Awesome MCP Servers
A comprehensive, automatically curated collection of awesome MCP (Model Context Protocol) servers
This list is automatically generated and updated to provide a comprehensive, unified resource for the MCP community. Featuring 7768 GitHub repositories with 414.3k total stars across 52 programming languages.
📊 Statistics
- Total Servers: 7964
- Categories: 13
- GitHub Repositories: 7768
- Total Stars: 414.3k
- Programming Languages: API Blueprint, AppleScript, Astro, Batchfile, Bicep, C, C#, C++, CMake, CSS, Clojure, ColdFusion, D, Dart, Dockerfile, EJS, Elixir, F#, GDScript, Go, HTML, Haskell, Java, JavaScript, Jupyter Notebook, Kotlin, Makefile, Nix, Open Policy Agent, PHP, PLpgSQL, Pascal, Php, PowerShell, Python, Rich Text Format, Roff, Ruby, Rust, Scala, Shell, Smalltalk, Smarty, Swift, TeX, TypeScript, V, VBScript, Vue, YAML, YARA, Zig
- Most Popular: context7 (⭐ 29.1k)
- Last Updated: 2025-10-28T21:54:39.230Z
📋 Table of Contents
- 🤖 AI/ML (2331)
- 🌐 Web Development (2378)
- 🗄️ Database (95)
- 🔌 API (187)
- ⚙️ DevOps (269)
- 💬 Communication (55)
- 📁 File Management (52)
- 🔐 Authentication (6)
- 📊 Monitoring (43)
- ✅ Testing (42)
- 📚 Documentation (7)
- 🔧 Utilities (139)
- 📦 Other (2360)
🤖 AI/ML
- context7 📜 🏠 (⭐ 29.1k, 🍴 1.5k, 🐛 80) - Context7 MCP Server -- Up-to-date code documentation for LLMs and AI code editors
javascriptllmmcpmcp-servervibe-codinggit clone https://github.com/upstash/context7 - fastmcp 🐍 🏠 (⭐ 17.3k, 🍴 1.2k, 🐛 176) - 🚀 The fast, Pythonic way to build MCP servers and clients
pythonagentsfastmcpllmsmcppip install git+https://github.com/jlowin/fastmcp - blender-mcp 🐍 🏠 (⭐ 13.1k, 🍴 1.2k, 🐛 28) - Python-based
pythonhttpgitgithubpip install git+https://github.com/ahujasid/blender-mcp - fastapi_mcp 🐍 🏠 📇 (⭐ 10.1k, 🍴 789, 🐛 95) - Expose your FastAPI endpoints as Model Context Protocol (MCP) tools, with Auth!
pythonaiauthenticationauthorizationclaudepip install git+https://github.com/tadata-org/fastapi_mcp - mcp-use 🐍 🏠 (⭐ 7.3k, 🍴 844, 🐛 39) - mcp-use is the easiest way to interact with mcp servers with custom agents
pythonagentagentsaimcppip install git+https://github.com/mcp-use/mcp-use - mcp-agent 🐍 🏠 (⭐ 7.2k, 🍴 731, 🐛 87) - Build effective agents using Model Context Protocol and simple workflow patterns
pythonagentsaiai-agentsllmpip install git+https://github.com/lastmile-ai/mcp-agent - browser-tools-mcp 📜 🏠 (⭐ 6.4k, 🍴 480, 🐛 115) - Monitor browser logs directly from Cursor and other MCP compatible IDEs.
javascriptaianthropiccursormcpnpm install AgentDeskAI/browser-tools-mcp - git-mcp 📘 🏠 ☁️ (⭐ 6k, 🍴 467, 🐛 43) - Put an end to code hallucinations! GitMCP is a free, open-source, remote MCP server for any GitHub project
typescriptagentic-aiagentsaiclaudenpm install idosal/git-mcp - cursor-talk-to-figma-mcp 📜 🏠 (⭐ 5.2k, 🍴 525, 🐛 66) - CTTF: MCP integration between Cursor AI and Figma, allowing Cursor to communicate with Figma like agentic ai for reading designs and modifying them programmatically.
javascriptagentagenticagentic-aiainpm install sonnylazuardi/cursor-talk-to-figma-mcp - whatsapp-mcp 🐹 🏠 (⭐ 4.8k, 🍴 706, 🐛 70) - WhatsApp MCP server (Go-based)
goaimcpwhatsappwhatsapp-apigo install lharries/whatsapp-mcp@latest - DesktopCommanderMCP 📜 🏠 ☁️ (⭐ 4.4k, 🍴 485, 🐛 67) - This is MCP server for Claude that gives it terminal control, file system search and diff file editing capabilities
javascriptagentaicode-analysiscode-generationnpm install wonderwhy-er/DesktopCommanderMCP - ida-pro-mcp 🐍 🏠 (⭐ 3.5k, 🍴 343, 🐛 30) - MCP Server for IDA Pro.
pythonclinecursorida-pluginida-propip install git+https://github.com/mrexodia/ida-pro-mcp - claude-context 📘 🏠 (⭐ 3.4k, 🍴 275, 🐛 38) - Code search MCP for Claude Code. Make entire codebase the context for any coding agent.
typescriptagentagentic-ragai-codingclaude-codegit clone https://github.com/zilliztech/claude-context - mcpo 🐍 🏠 📇 (⭐ 3.2k, 🍴 361, 🐛 43) - A simple, secure MCP-to-OpenAPI proxy server
pythonmcpmcp-servermcp-to-openapiopen-webuipip install git+https://github.com/open-webui/mcpo - unity-mcp 🔷 🏠 (⭐ 3.1k, 🍴 403, 🐛 27) - A Unity MCP server that allows MCP clients like Claude Desktop or Cursor to perform Unity Editor actions.
c#aiai-integrationanthropicclaudegit clone https://github.com/justinpbarnett/unity-mcp - MCP-Chinese-Getting-Started-Guide 🏠 (⭐ 2.8k, 🍴 166, 🐛 2) - Model Context Protocol(MCP) 编程极速入门
aideepseekmcpmcp-servermodelcontextprotocolgit clone https://github.com/liaokongVFX/MCP-Chinese-Getting-Started-Guide - langchain-mcp-adapters 🐍 🏠 (⭐ 2.7k, 🍴 257, 🐛 96) - LangChain 🔌 MCP (Python-based)
pythonlangchainlanggraphmcptoolspip install git+https://github.com/langchain-ai/langchain-mcp-adapters - Windows-MCP 🐍 🏠 (⭐ 2.6k, 🍴 284, 🐛 3) - Lightweight MCP Server for Computer Use in Windows
pythonaidesktopmcptoolspip install git+https://github.com/CursorTouch/Windows-MCP - mcp-server-browserbase 📘 🏠 (⭐ 2.5k, 🍴 279, 🐛 13) - Allow LLMs to control a browser with Browserbase and Stagehand
typescriptaibrowserchromechromiumnpm install browserbase/mcp-server-browserbase - mcp-context-forge 🐍 🏠 (⭐ 2.4k, 🍴 271, 🐛 221) - A Model Context Protocol (MCP) Gateway & Registry. Serves as a central management point for tools, resources, and prompts that can be accessed by MCP-compatible LLM applications. Converts REST API endpoints to MCP, composes virtual MCP servers with added security and observability, and converts between protocols (stdio, SSE, Streamable HTTP).
pythonagentsaiapi-gatewayasynciopip install git+https://github.com/IBM/mcp-context-forge - markdownify-mcp 📘 🏠 (⭐ 2.1k, 🍴 170, 🐛 13) - A Model Context Protocol server for converting almost anything to Markdown
typescriptaianthropicanthropic-aianthropic-claudenpm install zcaceres/mcp-markdownify-server - chatmcp 🎯 🏠 (⭐ 2k, 🍴 175, 🐛 40) - ChatMCP is an AI chat client implementing the Model Context Protocol (MCP).
dartaichatclientmcpgit clone https://github.com/daodao97/chatmcp - mcp-cli 🐍 🏠 (⭐ 1.7k, 🍴 288, 🐛 21) - Python-based
pythonhttpgitgithubpip install git+https://github.com/chrishayuk/mcp-cli - mcp-proxy 🐍 🏠 (⭐ 1.6k, 🍴 164, 🐛 25) - A bridge between Streamable HTTP and stdio MCP transports
pythonmcpmcp-serverproxyssepip install git+https://github.com/sparfenyuk/mcp-proxy - interactive-feedback-mcp 🐍 🏠 (⭐ 1.6k, 🍴 290, 🐛 28) - Interactive User Feedback MCP
pythonmcppip install git+https://github.com/noopstudios/interactive-feedback-mcp - codemcp 🐍 🏠 (⭐ 1.5k, 🍴 131, 🐛 78) - Coding assistant MCP for Claude Desktop
pythonmcphttpgitgithubpip install git+https://github.com/ezyang/codemcp - mcpelauncher-manifest 🏠 (⭐ 1.2k, 🍴 105, 🐛 654) - The main repository for the Linux and Mac OS Bedrock edition Minecraft launcher.
cmakebedrocklauncherlinuxmcpegit clone https://github.com/minecraft-linux/mcpelauncher-manifest - brightdata-mcp 📜 🏠 (⭐ 1.2k, 🍴 164, 🐛 9) - A powerful Model Context Protocol (MCP) server that provides an all-in-one solution for public web access.
javascriptai-agentsai-integrationsanti-bot-detectionbrowser-automationnpm install brightdata-com/brightdata-mcp - damn-vulnerable-MCP-server 🐍 🏠 (⭐ 1.2k, 🍴 98, 🐛 13) - Damn Vulnerable MCP Server
pythonmcpserverpip install git+https://github.com/harishsg993010/damn-vulnerable-MCP-server - postgres-mcp 🐍 🏠 (⭐ 1.1k, 🍴 119, 🐛 27) - Postgres MCP Pro provides configurable read/write access and performance analysis for you and your AI agents.
pythonmcpaipostgreshttppip install git+https://github.com/crystaldba/postgres-mcp - mcp-language-server 🐹 🏠 (⭐ 1.1k, 🍴 68, 🐛 27) - mcp-language-server gives MCP enabled clients access semantic tools like get definition, references, rename, and diagnostics.
goailanguage-server-protocolmcpmcp-servergo install isaacphi/mcp-language-server@latest - mcp-scan 🐍 🏠 (⭐ 1.1k, 🍴 105, 🐛 10) - Constrain, log and scan your MCP connections for security vulnerabilities.
pythonagentaimcpmodelcontextprotocolpip install git+https://github.com/invariantlabs-ai/mcp-scan - fast-mcp 💎 🏠 (⭐ 979, 🍴 76, 🐛 61) - A Ruby Implementation of the Model Context Protocol
rubyaillmmcprackgit clone https://github.com/yjacquin/fast-mcp - elevenlabs-mcp 🐍 🏠 (⭐ 966, 🍴 148, 🐛 7) - The official ElevenLabs MCP server
pythonelevenlabselevenlabs-apimcpserverpip install git+https://github.com/elevenlabs/elevenlabs-mcp-server - Office-PowerPoint-MCP-Server 🐍 🏠 (⭐ 944, 🍴 102, 🐛 21) - A MCP (Model Context Protocol) server for PowerPoint manipulation using python-pptx. This server provides tools for creating, editing, and manipulating PowerPoint presentations through the MCP protocol.
pythonmcpserverhttpgitpip install git+https://github.com/GongRzhe/Office-PowerPoint-MCP-Server - MiniMax-MCP 🐍 🏠 (⭐ 932, 🍴 146, 🐛 12) - Official MiniMax Model Context Protocol (MCP) server that enables interaction with powerful Text to Speech, image generation and video generation APIs.
pythonimage-generationimage-to-videomcpmcp-serverpip install git+https://github.com/MiniMax-AI/MiniMax-MCP - mcp-server-qdrant 🐍 🏠 (⭐ 903, 🍴 138, 🐛 25) - An official Qdrant Model Context Protocol (MCP) server implementation
pythonclaudecursorllmmcppip install git+https://github.com/qdrant/mcp-server-qdrant - unreal-mcp 🏠 (⭐ 901, 🍴 123, 🐛 25) - Enable AI assistant clients like Cursor, Windsurf and Claude Desktop to control Unreal Engine through natural language using the Model Context Protocol (MCP).
c++mcp-servermodelcontextprotocolunreal-engine-5mcpgit clone https://github.com/chongdashu/unreal-mcp - fetcher-mcp 📘 🏠 (⭐ 849, 🍴 64, 🐛 5) - MCP server for fetch web page content using Playwright headless browser.
typescriptaimcpplaywrightservernpm install jae-jae/fetcher-mcp - MCP-Bridge 🐍 🏠 (⭐ 848, 🍴 106, 🐛 31) - A middleware to provide an openAI compatible endpoint that can call MCP tools
pythonaiclaudemcpmcp-serverpip install git+https://github.com/SecretiveShell/MCP-Bridge - mcp-framework 📘 🏠 (⭐ 846, 🍴 94, 🐛 36) - A framework for writing MCP (Model Context Protocol) servers in Typescript
typescriptanthropicclaudegenaillmnpm install QuantGeekDev/mcp-framework - godot-mcp 📜 🏠 (⭐ 844, 🍴 86, 🐛 19) - MCP server for interfacing with Godot game engine. Provides tools for launching the editor, running projects, and capturing debug output.
javascriptaigodotmcpservernpm install Coding-Solo/godot-mcp - mcp-browser-use 🐍 🏠 (⭐ 810, 🍴 100, 🐛 13) - Python-based
pythonpip install git+https://github.com/Saik0s/mcp-browser-use - RedNote-MCP 📘 🏠 (⭐ 805, 🍴 110, 🐛 13) - 🚀MCP server for accessing RedNote(XiaoHongShu, xhs).
typescriptaimcpmcp-serverrednotenpm install iFurySt/RedNote-MCP - supabase-mcp-server 🐍 🏠 📇 (⭐ 786, 🍴 96, 🐛 4) - Query MCP enables end-to-end management of Supabase via chat interface: read & write query executions, management API support, automatic migration versioning, access to logs and much more.
pythoncursormodel-context-protocolsupabasewindsurfpip install git+https://github.com/alexander-zuev/supabase-mcp-server - hyper-mcp 🦀 🏠 (⭐ 784, 🍴 57, 🐛 17) - 📦️ A fast, secure MCP server that extends its capabilities through WebAssembly plugins.
rustaiextismllmmcpcargo install --git https://github.com/tuananh/hyper-mcp - awesome-devops-mcp-servers 🏠 (⭐ 766, 🍴 115, 🐛 3) - A curated list of awesome MCP servers focused on DevOps tools and capabilities.
aicloudnativedevopsgenaillmgit clone https://github.com/rohitg00/awesome-devops-mcp-servers - golf 🐍 🏠 (⭐ 741, 🍴 50, 🐛 1) - Production-Ready MCP Server Framework • Build, deploy & scale secure AI agent infrastructure • Includes Auth, Observability, Debugger, Telemetry & Runtime • Run real-world MCPs powering AI Agents
pythonagent-runtimeaiai-agentai-agent-toolsgit clone https://github.com/golf-mcp/golf - browser-use-mcp-server 🐍 🏠 (⭐ 727, 🍴 99, 🐛 13) - Browse the web, directly from Cursor etc.
pythonbrowserbrowser-usecursormcppip install git+https://github.com/co-browser/browser-use-mcp-server - kubectl-mcp-server 🐍 🏠 (⭐ 706, 🍴 128, 🐛 13) - Chat with your Kubernetes Cluster using AI tools and IDEs like Claude and Cursor!
pythonaideploymentdevopsgenaipip install git+https://github.com/rohitg00/kubectl-mcp-server - Office-Word-MCP-Server 🐍 🏠 (⭐ 703, 🍴 108, 🐛 37) - A Model Context Protocol (MCP) server for creating, reading, and manipulating Microsoft Word documents. This server enables AI assistants to work with Word documents through a standardized interface, providing rich document editing capabilities.
pythonmcpserveraihttppip install git+https://github.com/GongRzhe/Office-Word-MCP-Server - mcp-sequential-thinking 🐍 🏠 (⭐ 677, 🍴 79, 🐛 4) - Python-based
pythonpip install git+https://github.com/arben-adm/mcp-sequential-thinking - mcp-memory-service 🐍 🏠 (⭐ 657, 🍴 93, 🐛 3) - Universal MCP memory service with semantic search, multi-client support, and autonomous consolidation for Claude Desktop, VS Code, and 13+ AI applications
pythonchroma-dbchromadbclaudeclaude-codepip install git+https://github.com/doobidoo/mcp-memory-service - jupyter-mcp-server 🏠 (⭐ 649, 🍴 110, 🐛 12) - 🪐 ✨ Model Context Protocol (MCP) Server for Jupyter.
jupyter notebookaijupytermcpmcp-servergit clone https://github.com/datalayer/jupyter-mcp-server - mcp-client-cli 🐍 🏠 (⭐ 628, 🍴 78, 🐛 19) - A simple CLI to run LLM prompt and implement MCP client.
pythonlangchainllmmcpmodel-context-protocolpip install git+https://github.com/adhikasp/mcp-client-cli - mcpdoc 🐍 🏠 (⭐ 621, 🍴 77, 🐛 9) - Expose llms-txt to IDEs for development
pythonagentsclaude-codecursoridepip install git+https://github.com/langchain-ai/mcpdoc - context-portal 🐍 🏠 (⭐ 616, 🍴 65, 🐛 16) - Context Portal (ConPort): A memory bank MCP server building a project-specific knowledge graph to supercharge AI assistants. Enables powerful Retrieval Augmented Generation (RAG) for context-aware development in your IDE.
pythonmcpserveraidatabasegit clone https://github.com/GreatScottyMac/context-portal - mcp-server-docker 🐍 🏠 (⭐ 594, 🍴 77, 🐛 13) - MCP server for Docker
pythonmcpserverdockerhttppip install git+https://github.com/ckreiling/mcp-server-docker - mcp-mem0 🐍 🏠 (⭐ 542, 🍴 210, 🐛 12) - MCP server for long term agent memory with Mem0. Also useful as a template to get you started building your own MCP server with Python!
pythonmcpserverpip install git+https://github.com/coleam00/mcp-mem0 - android-mcp-server 🐍 🏠 (⭐ 525, 🍴 42, 🐛 3) - An MCP server that provides control over Android devices via adb
pythonmcpserverhttpgitpip install git+https://github.com/minhalvp/android-mcp-server - mcp-clickhouse 🐍 🏠 (⭐ 513, 🍴 105, 🐛 25) - Connect ClickHouse to your AI assistants.
pythonaidatabasehttpgitpip install git+https://github.com/ClickHouse/mcp-clickhouse - pg-mcp-server 🐍 🏠 (⭐ 504, 🍴 26, 🐛 7) - Python-based
pythonpip install git+https://github.com/stuzero/pg-mcp-server - mcp-server 🐍 🏠 📇 (⭐ 493, 🍴 83, 🐛 9) - An MCP server for interacting with the Financial Datasets stock market API.
pythonmcpserverapihttppip install git+https://github.com/financial-datasets/mcp-server - openmcp-client 🏠 (⭐ 483, 🍴 36, 🐛 7) - All in one vscode plugin for mcp developer
vueai-agentllmmcpgit clone https://github.com/LSTM-Kirigaya/openmcp-client - web-agent-protocol 🐍 🏠 (⭐ 477, 🍴 84, 🐛 7) - 🌐Web Agent Protocol (WAP) - Record and replay user interactions in the browser with MCP support
pythonai-agentsai-toolsbrowser-automationbrowser-usegit clone https://github.com/OTA-Tech-AI/webagentprotocol - mcp-server-data-exploration 🐍 🏠 (⭐ 475, 🍴 54, 🐛 7) - Python-based
pythonhttpcsvaigitpip install git+https://github.com/reading-plus-ai/mcp-server-data-exploration - ida-mcp-server 🐍 🏠 (⭐ 473, 🍴 51, 🐛 2) - A Model Context Protocol server for IDA
pythonserverpip install git+https://github.com/MxIris-Reverse-Engineering/ida-mcp-server - manim-mcp-server 🐍 🏠 (⭐ 457, 🍴 49, 🐛 5) - Python-based
pythonlocalhttpgitgithubpip install git+https://github.com/abhiemj/manim-mcp-server - mem0-mcp 🐍 🏠 (⭐ 445, 🍴 93, 🐛 12) - Python-based
pythonhttpaigitgithubpip install git+https://github.com/mem0ai/mem0-mcp - iterm-mcp 📘 🏠 (⭐ 438, 🍴 47, 🐛 11) - A Model Context Protocol server that executes commands in the current iTerm session - useful for REPL and CLI assistance
typescriptaiclaudeclaude-aimcpnpm install ferrislucas/iterm-mcp - duckduckgo-mcp-server 🐍 🏠 (⭐ 432, 🍴 88, 🐛 18) - A Model Context Protocol (MCP) server that provides web search capabilities through DuckDuckGo, with additional features for content fetching and parsing.
pythonmcpserverwebgopip install git+https://github.com/nickclyde/duckduckgo-mcp-server - mcp-gsuite 🐍 🏠 (⭐ 427, 🍴 86, 🐛 23) - MCP Server to interact with Google Gsuite prodcuts
pythonmcpservergohttppip install git+https://github.com/MarkusPfundstein/mcp-gsuite - mcp-pandoc 🐍 🏠 (⭐ 395, 🍴 53, 🐛 4) - MCP server for document format conversion using pandoc.
pythonpandocpandoc-markdownpandoc-templatemcppip install git+https://github.com/vivekVells/mcp-pandoc - clickup-mcp-server 📘 🏠 (⭐ 382, 🍴 107, 🐛 18) - ClickUp MCP Server - Integrate ClickUp project management with AI through Model Context Protocol
typescriptaiartificial-intelligenceclickupclickup-apinpm install TaazKareem/clickup-mcp-server - mcp-google-sheets 🐍 🏠 📇 (⭐ 377, 🍴 98, 🐛 5) - This MCP server integrates with your Google Drive and Google Sheets, to enable creating and modifying spreadsheets.
pythongooglemcpmcp-serverspreadsheetpip install git+https://github.com/xing5/mcp-google-sheets - mcp-for-security 📘 🏠 (⭐ 375, 🍴 61, 🐛 3) - MCP for Security: A collection of Model Context Protocol servers for popular security tools like SQLMap, FFUF, NMAP, Masscan and more. Integrate security testing and penetration testing into AI workflows.
javascriptaiai-toolsclaudefastmcpnpm install stanleyj03/mcp-for-security - mcp-remote-macos-use 🐍 🏠 ☁️ 📇 (⭐ 372, 🍴 44, 🐛 1) - The only general AI agent that does NOT requires extra API key, giving you full control on your local and remote MacOs from Claude Desktop App
pythonclaude-desktopcomputer-usegeneral-agentmacospip install git+https://github.com/baryhuang/mcp-remote-macos-use - dbt-mcp 🐍 🏠 (⭐ 369, 🍴 57, 🐛 25) - A MCP (Model Context Protocol) server for interacting with dbt.
pythondata-analyticsdata-engineeringllmmcppip install git+https://github.com/dbt-labs/dbt-mcp - mcp-hfspace 📘 🏠 (⭐ 353, 🍴 55, 🐛 12) - MCP Server to Use HuggingFace spaces, easy configuration and Claude Desktop mode.
httpgitgithubtypescriptmcpnpm install evalstate/mcp-hfspace - code-index-mcp 🐍 🏠 (⭐ 345, 🍴 38, 🐛 9) - A Model Context Protocol (MCP) server that helps large language models index, search, and analyze code repositories with minimal setup
pythonmcpserverpip install git+https://github.com/johnhuang316/code-index-mcp - linkedin-mcp-server 🐍 🏠 (⭐ 345, 🍴 61, 🐛 6) - This MCP server allows Claude and other AI assistants to access your LinkedIn. Scrape LinkedIn profiles and companies, get your recommended jobs, and perform job searches.
pythonanthropicchatgptchatgpt-desktopclaudepip install git+https://github.com/stickerdaniel/linkedin-mcp-server - mcp 🐍 🏠 📇 (⭐ 337, 🍴 37, 🐛 12) - Baidu Map MCP Server
pythonlbsmapmapsmcppip install git+https://github.com/baidu-maps/mcp - chroma-mcp 🐍 🏠 (⭐ 333, 🍴 59, 🐛 13) - A Model Context Protocol (MCP) server implementation that provides database capabilities for Chroma
pythonmcpserverdatabasehttppip install git+https://github.com/chroma-core/chroma-mcp - MCPSharp 🔷 🏠 (⭐ 327, 🍴 37, 🐛 11) - MCPSharp is a .NET library that helps you build Model Context Protocol (MCP) servers and clients - the standardized API protocol used by AI assistants and models.
c#aiaifunctionsdotnetdotnet-standardgit clone https://github.com/afrise/MCPSharp - mcp-server-motherduck 🐍 🏠 (⭐ 319, 🍴 40, 🐛 9) - MCP server for DuckDB and MotherDuck
pythonaiduckdbmotherduckmcppip install git+https://github.com/motherduckdb/mcp-server-motherduck - ableton-live-mcp-server 🐍 🏠 (⭐ 317, 🍴 44, 🐛 5) - MCP Server implementation for Ableton Live OSC control
pythonmcpserverhttpgitpip install git+https://github.com/Simon-Kansara/ableton-live-mcp-server - mcp-alchemy 🐍 🏠 (⭐ 314, 🍴 50) - A MCP (model context protocol) server that gives the LLM access to and knowledge about relational databases like SQLite, Postgresql, MySQL & MariaDB, Oracle, and MS-SQL.
pythonmcpserverdatabasellmpip install git+https://github.com/runekaagaard/mcp-alchemy - laravel-mcp-server 🐘 🏠 (⭐ 313, 🍴 29, 🐛 8) - A Laravel package for implementing secure Model Context Protocol servers using Streamable HTTP and SSE transport, providing real-time communication and a scalable tool system for enterprise environments.
phpailaravellaravel-packagellmgit clone https://github.com/opgginc/laravel-mcp-server - mcp-teams-server 🐍 🏠 (⭐ 308, 🍴 21, 🐛 8) - An MCP (Model Context Protocol) server implementation for Microsoft Teams integration, providing capabilities to read messages, create messages, reply to messages, mention members.
pythoninditexmcpmcp-servermsteamspip install git+https://github.com/InditexTech/mcp-teams-server - davinci-resolve-mcp 🐍 🏠 (⭐ 303, 🍴 29, 🐛 9) - MCP server integration for DaVinci Resolve
pythonblackmagicblackmagic-designblackmagicdesigndavinci-resolvepip install git+https://github.com/samuelgursky/davinci-resolve-mcp - telegram-mcp 🐍 🏠 📇 (⭐ 303, 🍴 94, 🐛 8) - Python-based
pythonhttpgitgithubtelegrampip install git+https://github.com/chigwell/telegram-mcp - UE5-MCP 🏠 (⭐ 303, 🍴 48, 🐛 6) - MCP for Unreal Engine 5
aiartificial-intelligencegame-developmentgame-enginemcpgit clone https://github.com/VedantRGosavi/UE5-MCP - mcp-hub 📜 🏠 (⭐ 302, 🍴 35, 🐛 10) - A centralized manager for Model Context Protocol (MCP) servers with dynamic server management and monitoring
javascriptaichatgptclaude-aillmsnpm install ravitemer/mcp-hub - mcp-sse 🐍 🏠 (⭐ 296, 🍴 50, 🐛 9) - A working pattern for SSE-based MCP clients and servers
pythonagentsllmmcptool-usepip install git+https://github.com/sidharthrajaram/mcp-sse - automcp 🐍 🏠 (⭐ 294, 🍴 40, 🐛 6) - Easily convert tool, agents and orchestrators from existing agent frameworks to MCP servers
pythonmcpserverpip install git+https://github.com/NapthaAI/automcp - mcp-server-azure-devops 📘 🏠 (⭐ 292, 🍴 84, 🐛 28) - An MCP server for Azure DevOps
typescriptaiazure-devopsclaudecopilotnpm install Tiberriver256/mcp-server-azure-devops - aws-mcp 📘 🏠 (⭐ 285, 🍴 34, 🐛 4) - Talk with your AWS using Claude. Model Context Protocol (MCP) server for AWS. Better Amazon Q alternative.
typescriptaiamazon-qawsclaudenpm install RafalWilinski/aws-mcp - BloodHound-MCP-AI 🐍 🏠 (⭐ 281, 🍴 45) - BloodHound-MCP-AI is integration that connects BloodHound with AI through Model Context Protocol, allowing security professionals to analyze Active Directory attack paths using natural language instead of complex Cypher queries.
pythonaibloodhoundbloodhoundadcypher-query-languagepip install git+https://github.com/mordavid/bloodhound-mcp-ai - freecad-mcp 🐍 🏠 (⭐ 280, 🍴 45, 🐛 3) - FreeCAD MCP(Model Context Protocol) server
pythonclaudefreecadmcpserverpip install git+https://github.com/neka-nat/freecad-mcp - mcp-apple-notes 📘 🏠 (⭐ 278, 🍴 27, 🐛 9) - Talk with your notes in Claude. RAG over your Apple Notes using Model Context Protocol.
typescriptaiclaudellmmcpnpm install RafalWilinski/mcp-apple-notes - kicad-mcp 🐍 🏠 (⭐ 276, 🍴 43, 🐛 10) - Model Context Protocol server for KiCad on Mac, Windows, and Linux
pythonserverhttpgitgithubpip install git+https://github.com/lamaalrajih/kicad-mcp - mcp-git-ingest 🐍 🏠 (⭐ 274, 🍴 38, 🐛 10) - A Model Context Protocol (MCP) server that helps read GitHub repository structure and important files.
pythongitllmmcpmodel-context-protocolpip install git+https://github.com/adhikasp/mcp-git-ingest - mcp-manager 📘 🏠 (⭐ 265, 🍴 40, 🐛 2) - simple web ui to manage mcp (model context protocol) servers in the claude app
typescriptclaudellmmcpmodel-context-protocolnpm install zueai/mcp-manager - mcp-nixos 🏠 (⭐ 265, 🍴 14, 🐛 6) - MCP-NixOS - Model Context Protocol Server for NixOS resources
htmlai-assistantai-integrationai-toolsanthropicgit clone https://github.com/utensils/nixmcp - mcp-graphql 📘 🏠 (⭐ 263, 🍴 43, 🐛 10) - Model Context Protocol server for GraphQL
typescriptaillmmcpmcp-servernpm install blurrah/mcp-graphql - mcp-router 📘 🏠 (⭐ 260, 🍴 24, 🐛 6) - A Unified MCP Server Management App
typescriptaillmllmopsmcpnpm install mcp-router/mcp-router - mcp-claude-code 🐍 🏠 (⭐ 259, 🍴 26, 🐛 3) - MCP implementation of Claude Code capabilities and more
pythonclaudeclaude-codemcpmcp-serverpip install git+https://github.com/SDGLBL/mcp-claude-code - atlas-mcp-server 📘 🏠 (⭐ 256, 🍴 38, 🐛 8) - A Model Context Protocol (MCP) server for ATLAS, a Neo4j-powered task management system for LLM Agents - implementing a three-tier architecture (Projects, Tasks, Knowledge) to manage complex workflows. Now with Deep Research.
typescriptagentsaideep-researchgraph-databasenpm install cyanheads/atlas-mcp-server - dify-mcp-server 🐍 🏠 (⭐ 256, 🍴 34, 🐛 2) - Model Context Protocol (MCP) Server for dify workflows
pythonmcpserverhttpgitpip install git+https://github.com/YanxingLiu/dify-mcp-server - meta-ads-mcp 🐍 🏠 ☁️ 📇 (⭐ 252, 🍴 66, 🐛 3) - MCP server to manage Facebook and Instagram Ads (Meta Ads)
pythonmcpserverapiremotepip install git+https://github.com/pipeboard-co/meta-ads-mcp - model-context-protocol-resources 🏠 (⭐ 249, 🍴 23, 🐛 1) - Exploring the Model Context Protocol (MCP) through practical guides, clients, and servers I've built while learning about this new protocol.
ai-agentsai-developmentdeveloper-guidesllm-toolsmcpgit clone https://github.com/cyanheads/model-context-protocol-resources - mcp-google-ads 🐍 🏠 (⭐ 248, 🍴 56, 🐛 7) - An MCP tool that connects Google Ads with Claude AI/Cursor and others, allowing you to analyze your advertising data through natural language conversations. This integration gives you access to campaign information, performance metrics, keyword analytics, and ad management—all through simple chat with Claude, Cursor or Windsurf.
pythonaiclaudegoogle-adsmcppip install git+https://github.com/cohnen/mcp-google-ads - aci-mcp 🐍 🏠 (⭐ 244, 🍴 37, 🐛 7) - MCP server(s) for Aipolabs ACI.dev
pythonmcpserveraipip install git+https://github.com/aipotheosis-labs/aci-mcp - perplexity-mcp 🐍 🏠 📇 (⭐ 240, 🍴 31, 🐛 5) - A Model Context Protocol (MCP) server that provides web search functionality using Perplexity AI's API.
pythonmcpserverapiwebpip install git+https://github.com/jsonallen/perplexity-mcp - gptr-mcp 🐍 🏠 (⭐ 237, 🍴 29, 🐛 9) - MCP server for enabling LLM applications to perform deep research via the MCP protocol
pythondeep-researchdeepresearchgpt-researchermcppip install git+https://github.com/assafelovic/gptr-mcp - chat-mcp 🏠 (⭐ 236, 🍴 32) - A Desktop Chat App that leverages MCP(Model Context Protocol) to interface with other LLMs.
htmlelectronmcpmcp-clientmodel-context-protocolgit clone https://github.com/AI-QL/chat-mcp - mcp-chatbot 🐍 🏠 📇 (⭐ 230, 🍴 23, 🐛 5) - A simple CLI chatbot that demonstrates the integration of the Model Context Protocol (MCP).
pythonmcpapihttpaipip install git+https://github.com/3choff/mcp-chatbot - mcp-neovim-server 📘 🏠 (⭐ 227, 🍴 20, 🐛 6) - Control Neovim using Model Context Protocol (MCP) and the official neovim/node-client JavaScript library
typescriptanthropicclaudemcpmodelcontextprotocolnpm install bigcodegen/mcp-neovim-server - mcp-ragdocs 📘 🏠 (⭐ 226, 🍴 27, 🐛 3) - An MCP server implementation that provides tools for retrieving and processing documentation through vector search, enabling AI assistants to augment their responses with relevant documentation context.
typescriptllmmcpmcp-serversragnpm install hannesrudolph/mcp-ragdocs - mcp-reddit 🐍 🏠 (⭐ 226, 🍴 30, 🐛 5) - A Model Context Protocol (MCP) server that provides tools for fetching and analyzing Reddit content.
pythonllmmcpmodel-context-protocolredditpip install git+https://github.com/adhikasp/mcp-reddit - argocd-mcp 📘 🏠 (⭐ 224, 🍴 25, 🐛 11) - An implementation of Model Context Protocol (MCP) server for Argo CD.
typescriptaiargocdargocd-mcpcontinuous-deliverynpm install akuity/argocd-mcp - FileScopeMCP 🏠 (⭐ 224, 🍴 22, 🐛 8) - Analyzes your codebase identifying important files based on dependency relationships. Generates diagrams and importance scores per file, helping AI assistants understand the codebase. Automatically parses popular programming languages such as Python, C, C++, Rust, Zig, Lua.
htmlaipythonrustfilegit clone https://github.com/admica/FileScopeMCP - ros-mcp-server 🐍 🏠 (⭐ 224, 🍴 44, 🐛 9) - Connect AI models like Claude & GPT with robots using MCP and ROS.
pythonmcpmcp-servermodelcontextprotocolrospip install git+https://github.com/lpigeon/ros-mcp-server - MCPControl 📘 🏠 (⭐ 222, 🍴 31, 🐛 33) - MCP server for Windows OS automation
typescriptaiclaudecomputer-controlcomputer-visionnpm install Cheffromspace/MCPControl - mssql_mcp_server 🐍 🏠 (⭐ 222, 🍴 61, 🐛 3) - A Model Context Protocol (MCP) server for Microsoft SQL Server that enables secure database interactions through a controlled interface. Allows AI assistants to safely list tables, read data, and execute SQL queries while maintaining security and structure.
pythonmcpserverdatabaseaipip install git+https://github.com/RichardHan/mssql_mcp_server - WireMCP 📜 🏠 (⭐ 215, 🍴 24, 🐛 7) - An MCP for WireShark (tshark). Empower LLM's with realtime network traffic analysis capability
javascriptllmmcpnetwork-analysiswiresharknpm install 0xkoda/wiremcp - video-editing-mcp 🐍 🏠 (⭐ 209, 🍴 27, 🐛 5) - MCP Interface for Video Jungle
pythonmcphttpgitgithubpip install git+https://github.com/burningion/video-editing-mcp - apktool-mcp-server 🐍 🏠 (⭐ 206, 🍴 25) - A MCP Server for APK Tool (Part of Android Reverse Engineering MCP Suites)
pythonaiandroidapktoolllmpip install git+https://github.com/zinja-coder/apktool-mcp-server - mcp-twikit 🐍 🏠 (⭐ 203, 🍴 27, 🐛 7) - A Model Context Protocol (MCP) server for interacting with Twitter.
pythonllmmcpmodel-context-protocolserverpip install git+https://github.com/adhikasp/mcp-twikit - prometheus-mcp-server 🐍 🏠 (⭐ 200, 🍴 43, 🐛 1) - A Model Context Protocol (MCP) server that enables AI assistants to query and analyze Prometheus metrics through standardized interfaces.
pythonaidevopsllmmcppip install git+https://github.com/pab1it0/prometheus-mcp-server - elasticsearch-mcp-server 🐍 🏠 (⭐ 199, 🍴 42, 🐛 6) - A Model Context Protocol (MCP) server implementation that provides Elasticsearch and OpenSearch interaction.
pythonmcpserverhttpgitpip install git+https://github.com/cr7258/elasticsearch-mcp-server - image-gen-server 🐍 🏠 (⭐ 199, 🍴 25, 🐛 7) - 一个能与Cursor集成的图片生成mcp server工具,实现调用即梦逆向接口
pythonmcpserverpip install git+https://github.com/fengin/image-gen-server - langchain-mcp 🐍 🏠 (⭐ 198, 🍴 24, 🐛 1) - Model Context Protocol tool support for LangChain
pythonaipip install git+https://github.com/rectalogic/langchain-mcp - obsidian-mcp-server 📘 🏠 (⭐ 197, 🍴 30, 🐛 9) - Obsidian Knowledge-Management MCP (Model Context Protocol) server that enables AI agents and development tools to interact with an Obsidian vault. It provides a comprehensive suite of tools for reading, writing, searching, and managing notes, tags, and frontmatter, acting as a bridge to the Obsidian Local REST API plugin.
typescriptai-toolsknowledge-basellmllm-agentnpm install cyanheads/obsidian-mcp-server - mcp-foundry 🐍 🏠 (⭐ 196, 🍴 82, 🐛 23) - A MCP Server for Azure AI Foundry
pythonmcpserveraiazurepip install git+https://github.com/azure-ai-foundry/mcp-foundry - doris-mcp-server 🐍 🏠 (⭐ 192, 🍴 51, 🐛 9) - Apache Doris MCP Server
pythonmcpserverailakehousepip install git+https://github.com/FreeOnePlus/doris-mcp-server - foundry-mcp-server 📘 🏠 (⭐ 191, 🍴 28, 🐛 3) - An experimental MCP Server for foundry built for Solidity devs
typescriptaiblockchainmcp-serversoliditynpm install PraneshASP/foundry-mcp-server - armor-crypto-mcp 🐍 🏠 (⭐ 188, 🍴 26, 🐛 2) - The MCP server for interacting with Blockchain, Swaps, Strategic Planning and more.
pythonaiai-agentscryptocurrencymcppip install git+https://github.com/armorwallet/armor-crypto-mcp - mindmap-mcp-server 🐍 🏠 (⭐ 188, 🍴 16, 🐛 3) - mindmap, mcp server, artifact
pythonartifactmcp-servermindmapmcppip install git+https://github.com/YuChenSSR/mindmap-mcp-server - easy-mcp 📘 🏠 (⭐ 183, 🍴 10, 🐛 1) - Absurdly easy Model Context Protocol Servers in Typescript
typescriptaibunclaudeclaude-ainpm install zcaceres/easy-mcp - rust-docs-mcp-server 🦀 🏠 (⭐ 183, 🍴 27, 🐛 14) - 🦀 Prevents outdated Rust code suggestions from AI assistants. This MCP server fetches current crate docs, uses embeddings/LLMs, and provides accurate context via a tool call.
rustaiai-safetycachingcargocargo install --git https://github.com/Govcraft/rust-docs-mcp-server - generator 🐘 🏠 (⭐ 180, 🍴 9, 🐛 23) - CTX: A tool for generating structured documentation from files, repositories, diffs, and URLs through a modular architecture with powerful configuration options for AI-assisted development workflows. The missing link between your codebase and your LLM. Context as Code (CaC) tool with MCP server inside.
phpcontextinstructionsllmmcpgit clone https://github.com/context-hub/generator - mcp-injection-experiments 🐍 🏠 (⭐ 180, 🍴 17, 🐛 3) - Code snippets to reproduce MCP tool poisoning attacks.
pythonmcppip install git+https://github.com/invariantlabs-ai/mcp-injection-experiments - mcp-linker 📘 🏠 (⭐ 179, 🍴 17, 🐛 3) - mcp manager, add & syncs MCP server configurations across clients like Claude, Cursor💡 build-in AI assistant
typescriptaiawesomeclaudedxtnpm install milisp/mcp-linker - reddit-mcp 🐍 🏠 (⭐ 179, 🍴 25, 🐛 3) - Model Context Protocol server implementation for Reddit
pythonmcpmcp-serverredditreddit-apipip install git+https://github.com/Arindam200/reddit-mcp - kagimcp 🐍 🏠 📇 (⭐ 174, 🍴 19, 🐛 2) - The Official Model Context Protocol (MCP) server for Kagi search & other tools.
pythonmcpserverapiwebpip install git+https://github.com/kagisearch/kagimcp - mcp-server-milvus 🐍 🏠 (⭐ 173, 🍴 46, 🐛 14) - Model Context Protocol Servers for Milvus
pythonserverdatabasehttpgitpip install git+https://github.com/zilliztech/mcp-server-milvus - omnicoreagent 🐍 🏠 (⭐ 173, 🍴 41) - OmniCoreAgent is the complete AI development platform that combines two powerful systems into one revolutionary ecosystem. Build production-ready AI agents with OmniAgent, use the advanced MCP client with MCPOmni Connect, or combine both for maximum power.
pythonagentfastapimcpmcp-clientgit clone https://github.com/Abiorh001/mcp_connect - tripo-mcp 🐍 🏠 (⭐ 172, 🍴 23, 🐛 7) - Official MCP server for Tripo
pythonmcpserverpip install git+https://github.com/VAST-AI-Research/tripo-mcp - hass-mcp 🐍 🏠 (⭐ 171, 🍴 28, 🐛 3) - Home Assistant MCP Server
pythonhome-assistanthome-automationmcpmcp-serverpip install git+https://github.com/voska/hass-mcp - mcp-ical 🐍 🏠 (⭐ 171, 🍴 42, 🐛 12) - A Model Context Protocol Server that allows you to interact with your MacOS Calendar through natural language.
pythonicalendarllmmcpmcp-serverpip install git+https://github.com/Omar-v2/mcp-ical - mcp-server-deep-research 🐍 🏠 (⭐ 171, 🍴 17, 🐛 3) - Python-based
pythonhttpaiopenaigitpip install git+https://github.com/reading-plus-ai/mcp-server-deep-research - supabase-mcp 🐍 🏠 (⭐ 171, 🍴 97, 🐛 1) - Supabase MCP server created in Python.
pythonmcpserverpip install git+https://github.com/coleam00/supabase-mcp - imagesorcery-mcp 🐍 🏠 (⭐ 167, 🍴 19, 🐛 2) - An MCP server providing tools for image processing operations
pythoncomputer-visionimage-editingimage-manipulationimage-processingpip install git+https://github.com/sunriseapps/imagesorcery-mcp - unsplash-mcp-server 🐍 🏠 (⭐ 164, 🍴 18, 🐛 3) - 🔎 A MCP server for Unsplash image search.
pythonmcp-serverpython3unsplash-mcpmcppip install git+https://github.com/hellokaton/unsplash-mcp-server - mac_messages_mcp 🐍 🏠 (⭐ 163, 🍴 18, 🐛 8) - An MCP server that securely interfaces with your iMessage database via the Model Context Protocol (MCP), allowing LLMs to query and analyze iMessage conversations. It includes robust phone number validation, attachment processing, contact management, group chat handling, and full support for sending and receiving messages.
pythonapplescriptclaudecontactscursorpip install git+https://github.com/carterlasalle/mac_messages_mcp - mcp-server 🐍 🏠 (⭐ 160, 🍴 43, 🐛 5) - This MCP server provides documentation about Strands Agents to your GenAI tools, so you can use your favorite AI coding assistant to vibe-code Strands Agents.
pythonagenticagentic-aiagentsaipip install git+https://github.com/strands-agents/mcp-server - mcp-server-tree-sitter 🐍 🏠 (⭐ 160, 🍴 21, 🐛 11) - MCP Server for Tree-sitter
pythonai-assistantastclaudeclaude-aipip install git+https://github.com/wrale/mcp-server-tree-sitter - mcp-server-siri-shortcuts 📘 🏠 (⭐ 159, 🍴 14) - MCP for calling Siri Shorcuts from LLMs
typescriptllmmcpmodel-context-protocolsiri-shortcutsnpm install dvcrn/mcp-server-siri-shortcuts - bilibili-mcp-server 🐍 🏠 📇 (⭐ 157, 🍴 30, 🐛 2) - MCP Server for the Bilibili API, supporting various operations.
pythonmcpserverapipip install git+https://github.com/huccihuang/bilibili-mcp-server - jadx-mcp-server 🐍 🏠 (⭐ 157, 🍴 23) - MCP server for JADX-AI Plugin
pythonaiandroid-hackingandroid-reverse-engineeringapplication-securitypip install git+https://github.com/zinja-coder/jadx-mcp-server - mcp-text-editor 🐍 🏠 (⭐ 156, 🍴 21, 🐛 4) - Python-based
pythonfilehttpllmgitpip install git+https://github.com/tumf/mcp-text-editor - phone-mcp 🐍 🏠 (⭐ 155, 🍴 20, 🐛 5) - A phone control plugin for MCP that allows you to control your Android phone through ADB commands to connect any human
pythonagentandroidmcpmcp-serverpip install git+https://github.com/hao-cyber/phone-mcp - hwp-mcp 🐍 🏠 (⭐ 154, 🍴 33, 🐛 4) - mcp for handling hwp
pythonmcppip install git+https://github.com/jkf87/hwp-mcp - composer-trade-mcp 🐍 🏠 (⭐ 153, 🍴 30, 🐛 4) - Composer's MCP server lets MCP-enabled LLMs like Claude backtest trading ideas and automatically invest in them for you
pythonai-tradingautomated-trading-strategiesbacktestingclaude-desktoppip install git+https://github.com/invest-composer/composer-trade-mcp - mcp-scholarly 🐍 🏠 (⭐ 151, 🍴 22, 🐛 3) - A MCP server to search for accurate academic articles.
pythonmcpserverhttpgitpip install git+https://github.com/adityak74/mcp-scholarly - mcp-simple-arxiv 🐍 🏠 (⭐ 148, 🍴 19, 🐛 2) - Tool to work with arXiv, provide LLM with ability to search and read papers from there
pythonllmhttpgitgithubpip install git+https://github.com/andybrandt/mcp-simple-arxiv - playwright-plus-python-mcp 🐍 🏠 (⭐ 148, 🍴 23, 🐛 5) - Python-based
pythonhttpllmgitgithubpip install git+https://github.com/blackwhite084/playwright-plus-python-mcp - ProxmoxMCP 🐍 🏠 (⭐ 145, 🍴 38, 🐛 10) - MCP for Proxmox integration in Cline
pythonmcppip install git+https://github.com/canvrno/ProxmoxMCP - ida-mcp-server-plugin 🐍 🏠 (⭐ 144, 🍴 27, 🐛 3) - IDA Pro Plugin for serving MCP SSE server for cursor / claude
pythonmcpserverpip install git+https://github.com/taida957789/ida-mcp-server-plugin - mcp-pinecone 🐍 🏠 📇 (⭐ 143, 🍴 31, 🐛 6) - Model Context Protocol server to allow for reading and writing from Pinecone. Rudimentary RAG
pythonclaudemcpmcp-servermodel-context-protocolpip install git+https://github.com/sirmews/mcp-pinecone - cli-mcp-server 🐍 🏠 (⭐ 141, 🍴 22, 🐛 5) - Command line interface for MCP clients with secure execution and customizable security policies
pythonmcphttpmlgitpip install git+https://github.com/MladenSU/cli-mcp-server - any-chat-completions-mcp 📜 🏠 📇 (⭐ 140, 🍴 23, 🐛 5) - MCP Server for using any LLM as a Tool
apihttpaiopenaigitnpm install pyroprompts/any-chat-completions-mcp - mcp-client-go 🐹 🏠 (⭐ 140, 🍴 17, 🐛 1) - mcp client for Go (Golang). Integrate multiple Model Context Protocol (MCP) servers
goaideepseekgo-librarygolanggo install yincongcyincong/mcp-client-go@latest - secops-mcp 🐍 🏠 (⭐ 140, 🍴 17, 🐛 4) - All-in-one security testing toolbox that brings together popular open source tools through a single MCP interface. Connected to an AI agent, it enables tasks like pentesting, bug bounty hunting, threat hunting, and more.
pythonmcpaitestinghttppip install git+https://github.com/securityfortech/secops-mcp - mcp 📜 🏠 (⭐ 138, 🍴 19, 🐛 5) - Official Magic UI MCP server.
javascriptaimagicuimagicuidesignmcpnpm install magicuidesign/mcp - meilisearch-mcp 🐍 🏠 📇 (⭐ 137, 🍴 17, 🐛 6) - A Model Context Protocol (MCP) server for interacting with Meilisearch through LLM interfaces.
pythonagentmcpmeilisearchmodelcontextprotocolpip install git+https://github.com/meilisearch/meilisearch-mcp - MCP-Salesforce 🐍 🏠 (⭐ 136, 🍴 46, 🐛 6) - MCP Salesforce connector
pythonmcpmodelcontextprotocolsalesforceserverpip install git+https://github.com/smn2gnt/MCP-Salesforce - facebook-ads-library-mcp 🐍 🏠 📇 (⭐ 134, 🍴 13, 🐛 1) - MCP Server for Facebook ADs Library - Get instant answers from FB's ad library
pythonaianalyticsapifacebookpip install git+https://github.com/trypeggy/facebook-ads-library-mcp - google-analytics-mcp 🐍 🏠 (⭐ 134, 🍴 27, 🐛 6) - Google Analytics 4 MCP Server for Claude, Cursor, Windsurf etc - Access GA4 data through natural language with 200+ dimensions & metrics
pythonmcpservergohttppip install git+https://github.com/surendranb/google-analytics-mcp - awesome-mcp-registry 📘 🏠 (⭐ 133, 🍴 19, 🐛 1) - Awesome MCP Servers and Packages Registry and Database with Structured JSON configurations
typescriptaiai-agentai-toolsawesomenpm install toolsdk-ai/awesome-mcp-registry - mcp-server-langfuse 📘 🏠 (⭐ 132, 🍴 31, 🐛 9) - Model Context Protocol (MCP) Server for Langfuse Prompt Management. This server allows you to access and manage your Langfuse prompts through the Model Context Protocol.
typescriptlangfusellmllmopsmcpnpm install langfuse/mcp-server-langfuse - OpenDataMCP 🐍 🏠 (⭐ 132, 🍴 19, 🐛 6) - Connect any Open Data to any LLM with Model Context Protocol.
pythonllmmcpopen-datahttppip install git+https://github.com/OpenDataMCP/OpenDataMCP - servicenow-mcp 🐍 🏠 (⭐ 132, 🍴 115, 🐛 11) - MCP Server for ServiceNow
pythonmcpserverhttpaipip install git+https://github.com/osomai/servicenow-mcp - flights-mcp 🐍 🏠 (⭐ 131, 🍴 24, 🐛 7) - An MCP server to search for flights.
pythonmcpserverpip install git+https://github.com/ravinahp/flights-mcp - ticktick-mcp 🐍 🏠 📇 (⭐ 131, 🍴 49, 🐛 16) - MCP server that interacts with TickTick (Dida 365) via the TickTick Open API
pythonmcpserverapipip install git+https://github.com/jacepark12/ticktick-mcp - mcp-shell-server 🐍 🏠 (⭐ 130, 🍴 38, 🐛 5) - Python-based
pythonhttpgitgithubpip install git+https://github.com/tumf/mcp-shell-server - utcp-mcp 🐍 🏠 (⭐ 128, 🍴 14, 🐛 2) - All-in-one MCP server that can connect your AI agents to any native endpoint, powered by UTCP
pythonaiai-agentdeveloper-toolsllmpip install git+https://github.com/universal-tool-calling-protocol/utcp-mcp - mcp-think-tool 🐍 🏠 (⭐ 127, 🍴 16, 🐛 8) - An MCP server implementing the think tool for Claude
pythonmcpserverpip install git+https://github.com/DannyMac180/mcp-think-tool - quick-data-mcp 🐍 🏠 (⭐ 127, 🍴 25, 🐛 2) - Prompt focused MCP Server for .json and .csv agentic data analytics for Claude Code
pythonmcpserverjsonpip install git+https://github.com/disler/quick-data-mcp - mcp-server-aws 🐍 🏠 (⭐ 126, 🍴 25) - A Model Context Protocol server implementation for operations on AWS resources
pythonanthropicawsclaudemcppip install git+https://github.com/rishikavikondala/mcp-server-aws - mcp-simple-pubmed 🐍 🏠 (⭐ 126, 🍴 24, 🐛 3) - MCP server for searching and querying PubMed medical papers/research database
pythonmcpserverdatabasehttppip install git+https://github.com/andybrandt/mcp-simple-pubmed - mcp-server-plugin 🎯 🏠 (⭐ 124, 🍴 41, 🐛 22) - JetBrains MCP Server Plugin
kotlinmcpserveraigit clone https://github.com/JetBrains/mcp-server-plugin - Google-Scholar-MCP-Server 🐍 🏠 (⭐ 123, 🍴 21, 🐛 8) - A MCP Server for Google Scholar: 🔍 Enable AI assistants to search and access Google Scholar papers through a simple MCP interface.
pythonmcpserveraigopip install git+https://github.com/JackKuo666/Google-Scholar-MCP-Server - aws-cost-explorer-mcp-server 🐍 🏠 (⭐ 122, 🍴 28, 🐛 3) - MCP server for understanding AWS spend
pythonbedrockclaude-desktopcostcost-explorerpip install git+https://github.com/aarora79/aws-cost-explorer-mcp-server - solana-mcp 🐚 🏠 (⭐ 122, 🍴 42, 🐛 1) - A Model Context Protocol server for interacting with the Solana blockchain, powered by the Solana Agent Kit (https://github.com/sendaifun/solana-agent-kit)
shellserveraihttpjavascriptgit clone https://github.com/sendaifun/solana-mcp - git-mcp-server 📘 🏠 (⭐ 121, 🍴 25, 🐛 4) - An MCP (Model Context Protocol) server enabling LLMs and AI agents to interact with Git repositories. Provides tools for comprehensive Git operations including clone, commit, branch, diff, log, status, push, pull, merge, rebase, worktree, tag management, and more, via the MCP standard. STDIO & HTTP.
typescriptaienterprise-readygitgit-servernpm install cyanheads/git-mcp-server - mcp-discord 🐍 🏠 (⭐ 121, 🍴 34, 🐛 14) - MCP server for discord bot
pythonmcpserverpip install git+https://github.com/hanweg/mcp-discord - mcp-toolbox-sdk-python 🐍 🏠 (⭐ 121, 🍴 26, 🐛 18) - Python SDK for interacting with the MCP Toolbox for Databases.
pythondatabasesgenailangchainlangchain-pythonpip install git+https://github.com/googleapis/mcp-toolbox-sdk-python - mcp-summarizer 📜 🏠 (⭐ 120, 🍴 18, 🐛 7) - MCP Server for AI Summarization
javascriptaiai-summarizerbookbookreadernpm install 0xshellming/mcp-summarizer - mcp-use-ts 📘 🏠 (⭐ 120, 🍴 24, 🐛 19) - 🚀 mcp-use is a TypeScript library that makes it easy to connect LangChain.js-compatible LLMs with MCP servers. Build powerful, flexible AI agents with dynamic tool access and multi-server support.
typescriptagentlangchainllmmcpnpm install zandko/mcp-use - yahoo-finance-mcp 🐍 🏠 (⭐ 120, 🍴 68, 🐛 2) - This is a Model Context Protocol (MCP) server that provides comprehensive financial data from Yahoo Finance. It allows you to retrieve detailed information about stocks, including historical prices, company information, financial statements, options data, and market news.
pythonmcpmcp-serveryahoo-financeyfinancepip install git+https://github.com/Alex2Yang97/yahoo-finance-mcp - mcp-server-calculator 🐍 🏠 (⭐ 118, 🍴 17, 🐛 6) - A Model Context Protocol server for calculating.
pythonserverhttpllmgitpip install git+https://github.com/githejie/mcp-server-calculator - buttplug-mcp 🐹 🏠 (⭐ 116, 🍴 1, 🐛 1) - Buttplug.io Model Context Protocol (MCP) Server
gobuttplugllmmcpmcp-servergo install conacademy/buttplug-mcp@latest - dart-mcp-server 📘 🏠 (⭐ 115, 🍴 26, 🐛 4) - Dart AI Model Context Protocol (MCP) server
typescriptaidartmcpservernpm install its-dart/dart-mcp-server - mcp-chat 📘 🏠 (⭐ 115, 🍴 13, 🐛 4) - Open Source Generic MCP Client for testing & evaluating mcp servers and agents
typescriptaillmmcpservernpm install flux159/mcp-chat - mcp-server-starrocks 🐍 🏠 (⭐ 115, 🍴 34, 🐛 1) - StarRocks MCP (Model Context Protocol) Server
pythonagentaidatabasemcp-serverpip install git+https://github.com/StarRocks/mcp-server-starrocks - mcp-package-version 🐹 🏠 (⭐ 113, 🍴 22, 🐛 3) - An MCP server that provides LLMs with the latest stable package versions when coding
goaijavascriptllmmcpgo install sammcj/mcp-package-version@latest - mcp-solver 🐍 🏠 (⭐ 113, 🍴 13, 🐛 6) - Model Context Protocol (MCP) server for constraint optimization and solving"
pythonmcpserveraihttppip install git+https://github.com/szeider/mcp-solver - elevenlabs-mcp-server 🐍 🏠 📇 (⭐ 112, 🍴 22, 🐛 3) - Python-based
pythonapihttpgitgithubpip install git+https://github.com/mamertofabian/elevenlabs-mcp-server - py-mcp-naver 🐍 🏠 (⭐ 112, 🍴 19, 🐛 2) - python MCP NAVER
pythonmcphttpgitgithubpip install git+https://github.com/pfldy2850/py-mcp-naver - photoshop-python-api-mcp-server 🐍 🏠 📇 (⭐ 111, 🍴 7, 🐛 13) - A Model Context Protocol (MCP) server that interfaces with Adobe Photoshop's Python API. Enables LLMs to execute image editing operations, automate workflows, and manage Photoshop tasks through structured commands and context-aware interactions.
pythonmcpserverapillmpip install git+https://github.com/loonghao/photoshop-python-api-mcp-server - cursor-notebook-mcp 🐍 🏠 (⭐ 110, 🍴 10, 🐛 10) - Model Context Protocol (MCP) server designed to allow AI agents within Cursor to interact with Jupyter Notebook (.ipynb) files
pythoncursoripynbjupyterjupyter-notebookpip install git+https://github.com/jbeno/cursor-notebook-mcp - LMStudio-MCP 🐚 🏠 (⭐ 110, 🍴 15) - A Model Control Protocol (MCP) server that allows Claude to communicate with locally running LLM models via LM Studio.
shellmcpserverllmgit clone https://github.com/infinitimeless/LMStudio-MCP - codeql-mcp 🐍 🏠 (⭐ 108, 🍴 15, 🐛 4) - This project runs a Model Context Protocol (MCP) server that wraps the CodeQL query server. It enables tools like Cursor or AI agents to interact with CodeQL through structured commands.
pythonmcpserveraihttppip install git+https://github.com/JordyZomer/codeql-mcp - crawl4ai-mcp-server 🐍 🏠 (⭐ 108, 🍴 21, 🐛 3) - 用于提供给本地开发者的 LLM的高效互联网搜索&内容获取的MCP Server, 节省你的token
pythonmcpserverllmpip install git+https://github.com/weidwonder/crawl4ai-mcp-server - MCP2Lambda 🐍 🏠 (⭐ 108, 🍴 19, 🐛 3) - Run any AWS Lambda function as a Large Language Model (LLM) tool without code changes using Anthropic's Model Context Protocol (MCP).
pythonaiawsaws-lambdagenerative-aipip install git+https://github.com/danilop/MCP2Lambda - agentql-mcp 📜 🏠 (⭐ 107, 🍴 25, 🐛 3) - Model Context Protocol server that integrates AgentQL's data extraction capabilities.
javascriptagentagentqlaiaiagentnpm install tinyfish-io/agentql-mcp - mcp-server-wazuh 🦀 🏠 (⭐ 107, 🍴 31, 🐛 4) - MCP Server for Wazuh SIEM
rustllmmcpmcp-servermodel-context-procargo install --git https://github.com/gbrigandi/mcp-server-wazuh - ultimate_mcp_server 🐍 🏠 (⭐ 106, 🍴 16, 🐛 5) - The Ultimate Model Context Protocol (MCP) Server, providing unified access to a wide variety of useful and powerful tools.
pythonagentllmmcpmcp-serverpip install git+https://github.com/Dicklesworthstone/llm_gateway_mcp_server - logfire-mcp 🐍 🏠 (⭐ 105, 🍴 18, 🐛 7) - The Logfire MCP Server is here! :tada:
pythonmcpserverhttpgitpip install git+https://github.com/pydantic/logfire-mcp - open-streetmap-mcp 🐍 🏠 (⭐ 105, 🍴 27, 🐛 8) - An OpenStreetMap MCP server implementation that enhances LLM capabilities with location-based services and geospatial data.
pythonanthropic-claudellmmcpmcp-serverpip install git+https://github.com/jagan-shanmugam/open-streetmap-mcp - mcp-logseq 🐍 🏠 📇 (⭐ 103, 🍴 13, 🐛 4) - MCP server to interact with LogSeq via its Local HTTP API - enabling AI assistants like Claude to seamlessly read, write, and manage your LogSeq graph.
pythonmcpserverapiaipip install git+https://github.com/ergut/mcp-logseq-server - mcp-hubspot 🐍 🏠 📇 (⭐ 102, 🍴 50, 🐛 1) - A Model Context Protocol (MCP) server that enables AI assistants to interact with HubSpot CRM data, providing built-in vector storage and caching mechanisms help overcome HubSpot API limitations while improving response times.
pythoncrmfaissfaiss-vector-databasehubspotpip install git+https://github.com/buryhuang/mcp-hubspot - superset-mcp 🐍 🏠 (⭐ 101, 🍴 22, 🐛 14) - connect to 50+ data stores via superset mcp server. Can use with open ai agent sdk, Claude app, cursor, windsurf
pythonmcpserveraipip install git+https://github.com/aptro/superset-mcp - mcp-mianshiya-server ☕ 🏠 (⭐ 100, 🍴 25, 🐛 13) - 基于 Spring AI 的面试鸭搜索题目的 MCP Server 服务,快速让 AI 搜索企业面试真题和答案
javaaibackendinterview-questionsmcpgit clone https://github.com/gulihua10010/mcp-mianshiya-server - MCP-searxng 🐍 🏠 (⭐ 99, 🍴 14, 🐛 1) - MCP server for connecting agentic systems to search systems via searXNG
pythonmcpserverhttpgitpip install git+https://github.com/SecretiveShell/MCP-searxng - remote-mcp-apim-functions-python 🏠 📇 (⭐ 99, 🍴 54, 🐛 14) - Azure API Management as AI Gateway to Remote MCP servers.
bicepmcpserverapiaigit clone https://github.com/Azure-Samples/remote-mcp-apim-functions-python - chronulus-mcp 🐍 🏠 (⭐ 97, 🍴 16, 🐛 4) - MCP Server for Chronulus AI Forecasting and Prediction Agents
httpaigitgithubpythonpip install git+https://github.com/ChronulusAI/chronulus-mcp - mcp-watch 📘 🏠 📇 (⭐ 96, 🍴 8, 🐛 4) - A comprehensive security scanner for Model Context Protocol (MCP) servers that detects vulnerabilities and security issues in your MCP server implementations.
typescriptagentic-aianthropicmcpservernpm install kapilduraphe/mcp-watch - wikipedia-mcp 🐍 🏠 (⭐ 96, 🍴 22, 🐛 1) - A Model Context Protocol (MCP) server that retrieves information from Wikipedia to provide context to LLMs.
pythonanthropicllmmcp-serveropen-sourcepip install git+https://github.com/Rudra-ravi/wikipedia-mcp - mcp_polygon 🐍 🏠 📇 (⭐ 95, 🍴 20, 🐛 6) - An MCP server for Polygon.io Financial Market Data
pythoncryptocurrencyfintechllmmarket-datapip install git+https://github.com/polygon-io/mcp_polygon - mcp-google-map 📘 🏠 📇 (⭐ 95, 🍴 33) - A powerful Model Context Protocol (MCP) server providing comprehensive Google Maps API integration with LLM processing capabilities.
typescriptaidivegoogle-mapmcpnpm install cablate/mcp-google-map - mcp-tool-kit 🐍 🏠 (⭐ 95, 🍴 14, 🐛 2) - Agentic abstraction layer for building high precision vertical AI agents written in python for Model Context Protocol.
pythonagentic-aienterprisegenerative-aillmpip install git+https://github.com/getfounded/mcp-tool-kit - remote-mcp-functions-python 🏠 (⭐ 95, 🍴 44, 🐛 4)
bicepgit clone https://github.com/Azure-Samples/remote-mcp-functions-python - freecad_mcp 🐍 🏠 (⭐ 91, 🍴 19, 🐛 9) - FreecadMCP connects Freecad to Claude AI and other MCP-ready tools like Cursor through the Model Context Protocol (MCP), allowing Claude to directly interact with and control Freecad. This integration enables prompt assisted CAD 3d Design.
pythonmcpaipip install git+https://github.com/bonninr/freecad_mcp - flyworks-mcp 🐍 🏠 (⭐ 90, 🍴 13, 🐛 1) - Fast and free zeroshot lipsync MCP server
pythonmcpserverhttpaipip install git+https://github.com/Flyworks-AI/flyworks-mcp - zettelkasten-mcp 🐍 🏠 (⭐ 89, 🍴 14, 🐛 6) - A Model Context Protocol (MCP) server that implements the Zettelkasten knowledge management methodology, allowing you to create, link, explore and synthesize atomic notes through Claude and other MCP-compatible clients.
pythonclaudeknowledge-graphllmmarkdownpip install git+https://github.com/entanglr/zettelkasten-mcp - UnityMCPIntegration 🔷 🏠 (⭐ 88, 🍴 19, 🐛 4) - Enable AI Agents to Control Unity
c#aigame-developmentmcpunitygit clone https://github.com/quazaai/UnityMCPIntegration - all-in-one-model-context-protocol 🏠 (⭐ 87, 🍴 8, 🐛 2) - 🚀 All-in-one MCP server with AI search, RAG, and multi-service integrations (GitLab/Jira/Confluence/YouTube) for AI-enhanced development workflows
deepseekmcpmodel-context-protocolserveraigit clone https://github.com/nguyenvanduocit/all-in-one-model-context-protocol - mcp-server-apache-airflow 🐍 🏠 (⭐ 86, 🍴 24, 🐛 10) - Python-based
pythonhttpaigitgithubpip install git+https://github.com/yangkyeongmo/mcp-server-apache-airflow - zin-mcp-client 🐍 🏠 (⭐ 85, 🍴 15) - MCP Client which serves as bridge between mcp servers and local LLMs running on Ollama, Created for MCP Servers Developed by Me, However other MCP Servers may run as well
pythonaicli-appcybersecurity-toolsethical-hacking-toolspip install git+https://github.com/zinja-coder/zin-mcp-client - binary_ninja_mcp 🐍 🏠 (⭐ 84, 🍴 25, 🐛 9) - A Binary Ninja plugin containing an MCP server that enables seamless integration with your favorite LLM/MCP client.
pythonmcpserveraimlpip install git+https://github.com/fosdickio/binary_ninja_mcp - mcp-streamable-http 📘 🏠 (⭐ 84, 🍴 19, 🐛 2) - Example implementation of MCP Streamable HTTP client/server in Python and TypeScript.
typescriptllmmcpmcp-clientmcp-servernpm install invariantlabs-ai/mcp-streamable-http - multi-mcp 🐍 🏠 (⭐ 84, 🍴 25, 🐛 3) - Python-based
pythonpip install git+https://github.com/kfirtoledo/multi-mcp - sqlite-explorer-fastmcp-mcp-server 🐍 🏠 (⭐ 84, 🍴 23, 🐛 5) - An MCP server that provides safe, read-only access to SQLite databases through Model Context Protocol (MCP). This server is built with the FastMCP framework, which enables LLMs to explore and query SQLite databases with built-in safety features and query validation.
pythondatabase-toolsllm-integrationllm-toolsmcppip install git+https://github.com/hannesrudolph/sqlite-explorer-fastmcp-mcp-server - mcp-server-perplexity 🐍 🏠 📇 (⭐ 82, 🍴 30, 🐛 3) - Python-based
httpgitgithubpythonapipip install git+https://github.com/tanigami/mcp-server-perplexity - node-candidate-mcp-server 📘 🏠 (⭐ 82, 🍴 5) - A Model Context Protocol (MCP) server library that gives LLMs access to information about a candidate.
typescriptaimcpserverllmnpm install jhgaylor/node-candidate-mcp-server - aseprite-mcp 🐍 🏠 📇 (⭐ 81, 🍴 9, 🐛 3) - MCP server for interacting with the Aseprite API
pythonmcpserverapihttppip install git+https://github.com/diivi/aseprite-mcp - mcp-server-llamacloud 📜 🏠 (⭐ 81, 🍴 17, 🐛 2) - A MCP server connecting to managed indexes on LlamaCloud
httpaigitgithubjavascriptnpm install run-llama/mcp-server-llamacloud - terminal-controller-mcp 🐍 🏠 (⭐ 81, 🍴 16, 🐛 4) - A Model Context Protocol (MCP) server that enables secure terminal command execution, directory navigation, and file system operations through a standardized interface.
pythonmcpserverfilehttppip install git+https://github.com/GongRzhe/terminal-controller-mcp - needle-mcp 🐍 🏠 (⭐ 79, 🍴 20, 🐛 2) - Needle MCP Server for easy RAG.Long-term memory for LLMs.
pythonaimcpmodelcontextprotocolragpip install git+https://github.com/JANHMS/needle-mcp-server - paiml-mcp-agent-toolkit 🦀 🏠 (⭐ 79, 🍴 14, 🐛 7) - Pragmatic AI Labs MCP Agent Toolkit - An MCP Server designed to make code with agents more deterministic
rustagenticcdenokotlincargo install --git https://github.com/paiml/paiml-mcp-agent-toolkit - sample-agentic-ai-demos 🐍 🏠 (⭐ 79, 🍴 29, 🐛 4) - Collection of examples of how to use Model Context Protocol with AWS.
pythonagentsbedrockgenaimcpgit clone https://github.com/aws-samples/Sample-Model-Context-Protocol-Demos - mcp-email-server 🐍 🏠 (⭐ 78, 🍴 28, 🐛 4) - IMAP and SMTP via MCP Server
pythonmcpserverpip install git+https://github.com/ai-zerolab/mcp-email-server - OpenSCAD-MCP-Server 🐍 🏠 (⭐ 78, 🍴 17, 🐛 3) - Devin's attempt at creating an OpenSCAD MCP Server that takes a user prompt and generates a preview image and 3d file.
pythonmcpserverpip install git+https://github.com/jhacksman/OpenSCAD-MCP-Server - mysql-mcp-server-sse 🐍 🏠 (⭐ 77, 🍴 21, 🐛 5) - MySQL query server based on the MCP sse.Multi-level SQL risk control & injection protection Docker support for quick deployment
pythonaidockerfilemcpmysqlpip install git+https://github.com/mangooer/mysql-mcp-server-sse - Awesome-Claude-MCP-Servers 🏠 (⭐ 75, 🍴 8, 🐛 2) - A curated list of Model Context Protocol (MCP) servers optimized for Claude AI assistants.
mcpserveraigit clone https://github.com/win4r/Awesome-Claude-MCP-Servers - ffmpeg-mcp 🐍 🏠 (⭐ 75, 🍴 12) - Using ffmpeg command line to achieve an mcp server, can be very convenient, through the dialogue to achieve the local video search, tailoring, stitching, playback,clip, overlay, concat and other functions
pythonmcpserveraipip install git+https://github.com/video-creator/ffmpeg-mcp - mcp-local-rag 🐍 🏠 📇 (⭐ 75, 🍴 15, 🐛 2) - "primitive" RAG-like web search model context protocol (MCP) server that runs locally. ✨ no APIs ✨
pythonmcpmcp-servermodel-context-protocolragpip install git+https://github.com/nkapila6/mcp-local-rag - mcp-azure-devops 🐍 🏠 (⭐ 74, 🍴 37, 🐛 14) - A Model Context Protocol (MCP) server enabling AI assistants to interact with Azure DevOps services via Python SDK.
pythonmcpserveraiazurepip install git+https://github.com/Vortiago/mcp-azure-devops - mcp-browser-use 🐍 🏠 📇 (⭐ 74, 🍴 13, 🐛 7) - FastAPI server implementing MCP protocol Browser automation via browser-use library.
pythonagent-aiagentic-aibrowser-usemcppip install git+https://github.com/JovaniPink/mcp-browser-use - garmin_mcp 🐍 🏠 (⭐ 73, 🍴 16, 🐛 4) - MCP server to access Garmin data
pythonmcpserverpip install git+https://github.com/Taxuspt/garmin_mcp - mcp-server-atlassian-bitbucket 📘 🏠 (⭐ 73, 🍴 28, 🐛 19) - Node.js/TypeScript MCP server for Atlassian Bitbucket. Enables AI systems (LLMs) to interact with workspaces, repositories, and pull requests via tools (list, get, comment, search). Connects AI directly to version control workflows through the standard MCP interface.
typescriptaiai-connectorai-integrationanthropicnpm install aashari/mcp-server-atlassian-bitbucket - mcp-server-openai 🐍 🏠 (⭐ 73, 🍴 18, 🐛 6) - Query OpenAI models directly from Claude using MCP protocol.
httpaiopenaigitgithubpip install git+https://github.com/pierrebrunelle/mcp-server-openai - freqtrade-mcp 🐍 🏠 (⭐ 72, 🍴 18, 🐛 5) - An MCP server that integrates with the Freqtrade cryptocurrency trading bot.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/freqtrade-mcp - alpha-vantage-mcp 🐍 🏠 📇 (⭐ 71, 🍴 32, 🐛 4) - MCP Server for Alpha Advantage API
pythonmcpserverapihttppip install git+https://github.com/berlinbra/alpha-vantage-mcp - share-best-mcp 🐍 🏠 (⭐ 71, 🍴 13) - 世界上最好的MCP Servers的列表,The best mcp servers in the world.
pythonmcpserverpip install git+https://github.com/shareAI-lab/share-best-mcp - mcp-ts-template 📘 🏠 (⭐ 70, 🍴 10, 🐛 3) - A production-grade TypeScript template for building robust Model Context Protocol (MCP) servers, featuring built-in observability with OpenTelemetry, advanced error handling, comprehensive utilities, and a modular architecture.
typescriptaillmllm-agentmcpnpm install cyanheads/mcp-ts-template - mcp-youtube-transcript 🐍 🏠 (⭐ 70, 🍴 24, 🐛 5) - MCP server retrieving transcripts of YouTube videos
pythonmcp-serveryoutubemcpserverpip install git+https://github.com/jkawamoto/mcp-youtube-transcript - mcp-gateway 🐍 🏠 (⭐ 69, 🍴 12, 🐛 3) - MCP Gateway and Registry
htmlmcpgoserverpythongit clone https://github.com/igutekunst/mcp-gateway - mcp-server-any-openapi 🐍 🏠 📇 (⭐ 69, 🍴 14, 🐛 1) - A MCP server that enables Claude to discover and call any API endpoint through semantic search. Intelligently chunks OpenAPI specifications to handle large API documentation, with built-in request execution capabilities. Perfect for integrating private APIs with Claude Desktop.
pythonfaissmcp-serveropenapisemantic-searchpip install git+https://github.com/baryhuang/mcp-server-any-openapi - mcp-server-idapro 🐍 🏠 (⭐ 69, 🍴 21, 🐛 1) - A Model Context Protocol (MCP) server that enables AI assistants to interact with IDA Pro for reverse engineering and binary analysis tasks.
pythonaiaiagentbinary-analysisdissaseemblypip install git+https://github.com/fdrechsler/mcp-server-idapro - imessage-query-fastmcp-mcp-server 🐍 🏠 (⭐ 68, 🍴 13, 🐛 3) - An MCP server that provides safe access to your iMessage database through Model Context Protocol (MCP). This server is built with the FastMCP framework and the imessagedb library, enabling LLMs to query and analyze iMessage conversations with proper phone number validation and attachment handling.
pythonllmmcpmcp-serverserverpip install git+https://github.com/hannesrudolph/imessage-query-fastmcp-mcp-server - mcp-excel-server 🐍 🏠 (⭐ 68, 🍴 14) - The Excel MCP Server is a powerful tool that enables natural language interaction with Excel files through the Model Context Protocol (MCP). It provides a comprehensive set of capabilities for reading, analyzing, visualizing, and writing Excel data.
pythonclaudeclaude-mcpdataexcelpip install git+https://github.com/yzfly/mcp-excel-server - mcp.science 🐍 🏠 (⭐ 68, 🍴 19, 🐛 3) - Open Source MCP Servers for Scientific Research
pythonmcpserverpip install git+https://github.com/pathintegral-institute/mcp-servers - stealth-browser-mcp 🐍 🏠 (⭐ 68, 🍴 11) - The only browser automation that bypasses anti-bot systems. AI writes network hooks, clones UIs pixel-perfect via simple chat.
pythonai-agent-toolsai-toolsanthropicanti-bot-bypasspip install git+https://github.com/vibheksoni/stealth-browser-mcp - awsome_kali_MCPServers 🐍 🏠 (⭐ 67, 🍴 6) - awsome kali MCPServers is a set of MCP servers tailored for Kali Linux
pythonagentkali-linuxllmmcp-serverpip install git+https://github.com/ccq1/awsome_kali_MCPServers - jvm-mcp-server 🐍 🏠 (⭐ 67, 🍴 13, 🐛 2) - This is an implementation project of a JVM-based MCP (Model Context Protocol) server. The project aims to provide a standardized MCP server implementation for the JVM platform, enabling AI models to better interact with the Java ecosystem.
pythonmcpserveraihttppip install git+https://github.com/xzq-xu/jvm-mcp-server - mythic_mcp 🐍 🏠 (⭐ 67, 🍴 16, 🐛 3) - A simple POC to expose Mythic as a MCP server
pythonmcpserverpip install git+https://github.com/xpn/mythic_mcp - academic-search-mcp-server 🐍 🏠 (⭐ 66, 🍴 8, 🐛 2) - Academic Paper Search MCP Server for Claude Desktop integration. Allows Claude to access data from Semantic Scholar and Crossref.
pythonacademicaillmmcppip install git+https://github.com/afrise/academic-search-mcp-server - pubmedmcp 🐍 🏠 (⭐ 66, 🍴 12, 🐛 1) - A MCP server for PubMed data
pythonmcpserverpip install git+https://github.com/grll/pubmedmcp - splunk-mcp 🐍 🏠 (⭐ 66, 🍴 26, 🐛 12) - A Model Context Protocol (MCP) implementation for Splunk Enterprise and Cloud integration with Cursor IDE or Claude
pythonmcppip install git+https://github.com/livehybrid/splunk-mcp - Wazuh-MCP-Server 🐍 🏠 (⭐ 66, 🍴 18, 🐛 2) - AI-powered security operations with Wazuh SIEM + Claude Desktop. Natural language threat detection, automated incident response & compliance. Real-time monitoring, ML anomaly detection. Transform your SOC with conversational security analysis. Production-ready MCP server.
pythonaiclaudeclaude-aiclaude-codepip install git+https://github.com/unmuktoai/Wazuh-MCP-Server - mcp-github-project-manager 📘 🏠 (⭐ 65, 🍴 22, 🐛 7) - a mcp server to manage github project's functionality
typescriptaiautomategithub-projectsmcpnpm install kunwarVivek/mcp-github-project-manager - mcp-redmine 🐍 🏠 📇 (⭐ 65, 🍴 21, 🐛 5) - A redmine MCP server covering close to 100% of redmines API
pythonmcpserverapipip install git+https://github.com/runekaagaard/mcp-redmine - mcp-pdf-tools 🐍 🏠 (⭐ 64, 🍴 7, 🐛 2) - MCP server for working with PDF files
pythonmcpserverpip install git+https://github.com/hanweg/mcp-pdf-tools - mcp-python-interpreter 🐍 🏠 (⭐ 64, 🍴 23, 🐛 2) - MCP Python Interpreter: run python code. Python-mcp-server, mcp-python-server, Code Executor
pythonclaudeclaude-mcpcodemcppip install git+https://github.com/yzfly/mcp-python-interpreter - mcp-llm 📜 🏠 (⭐ 63, 🍴 8) - An MCP server that provides LLMs access to other LLMs
javascriptanthropicbedrockclaudellamanpm install sammcj/mcp-llm - openai-websearch-mcp 🐍 🏠 (⭐ 63, 🍴 13, 🐛 5) - openai websearch tool as mcp server
pythonmcpserverwebaipip install git+https://github.com/ConechoAI/openai-websearch-mcp - dicom-mcp 🐍 🏠 (⭐ 62, 🍴 19, 🐛 7) - Model Context Protocol (MCP) for interacting with dicom servers (PACS etc.)
pythonmcpserverhttpgitpip install git+https://github.com/ChristianHinge/dicom-mcp - lucidity-mcp 🐍 🏠 (⭐ 62, 🍴 19, 🐛 5) - AI-powered code quality analysis using MCP to help AI assistants review code more effectively. Analyze git changes for complexity, security issues, and more through structured prompts.
pythonai-toolsclaudecode-analysiscode-qualitypip install git+https://github.com/hyperb1iss/lucidity-mcp - sample-mcp-server-s3 🐍 🏠 (⭐ 62, 🍴 15, 🐛 8) - Python-based
pythonhttpawsgitgithubpip install git+https://github.com/aws-samples/sample-mcp-server-s3 - discord-mcp ☕ 🏠 (⭐ 61, 🍴 15, 🐛 1) - A MCP server for the Discord integration. Enable your AI assistants to seamlessly interact with Discord. Enhance your Discord experience with powerful automation capabilities.
javaaiclaudediscorddiscord-botgit clone https://github.com/SaseQ/discord-mcp - github-chat-mcp 🐍 🏠 📇 (⭐ 61, 🍴 9, 🐛 3) - A Model Context Protocol (MCP) for analyzing and querying GitHub repositories using the GitHub Chat API.
pythongithubmcpmcp-serverapipip install git+https://github.com/AsyncFuncAI/github-chat-mcp - oxylabs-mcp 🐍 🏠 📇 (⭐ 61, 🍴 14, 🐛 2) - Official Oxylabs MCP integration
pythonai-toolsdata-collectione-comerce-scrapingllmpip install git+https://github.com/oxylabs/oxylabs-mcp - semantic-scholar-fastmcp-mcp-server 🐍 🏠 📇 (⭐ 61, 🍴 10, 🐛 4) - A FastMCP server implementation for the Semantic Scholar API, providing comprehensive access to academic paper data, author information, and citation networks.
pythonagentfastmcpllmmcppip install git+https://github.com/YUZongmin/semantic-scholar-fastmcp-mcp-server - deepview-mcp 🐍 🏠 (⭐ 60, 🍴 13, 🐛 2) - DeepView MCP is a Model Context Protocol server that enables IDEs like Cursor and Windsurf to analyze large codebases using Gemini 2.5 Pro's extensive context window.
pythonmcpserverhttpaipip install git+https://github.com/ai-1st/deepview-mcp - mcp-sap-gui 🐍 🏠 (⭐ 60, 🍴 17, 🐛 8) - MCP server that allows simple SAP GUI interaction for LLM models using simulated mouse clicks and keyboard input.
pythonmcpserverllmpip install git+https://github.com/mario-andreschak/mcp-sap-gui - r0idamcp 🐍 🏠 (⭐ 60, 🍴 9, 🐛 2) - r0idamcp is a SSE protocal MCP server IDA pro plugin designed for automatic reverse engineering with LLM assistant
pythonmcpserverllmpip install git+https://github.com/r0ysue/r0idamcp - x-mcp 🐍 🏠 (⭐ 60, 🍴 21, 🐛 1) - Python-based
pythonhttpgitgithubpip install git+https://github.com/vidhupv/x-mcp - MCP-wolfram-alpha 🐍 🏠 📇 (⭐ 59, 🍴 14, 🐛 1) - Connect your chat repl to wolfram alpha computational intelligence
pythonmcpmcp-serverwolframwolfram-alphapip install git+https://github.com/SecretiveShell/MCP-wolfram-alpha - opencv-mcp-server 🐍 🏠 (⭐ 59, 🍴 8, 🐛 2) - OpenCV MCP Server provides OpenCV's image and video processing capabilities through the Model Context Protocol (MCP). Access powerful computer vision tools for tasks ranging from basic image manipulation to advanced object detection and tracking.
pythonmcpserverhttpaipip install git+https://github.com/GongRzhe/opencv-mcp-server - gmail-mcp-server 🐍 🏠 (⭐ 58, 🍴 32, 🐛 3) - Model Context Protocol (MCP) server for Gmail
pythonmcpserveraipip install git+https://github.com/jasonsum/gmail-mcp-server - heurist-mesh-mcp-server 🐍 🏠 (⭐ 58, 🍴 15, 🐛 6) - Python-based
pythonwebhttpaigitpip install git+https://github.com/heurist-network/heurist-mesh-mcp-server - OmniMCP 🐍 🏠 (⭐ 58, 🍴 10, 🐛 15) - OmniMCP uses Microsoft OmniParser and Model Context Protocol (MCP) to provide AI models with rich UI context and powerful interaction capabilities.
pythonanthropicawscomputerusegeminipip install git+https://github.com/OpenAdaptAI/OmniMCP - ccxt-mcp 📘 🏠 (⭐ 57, 🍴 13) - CCXT MCP Server bridges the gap between AI models and cryptocurrency trading by providing a standardized interface through the Model Context Protocol. Created to empower automated trading strategies, this tool allows AI assistants like Claude and GPT to directly interact with over 100 cryptocurrency exchanges without requiring users to write comple
typescriptagentaiai-tradingccxtnpm install Obinox04/ccxt-mcp - piapi-mcp-server 📘 🏠 📇 (⭐ 57, 🍴 21, 🐛 5) - A TypeScript implementation of a Model Context Protocol (MCP) server that integrates with PiAPI's API. PiAPI makes user able to generate media content with Midjourney/Flux/Kling/LumaLabs/Udio/Chrip/Trellis directly from Claude or any other MCP-compatible apps.
apiwebhttpaigitnpm install apinetwork/piapi-mcp-server - pinescript-mcp-server 🏠 (⭐ 57, 🍴 15, 🐛 1) - A Model Context Protocol (MCP) server for working with TradingView PineScript
htmlmcpservergit clone https://github.com/cklose2000/pinescript-mcp-server - zabbix-mcp-server 🐍 🏠 📇 (⭐ 57, 🍴 18, 🐛 3) - 🔌 Complete MCP server for Zabbix integration - Connect AI assistants to Zabbix monitoring with 40+ tools for hosts, items, triggers, templates, problems, and more. Features read-only mode and comprehensive API coverage.
pythonmcpserverapiaipip install git+https://github.com/mpeirone/zabbix-mcp-server - Awesome-MCP-Server 🐍 🏠 (⭐ 56, 🍴 28) - All MCP Servers related projects.
pythonmcpserverpip install git+https://github.com/AIAnytime/Awesome-MCP-Server - jira-mcp 🐹 🏠 (⭐ 56, 🍴 15, 🐛 1) - A Go-based MCP (Model Control Protocol) connector for Jira that enables AI assistants like Claude to interact with Atlassian Jira. This tool provides a seamless interface for AI models to perform common Jira operations including issue management, sprint planning, and workflow transitions.
goaigolang-mcpjirajira-mcpgo install nguyenvanduocit/jira-mcp@latest - mcp-difyworkflow-server 🐹 🏠 (⭐ 56, 🍴 14, 🐛 2) - mcp-difyworkflow-server is an mcp server Tools application that implements the query and invocation of Dify workflows, supporting the on-demand operation of multiple custom Dify workflows.
goaimcpmcp-serverservergo install gotoolkits/mcp-difyworkflow-server@latest - mcp-fal 🐍 🏠 (⭐ 56, 🍴 17, 🐛 1) - A Model Context Protocol (MCP) server for interacting with fal.ai models and services.
pythonmcpserveraipip install git+https://github.com/am0y/mcp-fal - netbox-mcp-server 🐍 🏠 (⭐ 56, 🍴 28, 🐛 12) - Model Context Protocol (MCP) server for read-only interaction with NetBox data in LLMs
pythonmcpmcp-servernetboxserverpip install git+https://github.com/netboxlabs/netbox-mcp-server - python_mcp 🐍 🏠 (⭐ 56, 🍴 14, 🐛 5) - MCP Server to run python code locally
pythonmcpserverpip install git+https://github.com/Alec2435/python_mcp - bing-search-mcp 🐍 🏠 📇 (⭐ 55, 🍴 5, 🐛 3) - MCP Server for Bing Search API
pythonclaudemcpmcp-serverserverpip install git+https://github.com/leehanchung/bing-search-mcp - boilerplate-mcp-server 📘 🏠 (⭐ 55, 🍴 20, 🐛 9) - TypeScript Model Context Protocol (MCP) server boilerplate providing IP lookup tools/resources. Includes CLI support and extensible structure for connecting AI systems (LLMs) to external data sources like ip-api.com. Ideal template for creating new MCP integrations via Node.js.
typescriptaiai-integrationanthropicboilerplatenpm install aashari/boilerplate-mcp-server - data-gov-il-mcp 📜 🏠 (⭐ 55, 🍴 13, 🐛 1) - Advanced MCP server for seamless access to Israeli Government Open Data
javascriptaiclaudedata-gov-ilgovernment-datanpm install DavidOsherProceed/data-gov-il-mcp - fantasy-pl-mcp 🐍 🏠 (⭐ 55, 🍴 17, 🐛 1) - Fantasy Premier League MCP Server
pythonmcpserverhttpgitpip install git+https://github.com/rishijatia/fantasy-pl-mcp - nexonco-mcp 🐍 🏠 (⭐ 55, 🍴 8, 🐛 1) - An advanced MCP Server for accessing and analyzing clinical evidence data, with flexible search options to support precision medicine and oncology research.
pythonaihealthmcpserverpip install git+https://github.com/Nexgene-Research/nexonco-mcp - dify-plugin-mcp_server 🐍 🏠 (⭐ 54, 🍴 8, 🐛 3) - Python-based
pythonpip install git+https://github.com/hjlarry/dify-plugin-mcp_server - kokoro-tts-mcp 🐍 🏠 (⭐ 54, 🍴 13, 🐛 4) - Kokoro Text to Speech (TTS) MCP Server
pythonmcpserverhttpgitpip install git+https://github.com/mberg/kokoro-tts-mcp - lldb-mcp 🐍 🏠 (⭐ 54, 🍴 5, 🐛 2) - LLDB MCP server (Python-based)
pythonmcpserverhttpllmpip install git+https://github.com/stass/lldb-mcp - mcp-server-ccxt 🐍 🏠 (⭐ 54, 🍴 16, 🐛 1) - Cryptocurrency Market Data MCP Server
pythonagentaiccxtcryptocurrencypip install git+https://github.com/Nayshins/mcp-server-ccxt - omniparser-autogui-mcp 🐍 🏠 (⭐ 54, 🍴 10, 🐛 3) - Automatic operation of on-screen GUI.
pythonhttpgitgithubpip install git+https://github.com/NON906/omniparser-autogui-mcp - wandb-mcp-server 🐍 🏠 (⭐ 54, 🍴 7, 🐛 3) - A collection of MCP (Model Context Protocol) tools and examples for wandb and weave
pythonmcppip install git+https://github.com/wandb/MCP-server - intervals-mcp-server 🐍 🏠 📇 (⭐ 53, 🍴 22, 🐛 1) - Model Context Protocol (MCP) server for connecting Claude with the Intervals.icu API
pythonmcpserverapipip install git+https://github.com/mvilanova/intervals-mcp-server - markitdown_mcp_server 🐍 🏠 (⭐ 53, 🍴 11, 🐛 2) - A Model Context Protocol (MCP) server that converts various file formats to Markdown using the MarkItDown utility.
pythonmcpmcp-serverserverpip install git+https://github.com/KorigamiK/markitdown_mcp_server - mcp-for-api 🐍 🏠 (⭐ 53, 🍴 15, 🐛 5) - Appwrite’s MCP server. Operating your backend has never been easier.
pythonmcpserverpip install git+https://github.com/christyjacob4/mcp-server-appwrite - mcp-hn 🐍 🏠 (⭐ 53, 🍴 13, 🐛 3) - MCP Server for Hackernews
pythonmcpserverhttpgitpip install git+https://github.com/erithwik/mcp-hn - mcp-ppt 🐍 🏠 (⭐ 53, 🍴 11) - A mcp server supporting you to generate powerpoint using LLM and natural language automatically.
pythonmcpserverllmpip install git+https://github.com/ltc6539/mcp-ppt - mcp-server-datahub 🐍 🏠 (⭐ 53, 🍴 20, 🐛 6) - The official Model Context Protocol (MCP) server for DataHub (https://datahub.com)
pythonmcpserverhttpgitpip install git+https://github.com/acryldata/mcp-server-datahub - mobile-mcp 📘 🏠 (⭐ 53, 🍴 3) - A Model Context Protocol (MCP) server that provides mobile automation capabilities.
typescriptadbaiandroidclaudenpm install runablehq/mobile-mcp - wecom-bot-mcp-server 🐍 🏠 (⭐ 53, 🍴 10, 🐛 5) - A Python server implementation for WeCom (WeChat Work) bot that follows the Model Context Protocol (MCP). This server provides a standardized interface for handling automated messaging and context-aware interactions within enterprise WeChat environments.
pythonmcpserverpip install git+https://github.com/loonghao/wecom-bot-mcp-server - anilist-mcp 📘 🏠 📇 (⭐ 52, 🍴 8, 🐛 1) - AniList MCP server for accessing anime and manga data
typescriptaianilistanimeapinpm install yuna0x0/anilist-mcp - cryptopanic-mcp-server 🐍 🏠 (⭐ 52, 🍴 19, 🐛 3) - Provide latest cryptocurrency news to AI agents.
pythonaihttpgitgithubpip install git+https://github.com/kukapay/cryptopanic-mcp-server - demcp-defillama-mcp 🐍 🏠 (⭐ 52, 🍴 13, 🐛 2) - Python-based
pythonpip install git+https://github.com/demcp/defillama-mcp - mcp-applemusic 🐍 🏠 (⭐ 52, 🍴 12, 🐛 2) - An experimental MCP server for controlling Apple Music.
pythonmcpserverpip install git+https://github.com/kennethreitz/mcp-applemusic - mcp-headless-gmail 🐍 🏠 ☁️ (⭐ 52, 🍴 25, 🐛 2) - A MCP (Model Context Protocol) server that provides get, send Gmails without local credential or token setup.
pythonai-assistantgmailgmail-botgoogle-suitepip install git+https://github.com/baryhuang/mcp-headless-gmail - mcp-server-okppt 🐍 🏠 (⭐ 52, 🍴 3) - 这个项目是一个基于MCP (Model Context Protocol) 的服务器工具,名为 "MCP OKPPT Server"。它的核心功能是允许大型语言模型(如Claude、GPT等)通过生成SVG图像来间接设计和创建PowerPoint演示文稿。工具负责将这些SVG图像高质量地插入到PPTX幻灯片中,并保留其矢量特性,确保图像在PowerPoint中可缩放且清晰。
pythonmcpserverpip install git+https://github.com/NeekChaw/mcp-server-okppt - codealive-mcp 🐍 🏠 (⭐ 51, 🍴 5, 🐛 2) - Python-based
pythonpip install git+https://github.com/CodeAlive-AI/codealive-mcp - mcp-powershell-exec 🐍 🏠 (⭐ 51, 🍴 9, 🐛 1) - MCP Server for executing PowerShell scripts
pythonmcpserverpip install git+https://github.com/dfinke/mcp-powershell-exec - yfinance-mcp 🐍 🏠 (⭐ 51, 🍴 19, 🐛 2) - Python-based
pythonfinancemcpmcp-serveryahoo-financepip install git+https://github.com/narumiruna/yfinance-mcp - kospi-kosdaq-stock-server 🐍 🏠 (⭐ 50, 🍴 12) - An MCP server that provides KOSPI/KOSDAQ stock data using FastMCP
pythonfinancemcpserverpip install git+https://github.com/dragon1086/kospi-kosdaq-stock-server - mcp-server-azure-ai-agents 🐍 🏠 (⭐ 50, 🍴 12, 🐛 4) - Model Context Protocol Servers for Azure AI Search
pythonserveraiazurepip install git+https://github.com/farzad528/mcp-server-azure-ai-search - reaper-mcp-server 🐍 🏠 (⭐ 50, 🍴 8, 🐛 1) - An MCP Server for interacting with Reaper projects.
pythonmcpserverhttpgitpip install git+https://github.com/dschuler36/reaper-mcp-server - yokatlas-mcp 🐍 🏠 (⭐ 50, 🍴 5) - MCP Server for YOK Atlas
pythonmcpserverpip install git+https://github.com/saidsurucu/yokatlas-mcp - BurpSuite-MCP-Server 🐍 🏠 (⭐ 49, 🍴 2, 🐛 3) - BurpSuite MCP Server: A powerful Model Context Protocol (MCP) server implementation for BurpSuite, providing programmatic access to Burp's core functionalities.
pythonmcpserverpip install git+https://github.com/X3r0K/BurpSuite-MCP-Server - cve-search_mcp 🐍 🏠 📇 (⭐ 49, 🍴 8, 🐛 2) - A Model Context Protocol (MCP) server for querying the CVE-Search API
pythoncvemcp-servervulunhubmcppip install git+https://github.com/roadwy/cve-search_mcp - deepseek-claude-MCP-server 🐍 🏠 (⭐ 49, 🍴 11, 🐛 2) - a MCP server which integrates reasoning capabilities of DeepSeek R1 model into claude desktop app.
pythonmcpserverpip install git+https://github.com/HarshJ23/deepseek-claude-MCP-server - fastapi_mcp_sse 🐍 🏠 📇 (⭐ 49, 🍴 10, 🐛 4) - A working example to create a FastAPI server with SSE-based MCP support
pythonmcpserverapipip install git+https://github.com/panz2018/fastapi_mcp_sse - leetcode-mcp-server 📘 🏠 (⭐ 49, 🍴 13, 🐛 4) - An MCP server enabling automated access to LeetCode's problems, solutions, and public data with optional authentication for user-specific features, supporting leetcode.com & leetcode.cn sites.
typescriptaialgorithmlcleetcodenpm install jinzcdev/leetcode-mcp-server - mcp-server-box 🐍 🏠 📇 (⭐ 49, 🍴 19, 🐛 8) - An MCP server capable of interacting with the Box API
pythonmcpserverapihttppip install git+https://github.com/box-community/mcp-server-box - plex-mcp-server 🐍 🏠 (⭐ 49, 🍴 12, 🐛 1) - MCP Server for Plex to allow LLMs to converse with Plex.
pythonmcpserverllmpip install git+https://github.com/vladimir-tutin/plex-mcp-server - scrapling-fetch-mcp 🐍 🏠 (⭐ 49, 🍴 6, 🐛 3) - Helps AI assistants access text content from bot-protected websites. MCP server that fetches HTML/markdown from sites with anti-automation measures using Scrapling.
pythonmcpserverwebaipip install git+https://github.com/cyberchitta/scrapling-fetch-mcp - chess-mcp 🐍 🏠 📇 (⭐ 48, 🍴 12, 🐛 4) - A Model Context Protocol server for Chess.com's Published Data API. This provides access to Chess.com player data, game records, and other public information through standardized MCP interfaces, allowing AI assistants to search and analyze chess information.
pythonmcpserverapiaipip install git+https://github.com/pab1it0/chess-mcp - claude-mcp-setup 🐍 🏠 (⭐ 48, 🍴 13, 🐛 2) - Easy setup script for Anthropic Claude Model Context Protocol (MCP) servers on Windows
pythonmcpserverpip install git+https://github.com/patruff/claude-mcp-setup - deep-research-mcp-server 📘 🏠 (⭐ 48, 🍴 9) - MCP Deep Research Server using Gemini creating a Research AI Agent
typescriptaiai-agentsai-researchai-research-assistantnpm install ssdeanx/deep-research-mcp-server - mcp-server-node 📜 🏠 (⭐ 48, 🍴 11) - MCP Server implemented in JavaScript using Node.js that demonstrates how to build an MCP server with a custom prompt and custom tools, including one that loads an environment variable from a configuration file, to integrate seamlessly with AI-assisted environments like Cursor IDE.
javascriptaicursormcp-servernodejsnpm install lucianoayres/mcp-server-node - mcp-client 🐍 🏠 📇 (⭐ 48, 🍴 17, 🐛 1) - build agents and complex workflows with LLMs
pythonapiresthttpaipip install git+https://github.com/rakesh-eltropy/mcp-client - quick-mcp-example 🐍 🏠 (⭐ 48, 🍴 21, 🐛 2) - Short and sweet example MCP server / client implementation for Tools, Resources and Prompts.
pythonmcpmodel-context-protocolmodel-context-protocol-serversserverpip install git+https://github.com/ALucek/quick-mcp-example - AllVoiceLab-MCP 🐍 🏠 (⭐ 47, 🍴 8) - Official AllVoiceLab Model Context Protocol (MCP) server, supporting interaction with powerful text-to-speech and video translation APIs.
pythonaivoiceaivoicechangeraivoiceoveraudiobookspip install git+https://github.com/allvoicelab/AllVoiceLab-MCP - blender-open-mcp 🐍 🏠 (⭐ 47, 🍴 19, 🐛 10) - Open Models MCP for Blender Using Ollama
pythonblenderblender-addonblender3dmcppip install git+https://github.com/dhakalnirajan/blender-open-mcp - mcp-server 📘 🏠 📇 (⭐ 47, 🍴 16, 🐛 10) - MCP server for Glean API integration
pythonmcpservertypescriptapipip install git+https://github.com/devrev/mcp-server - user-feedback-mcp 🐍 🏠 (⭐ 47, 🍴 8, 🐛 1) - Simple MCP Server to enable a human-in-the-loop workflow in tools like Cline and Cursor.
pythonclinecursormcpmcp-serverpip install git+https://github.com/mrexodia/user-feedback-mcp - adx-mcp-server 🐍 🏠 (⭐ 46, 🍴 20) - A Model Context Protocol (MCP) server that enables AI assistants to query and analyze Azure Data Explorer databases through standardized interfaces.
pythonmcpserverdatabaseaipip install git+https://github.com/pab1it0/adx-mcp-server - BuildMCPServer 🐍 🏠 (⭐ 46, 🍴 19, 🐛 3) - A complete walkthrough on how to build an MCP server to serve a trained Random Forest model and integrate it with Bee Framework for ReAct interactivity.
pythonmcpserverairestpip install git+https://github.com/nicknochnack/BuildMCPServer - mssql_mcp_server 🐍 🏠 (⭐ 46, 🍴 22, 🐛 8) - A Model Context Protocol (MCP) server facilitating secure interactions with MSSQL databases.
pythonmcpserverdatabasehttppip install git+https://github.com/JexinSam/mssql_mcp_server - mcp_server_gdb 🦀 🏠 ☁️ (⭐ 45, 🍴 9, 🐛 5) - MCP Server to expose the GDB debugging capabilities
rustagentaillmmcpcargo install --git https://github.com/pansila/mcp_server_gdb - mcp-metatrader5-server 🐍 🏠 (⭐ 45, 🍴 20, 🐛 6) - A Model Context Protocol (MCP) server for interacting with the MetaTrader 5 trading platform. This server provides AI assistants with tools and resources to access market data, perform trading operations, and analyze trading history.
pythonmcp-servermetatrader-5mcpserverpip install git+https://github.com/Qoyyuum/mcp-metatrader5-server - oatpp-mcp 🏠 (⭐ 45, 🍴 4, 🐛 1) - Anthropic’s Model Context Protocol implementation for Oat++
c++anthropicmodel-context-protocoloatpphttpgit clone https://github.com/oatpp/oatpp-mcp - roadrecon_mcp_server 🐍 🏠 (⭐ 45, 🍴 8, 🐛 1) - Claude MCP server to perform analysis on ROADrecon data
pythonmcpserverhttpazurepip install git+https://github.com/atomicchonk/roadrecon_mcp_server - jmeter-mcp-server 🐍 🏠 (⭐ 44, 🍴 14, 🐛 5) - ✨ JMeter Meets AI Workflows: Introducing the JMeter MCP Server! 🤯
pythonapache-jmeterjmetermcpmodel-context-protocol-serverspip install git+https://github.com/QAInsights/jmeter-mcp-server - mcp-discord 📘 🏠 (⭐ 44, 🍴 21, 🐛 1) - Implement Discord MCP server enabling AI assistants to interact with the Discord platform.
typescriptaidiscorddiscord-botmcpnpm install barryyip0625/mcp-discord - awesome-remote-mcp-servers 📜 🏠 (⭐ 43, 🍴 5, 🐛 1) - A curated list of Hosted & Managed Model Context Protocol (MCP) Servers accessible via a simple URL endpoint.
javascriptaiawesomeawesome-listawesome-listsnpm install sylviangth/awesome-remote-mcp-servers - create-mcp 📘 🏠 (⭐ 43, 🍴 9, 🐛 1) - CLI to set up and deploy MCP Servers to Cloudflare Workers in seconds. Just write TypeScript functions to make Cursor MCP tools.
typescriptaiclicloudflare-workerscursornpm install zueai/create-mcp - MCP_Security 🐍 🏠 📇 (⭐ 43, 🍴 7, 🐛 1) - This is a repository to experiment with MCP for security
pythonmcpapihttpgitpip install git+https://github.com/fr0gger/MCP_Security - vrchat-mcp 📘 🏠 📇 (⭐ 43, 🍴 5, 🐛 1) - This project is a Model Context Protocol (MCP) server for interacting with the VRChat API.
typescriptaiclaudeclinemcpnpm install sawa-zen/vrchat-mcp - binja-lattice-mcp 🐍 🏠 (⭐ 42, 🍴 3, 🐛 1) - Plugin interface for remote communications with Binary Ninja database and MCP server for interfacing with LLMs.
pythonmcpserverdatabasellmpip install git+https://github.com/Invoke-RE/binja-lattice-mcp - ibkr-mcp-server 🐍 🏠 (⭐ 42, 🍴 13, 🐛 4) - MCP Server for IBKR Client
pythonmcpserverpip install git+https://github.com/seriallazer/ibkr-mcp-server - mcp_zoomeye 🐍 🏠 (⭐ 42, 🍴 12, 🐛 1) - A Model Context Protocol server that provides network asset information based on query conditions. This server allows LLMs to obtain network asset information and supports querying network asset information by zoomeye dork etc.
pythoncybersecurityosintsearch-enginezoomeyepip install git+https://github.com/zoomeye-ai/mcp_zoomeye - mcp-wolframalpha 🐍 🏠 📇 (⭐ 42, 🍴 7, 🐛 2) - A Python-powered Model Context Protocol MCP server and client that uses Wolfram Alpha via API.
pythonmcpserverapihttppip install git+https://github.com/ricocf/mcp-wolframalpha - mikrotik-mcp 🐍 🏠 (⭐ 42, 🍴 13, 🐛 2) - MCP server for Mikrotik
pythonmcpserverhttpgitpip install git+https://github.com/jeff-nasseri/mikrotik-mcp - pyATS_MCP 🐍 🏠 (⭐ 42, 🍴 12, 🐛 1) - An MCP Server for pyATS (experimental)
pythonmcpserverhttpgitpip install git+https://github.com/automateyournetwork/pyATS_MCP - mcp-databricks-server 🐍 🏠 📇 (⭐ 41, 🍴 22, 🐛 9) - MCP Server for Databricks
pythonmcpserverdatabricksllmpip install git+https://github.com/JordiNeil/mcp-databricks-server - mcp-stripe 🐍 🏠 (⭐ 41, 🍴 9, 🐛 3) - Python-based
pythonhttpgitgithubpip install git+https://github.com/atharvagupta2003/mcp-stripe - databricks-mcp 🐍 🏠 (⭐ 41, 🍴 18, 🐛 5) - Python-based
pythonpip install git+https://github.com/markov-kernel/databricks-mcp - time-mcp 📜 🏠 (⭐ 41, 🍴 7) - ⏰ Time MCP Server: Giving LLMs Time Awareness Capabilities
javascriptagentsdayjsllmmcpnpm install yokingma/time-mcp - web-browser-mcp-server 🐍 🏠 (⭐ 41, 🍴 10) - A Minimum Control Program (MCP) server implementation for web browsing capabilities using BeautifulSoup4
pythonmcpserverwebpip install git+https://github.com/blazickjp/web-browser-mcp-server - mcp-goodnews 🐍 🏠 (⭐ 41, 🍴 7, 🐛 1) - A simple MCP application that delivers curated positive and uplifting news stories.
pythonmcphttpgitgithubpip install git+https://github.com/VectorInstitute/mcp-goodnews - coze-mcp-server 🐍 🏠 (⭐ 40, 🍴 11, 🐛 3) - mcp server for coze (Python-based)
pythonmcpserverpip install git+https://github.com/coze-dev/coze-mcp-server - crypto-feargreed-mcp 🐍 🏠 (⭐ 40, 🍴 14, 🐛 4) - Providing real-time and historical Crypto Fear & Greed Index data
pythonhttpgitgithubpip install git+https://github.com/kukapay/crypto-feargreed-mcp - polymarket-mcp 🐍 🏠 📇 (⭐ 40, 🍴 12, 🐛 6) - MCP Server for PolyMarket API
pythonmcpserverapipip install git+https://github.com/berlinbra/polymarket-mcp - scaled-mcp 🐹 🏠 (⭐ 40, 🍴 4, 🐛 4) - ScaledMCP is a horizontally scalabled MCP and A2A Server. You know, for AI.
goa2aaimcpmcp-clientgo install traego/scaled-mcp@latest - steel-mcp-server 📜 🏠 (⭐ 40, 🍴 9, 🐛 8) - MCP Server for interacting with a Steel web browser
javascriptaiclaudemcp-servermcpnpm install steel-dev/steel-mcp-server - taskMaster-todoist-mcp 🐍 🏠 (⭐ 40, 🍴 5, 🐛 2) - A lightweight Model Context Protocol (MCP) server that enables natural language interaction with your Todoist tasks directly from your IDE. Built with simplicity and maintainability in mind.
pythonai-assistantcursor-aimcptodoistpip install git+https://github.com/mingolladaniele/taskMaster-todoist-mcp - mcp_server_wechat 🐍 🏠 (⭐ 39, 🍴 6, 🐛 4) - 基于MCP技术,操作微信发送消息和获取历史记录
pythonmcppip install git+https://github.com/panxingfeng/mcp_server_wechat - mcp-bear 🐍 🏠 (⭐ 39, 🍴 9) - A MCP server for interacting with Bear note-taking software.
pythonmacosmcp-serverx-callback-urlmcppip install git+https://github.com/jkawamoto/mcp-bear - mcp-jenkins 🐍 🏠 (⭐ 39, 🍴 16) - The Model Context Protocol (MCP) is an open-source implementation that bridges Jenkins with AI language models following Anthropic's MCP specification. This project enables secure, contextual AI interactions with Jenkins tools while maintaining data privacy and security.
pythonmcpaipip install git+https://github.com/lanbaoshen/mcp-jenkins - MCP-timeserver 🐍 🏠 (⭐ 39, 🍴 15, 🐛 4) - A simple MCP server that exposes datetime information to agentic systems and chat REPLs
pythonmcpserverlocalhttppip install git+https://github.com/SecretiveShell/MCP-timeserver - NGCBot-MCP 🐍 🏠 (⭐ 39, 🍴 5) - NGCBot-MCP-Server 让AI操纵你的微信!
pythonmcpserveraipip install git+https://github.com/ngc660sec/NGCBot-MCP - openai-codex-mcp 🐍 🏠 📇 (⭐ 39, 🍴 9, 🐛 1) - An MCP server to communicated with, use, and wrap the API for the OpenAI Codex CLI tool.
pythonmcpaiserverapipip install git+https://github.com/Tomatio13/openai-codex-mcp - random-number-mcp 🐍 🏠 (⭐ 39, 🍴 4, 🐛 1) - Production-ready MCP server that provides LLMs with essential random generation abilities, built entirely on Python's standard library.
pythonmcpserverllmhttppip install git+https://github.com/zazencodes/random-number-mcp - stata-mcp 🐍 🏠 (⭐ 39, 🍴 4) - Let LLM help you achieve your regression with Stata: AI-Powered Stata Code Generation & Regression Analysis.
pythonai-codingeconometricsempiricalempirical-researchpip install git+https://github.com/SepineTam/stata-mcp - python-notebook-mcp 🐍 🏠 (⭐ 39, 🍴 8) - Lightweight Python Notebook MCP - Enable AI assistants to create, edit, and view Jupyter notebooks via Model Context Protocol
pythonai-toolsclaudeclaude-desktopcursor-idepip install git+https://github.com/UsamaK98/python-notebook-mcp - bloodhound_mcp 🐍 🏠 (⭐ 38, 🍴 4, 🐛 1) - A Model Context Protocol (MCP) server to converse with data in Bloodhound
pythonmcpserverpip install git+https://github.com/mwnickerson/bloodhound_mcp - document-edit-mcp 🐍 🏠 (⭐ 38, 🍴 10, 🐛 4) - A lightweight MCP server for processing, editing, and interacting with PDF, Word, Excel, and CSV documents.
pythonmcpserverpip install git+https://github.com/alejandroBallesterosC/document-edit-mcp - mcp_code_analyzer 🐍 🏠 (⭐ 38, 🍴 17, 🐛 4) - A Model Context Protocol (MCP) server implementation for comprehensive code analysis. This tool integrates with Claude Desktop to provide code analysis capabilities through natural language interactions.
pythonmcpserverpip install git+https://github.com/emiryasar/mcp_code_analyzer - mcp-hetzner 🐍 🏠 📇 (⭐ 38, 🍴 7, 🐛 2) - A Model Context Protocol (MCP) server for interacting with the Hetzner Cloud API. This server allows language models to manage Hetzner Cloud resources through structured functions.
pythonmcpserverapihttppip install git+https://github.com/dkruyt/mcp-hetzner - mssql-mcp 🐍 🏠 (⭐ 38, 🍴 9) - mssql mcp server (Python-based)
pythonaimcpmodel-context-protocolmssqlpip install git+https://github.com/daobataotie/mssql-mcp - thingspanel-mcp 🐍 🏠 (⭐ 38, 🍴 10, 🐛 2) - This MCP server integrates ThingsPanel IoT platform with AI models like Claude, GPT, and others that support the Model Context Protocol.
pythonmcpserveraipip install git+https://github.com/ThingsPanel/thingspanel-mcp - whale-tracker-mcp 🐍 🏠 (⭐ 38, 🍴 12, 🐛 4) - A mcp server for tracking cryptocurrency whale transactions.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/whale-tracker-mcp - world_bank_mcp_server 🐍 🏠 📇 (⭐ 38, 🍴 8) - An implementation of the Model Context Protocol for the World Bank open data API
pythonapihttpaigitpip install git+https://github.com/anshumax/world_bank_mcp_server - akshare-one-mcp 🐍 🏠 (⭐ 37, 🍴 6, 🐛 1) - MCP server that provides access to Chinese stock market data using akshare-one
pythonaksharemcpmcp-serverstock-datapip install git+https://github.com/zwldarren/akshare-one-mcp - databricks-mcp-server 🐍 🏠 (⭐ 37, 🍴 18, 🐛 4) - A Model Completion Protocol (MCP) server for interacting with Databricks services
pythonmcpserverpip install git+https://github.com/JustTryAI/databricks-mcp-server - mcp-rquest 🐍 🏠 (⭐ 37, 🍴 6, 🐛 2) - A MCP server providing realistic browser-like HTTP request capabilities with accurate TLS/JA3/JA4 fingerprints for bypassing anti-bot measures. It also supports converting PDF and HTML documents to Markdown for easier processing by LLMs.
pythonaiclaudehttp-requestsmcppip install git+https://github.com/xxxbrian/mcp-rquest - mcp-server-arangodb 📘 🏠 (⭐ 37, 🍴 9, 🐛 2) - This is a TypeScript-based MCP server that provides database interaction capabilities through ArangoDB. It implements core database operations and allows seamless integration with ArangoDB through MCP tools. You can use it wih Claude app and also extension for VSCode that works with mcp like Cline!
typescriptaiclaudeclinemcp-servernpm install ravenwits/mcp-server-arangodb - mcp-server-rabbitmq 🐍 🏠 (⭐ 37, 🍴 9, 🐛 7) - MCP server for interacting with RabbitMQ
pythonmcpserverhttpgitpip install git+https://github.com/kenliao94/mcp-server-rabbitmq - passport-mcp 🐍 🏠 (⭐ 37, 🍴 3, 🐛 4) - Build MCP servers for any website with automatic browser auth syncing
pythonmcpserverwebauthpip install git+https://github.com/JoshMayerr/passport-mcp - scheduler-mcp 🐍 🏠 📇 (⭐ 37, 🍴 10, 🐛 4) - MCP Scheduler is a task automation server that lets you schedule shell commands, API calls, AI tasks, and desktop notifications using cron expressions. Built with Model Context Protocol for seamless integration with Claude Desktop and other AI assistants.
pythonmcpservergoapipip install git+https://github.com/JorgeVanco/Scheduler-MCP - esxi-mcp-server 🐍 🏠 📇 (⭐ 36, 🍴 18, 🐛 5) - A VMware ESXi/vCenter management server based on MCP (Model Control Protocol), providing simple REST API interfaces for virtual machine management.
pythonmcpserverapirestpip install git+https://github.com/bright8192/esxi-mcp-server - example-mcp-server 🐍 🏠 (⭐ 36, 🍴 11, 🐛 4) - A ready-to-use MCP (Model Context Protocol) server template for extending Cursor IDE with custom tools. Deploy your own server to Heroku with one click, create custom commands, and enhance your Cursor IDE experience. Perfect for developers who want to add their own tools and commands to Cursor IDE without complex setup.
pythonautomationcursorfetchllmpip install git+https://github.com/kirill-markin/weaviate-mcp-server - healthcare-mcp-public 📜 🏠 (⭐ 36, 🍴 14, 🐛 1) - A Model Context Protocol (MCP) server providing AI assistants with access to healthcare data and medical information tools, including FDA drug info, PubMed, medRxiv, NCBI Bookshelf, clinical trials, ICD-10, DICOM metadata, and a medical calculator.
javascriptaiclaudeclaude-desktopdesktop-extensionsnpm install Cicatriiz/healthcare-mcp-public - mcp-simple-openai-assistant 🐍 🏠 (⭐ 36, 🍴 15, 🐛 2) - MCP server that gives Claude ability to use OpenAI's GPTs assistants
pythonmcpserveraihttppip install git+https://github.com/andybrandt/mcp-simple-openai-assistant - scrapegraph-mcp 🐍 🏠 (⭐ 36, 🍴 7) - ScapeGraph MCP Server
pythonmcp-serverscrapingwebcrawlermcppip install git+https://github.com/ScrapeGraphAI/scrapegraph-mcp - unichat-mcp-server 🐍 🏠 📇 (⭐ 36, 🍴 8, 🐛 1) - Python-based
pythonapihttpaiopenaipip install git+https://github.com/amidabuddha/unichat-mcp-server - whatsapp-mcp-ts 📘 🏠 (⭐ 36, 🍴 11, 🐛 1) - WhatsApp MCP Server (TypeScript/Baileys)
typescriptaiclaudemcpnodejsnpm install jlucaso1/whatsapp-mcp-ts - hackmd-mcp 📘 🏠 📇 (⭐ 35, 🍴 7) - A Model Context Protocol server for integrating HackMD's note-taking platform with AI assistants.
typescriptaiapihackmdllmnpm install yuna0x0/hackmd-mcp - mcp-crypto-price 📘 🏠 (⭐ 35, 🍴 8, 🐛 4) - A Model Context Protocol (MCP) server that provides real-time cryptocurrency analysis via CoinCap's API. Enables Claude and other MCP clients to fetch crypto prices, analyze market trends, and track historical data.
typescriptanthropicclaudecoincapcryptonpm install truss44/mcp-crypto-price - n8n-workflow-builder-mcp 📜 🏠 (⭐ 35, 🍴 12, 🐛 2) - MCP server that allow LLM in agent mode builds n8n workflows for you
javascriptagentaicursormcpnpm install ifmelate/n8n-workflow-builder-mcp - ops-mcp-server 🐍 🏠 (⭐ 35, 🍴 12, 🐛 2) - 服务器、网络设备巡检和运维MCP工具 (Python-based)
pythonmcppip install git+https://github.com/Heht571/ops-mcp-server - agentic-developer-mcp 🐍 🏠 (⭐ 34, 🍴 3, 🐛 3) - An MCP server that scales development into controllable agentic, recursive flows, and build a feature from bottom-up
pythoncodexmcp-serveropenai-codex-climcppip install git+https://github.com/teabranch/agentic-developer-mcp - joplin-mcp-server 🐍 🏠 (⭐ 34, 🍴 5, 🐛 5) - A Model Context Protocol (MCP) Server for https://joplinapp.org/ that enables note access through the https://modelcontextprotocol.io. Perfect for integration with AI assistants like Claude.
pythonjoplinmcp-servermcpserverpip install git+https://github.com/dweigend/joplin-mcp-server - manus-mcp 🐍 🏠 (⭐ 34, 🍴 11, 🐛 1) - MCP server that provides Manus-like capabilities
pythonmcpserverpip install git+https://github.com/huyouare/manus-mcp - mcp-server-whisper 🐍 🏠 (⭐ 34, 🍴 3, 🐛 1) - An MCP Server for audio transcription using OpenAI
pythonmcpserveraipip install git+https://github.com/arcaputo3/mcp-server-whisper - nostr-mcp 📘 🏠 (⭐ 34, 🍴 6, 🐛 4) - A Nostr MCP server that allows to interact with Nostr, enabling posting notes, and more.
typescriptllmmcp-servernostrmcpnpm install AbdelStark/nostr-mcp - openai-mcp 🐍 🏠 📇 (⭐ 34, 🍴 12, 🐛 5) - OpenAI Code Assistant Model Context Protocol (MCP) Server
pythonmcpserveraijavascriptpip install git+https://github.com/arthurcolle/openai-mcp - aider-mcp-server 🐍 🏠 (⭐ 34, 🍴 8, 🐛 1) - Python-based
pythonpip install git+https://github.com/sengokudaikon/aider-mcp-server - claude-memory-mcp 🐍 🏠 (⭐ 33, 🍴 7, 🐛 6) - An MCP server implementation providing persistent memory capabilities for Claude, based on research into optimal LLM memory techniques
pythonmcpserverllmpip install git+https://github.com/WhenMoon-afk/claude-memory-mcp - mcp_server_ros_2 🐍 🏠 (⭐ 33, 🍴 2, 🐛 3) - Advanced MCP Server ROS 2 bridging AI agents straight into robotics
pythonaimcpmcp-servermcp-server-ros2pip install git+https://github.com/wise-vision/mcp_server_ros_2 - mcp-outline 🐍 🏠 (⭐ 33, 🍴 12, 🐛 4) - A Model Context Protocol (MCP) server enabling AI assistants to interact with Outline documentation services.
pythonmcpserveraidocumentationpip install git+https://github.com/Vortiago/mcp-outline - mcp-server-ipinfo 🐍 🏠 📇 (⭐ 33, 🍴 12, 🐛 5) - IP Geolocation Server for MCP
pythonmcpserverapihttppip install git+https://github.com/briandconnelly/mcp-server-ipinfo - mcp-server-opendal 🐍 🏠 (⭐ 33, 🍴 6, 🐛 2) - Model Context Protocol Server for Apache OpenDAL™
pythonserverhttpgitgithubpip install git+https://github.com/Xuanwo/mcp-server-opendal - unifi-network-mcp 🐍 🏠 (⭐ 33, 🍴 10, 🐛 4) - MCP server implementation for the UniFi network application
pythonmcp-serverunifimcpserverpip install git+https://github.com/sirkirby/unifi-network-mcp - coin_api_mcp 🐍 🏠 📇 (⭐ 33, 🍴 7, 🐛 4) - A Model Context Protocol server that provides access to CoinMarketCap's cryptocurrency data. This server enables AI-powered applications to retrieve cryptocurrency listings, quotes, and detailed information about various coins.
pythonserveraiapihttppip install git+https://github.com/longmans/coin_api_mcp - alibabacloud-rds-openapi-mcp-server 🐍 🏠 📇 (⭐ 32, 🍴 14, 🐛 4) - MCP server for RDS Services via OPENAPI.
pythonaimcprdsserverpip install git+https://github.com/aliyun/alibabacloud-rds-openapi-mcp-server - crypto-sentiment-mcp 🐍 🏠 (⭐ 32, 🍴 11, 🐛 2) - An MCP server that delivers cryptocurrency sentiment analysis to AI agents.
pythonmcpserveraihttppip install git+https://github.com/kukapay/crypto-sentiment-mcp - mcp_for_android 🐍 🏠 📇 (⭐ 32, 🍴 5) - 🤖 Android MCP 框架 - 让你的手机听懂人话! 📱 智能控制,从指尖开始,让你可以用自然语言控制你的Android设备!无需复杂编程,只需简单对话!✨ 🧠 它能做什么? 🗣️ 自然语言控制 - "打开微信发消息给妈妈" 🔍 自动学习应用 - 自动探索和理解设备上的应用 🔄 深度应用探索 - 智能发现应用功能和界面 💬 上下文理解 - 记住对话历史,理解连续指令 🛠️ 简单API接口 - 方便集成到其他系统
pythonmcpapipip install git+https://github.com/lmee/mcp_for_android - mcp_safe_local_python_executor 🐍 🏠 (⭐ 32, 🍴 7, 🐛 1) - Stdio MCP Server wrapping custom Python runtime (LocalPythonExecutor) from Hugging Faces'
smolagentsframework. The runtime combines the ease of setup (compared to docker, VM, cloud runtimes) while providing safeguards and limiting operations/imports that are allowed inside the runtime.pythonmcpserverdockerlocalpip install git+https://github.com/maxim-saplin/mcp_safe_local_python_executor - mcp_server_notify 🐍 🏠 (⭐ 32, 🍴 8, 🐛 1) - Send system notification when Agent task is done.
pythonmcpmcp-servernotificationhttppip install git+https://github.com/Cactusinhand/mcp_server_notify - mcp-crew-ai 🐍 🏠 (⭐ 32, 🍴 8, 🐛 1) - MCP Crew AI Server is a lightweight Python-based server designed to run, manage and create CrewAI workflows.
pythonagentsaimcpmcp-serverpip install git+https://github.com/adam-paterson/mcp-crew-ai - mcp-logic 🐚 🏠 (⭐ 32, 🍴 6, 🐛 1) - Fully functional AI Logic Calculator utilizing Prover9/Mace4 via Python based Model Context Protocol (MCP-Server)- tool for Windows Claude App etc
shellaiclaude-3-5-sonnetllmlogicgit clone https://github.com/angrysky56/mcp-logic - mcp-server-monday 🐍 🏠 (⭐ 32, 🍴 15) - MCP Server to interact with Monday.com boards and items
pythonmcpserverhttpgitpip install git+https://github.com/sakce/mcp-server-monday - mcp-server-rememberizer 🐍 🏠 (⭐ 32, 🍴 5, 🐛 1) - An MCP Server to enable global access to Rememberizer
pythonmcprememberizerskydeckaiserverpip install git+https://github.com/skydeckai/mcp-server-rememberizer - Rootly-MCP-server 🐍 🏠 (⭐ 32, 🍴 9) - Rootly MCP server (Python-based)
pythonmcpserverhttpaipip install git+https://github.com/Rootly-AI-Labs/Rootly-MCP-server - llm-server 📘 🏠 (⭐ 32, 🍴 11, 🐛 23) - 🤖 Open-source LLM server (OpenAI, Ollama, Groq, Anthropic) with support for HTTP, Streaming, Agents, RAG (Deprecated check out Orchestra) ->
typescriptaianthropicbedrockfastapinpm install promptengineers-ai/llm-server - Basecamp-MCP-Server 🐍 🏠 📇 (⭐ 31, 🍴 7, 🐛 3) - An MCP Server that interacts with the Basecamp 3+ API
pythonmcpserverapihttppip install git+https://github.com/georgeantonopoulos/Basecamp-MCP-Server - devcontext 🏠 (⭐ 31, 🍴 10, 🐛 8) - DevContext is a cutting-edge Model Context Protocol (MCP) server designed to provide developers with continuous, project-centric context awareness. Unlike traditional context systems, DevContext continuously learns from and adapts to your development patterns and delivers highly relevant context providing a deeper understanding of your codebase.
htmlagent-memoryagent-toolkitagent-toolsagentic-aigit clone https://github.com/aurda012/devcontext - gradle-mcp-server 🎯 🏠 📇 (⭐ 31, 🍴 4, 🐛 3) - A Model Context Protocol (MCP) server to enable AI tools to interact with Gradle projects programmatically.
kotlinmcpserveraiapigit clone https://github.com/IlyaGulya/gradle-mcp-server - mcp-flight-search 🐍 🏠 (⭐ 31, 🍴 16) - MCP Server implementation for the Model Context Protocol (MCP) enabling AI tool usage - Realtime Flight Search
pythonaifligh-searchgenaimcppip install git+https://github.com/arjunprabhulal/mcp-flight-search - mcp-gemini-server 📘 🏠 (⭐ 31, 🍴 13, 🐛 1) - This project provides a dedicated MCP (Model Context Protocol) server that wraps the @google/genai SDK. It exposes Google's Gemini model capabilities as standard MCP tools, allowing other LLMs (like Cline) or MCP-compatible systems to leverage Gemini's features as a backend workhorse.
typescriptaiclaudegeminigemini-apinpm install bsmi021/mcp-gemini-server - mcp-server-js 📘 🏠 📇 (⭐ 31, 🍴 14, 🐛 2) - An MCP (Model Context Protocol) server that enables ✨ AI platforms to interact with 🤖 YepCode's infrastructure. Turn your YepCode processes into powerful tools that AI assistants can use 🚀
typescriptagentaiai-agentai-agentsnpm install yepcode/mcp-server-js - mentor-mcp-server 📘 🏠 📇 (⭐ 31, 🍴 15, 🐛 4) - A Model Context Protocol server providing LLM Agents a second opinion via AI-powered Deepseek-Reasoning R1 mentorship capabilities, including code review, design critique, writing feedback, and idea brainstorming through the Deepseek API.
typescriptai-mentorllmllm-agentmcpnpm install cyanheads/mentor-mcp-server - mcp-jinaai-reader 📜 🏠 📇 (⭐ 31, 🍴 4, 🐛 1) - 🔍 Model Context Protocol (MCP) tool for parsing websites using the Jina.ai Reader
pythonmcpserverapiaipip install git+https://github.com/ASRagab/mcp-jinaai-reader - pbixray-mcp-server 🐍 🏠 (⭐ 31, 🍴 7, 🐛 2) - MCP server to give llms such as Claude, GitHub Copilot etc full PowerBI model context (from input .pbix) through tools based on PBIXRay python package.
pythonclaudemcp-serverpbix-filespowerbipip install git+https://github.com/jonaolden/pbixray-mcp-server - trello-mcp-server 🐍 🏠 (⭐ 31, 🍴 22, 🐛 3) - A simple yet powerful MCP server for Trello.
pythonmcpserverpip install git+https://github.com/m0xai/trello-mcp - aps-mcp-server 📘 🏠 📇 (⭐ 30, 🍴 10) - Experimental Model Context Protocol server providing access to Autodesk Platform Services API.
pythonmcpserverapitypescriptpip install git+https://github.com/kpphillips/aps-mcp - comfy-mcp-server 🐍 🏠 (⭐ 30, 🍴 9, 🐛 2) - A server using FastMCP framework to generate images based on prompts via a remote Comfy server.
pythoncomfyuimcp-servermcpserverpip install git+https://github.com/lalanikarim/comfy-mcp-server - davinci-resolve-mcp 🐍 🏠 (⭐ 30, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server for interacting with DaVinci Resolve and Fusion
pythonmcpserverpip install git+https://github.com/apvlv/davinci-resolve-mcp - Fast-LLM-Agent-MCP 🐍 🏠 (⭐ 30, 🍴 8) - This repo covers LLM, Agents concepts both theoretically and practically: LLMs, RAG, Fine Tuning, Agents, Tools, MCP, AWS Strands Agents, Google Agent Development Kit, ADK, Reference Documents, etc.
pythonagent-developmentagentsaiawspip install git+https://github.com/omerbsezer/Fast-LLM-Agent-MCP - groq-mcp-server 🐍 🏠 (⭐ 30, 🍴 11) - Groq MCP server (Python-based)
pythonmanaged-by-terraformmcpserverpip install git+https://github.com/groq/groq-mcp-server - mcp-aoai-web-browsing 🐍 🏠 (⭐ 30, 🍴 10, 🐛 2) - A minimal Model Context Protocol 🖥️ server/client🧑💻with Azure OpenAI and 🌐 web browser control via Playwright.
pythonazure-openaimcpmcp-clientmcp-serverpip install git+https://github.com/kimtth/mcp-aoai-web-browsing - openmm-mcp-server 🐍 🏠 (⭐ 30, 🍴 6) - OpenMM, an open-source platform for molecular dynamics (MD) simulations, is supported by an MCP server that offers a structured communication interface for task submission, management, and execution.
pythonmcpserverpip install git+https://github.com/PhelanShao/openmm-mcp-server - Sci-Hub-MCP-Server 🐍 🏠 (⭐ 30, 🍴 11, 🐛 7) - 🔍 Enable AI assistants to search, access, and analyze academic papers through Sci-Hub using a simple MCP interface.
pythonmcpaipip install git+https://github.com/JackKuo666/Sci-Hub-MCP-Server - v0-mcp 🐍 🏠 (⭐ 30, 🍴 1) - MCP Server to connect your MCP host to V0.dev directly
pythonmcpserverpip install git+https://github.com/m2rads/v0-mcp - zilliz-mcp-server 🐍 🏠 (⭐ 30, 🐛 1) - A Model Context Protocol (MCP) server seamlessly connecting AI Agents and AI coding tools with Zilliz Cloud https://zilliz.com/
pythonmcpserveraimlpip install git+https://github.com/zilliztech/zilliz-mcp-server - simple-psql-mcp 🐍 🏠 (⭐ 30, 🍴 4, 🐛 2) - A beginner-friendly MCP server template featuring a PostgreSQL connector with clean, easy-to-understand code. Perfect for developers new to Model Context Protocol who want to experiment and create their own AI tool connectors with minimal setup.
pythonmcpserveraipostgrespip install git+https://github.com/NetanelBollag/simple-psql-mcp - claude-code-mcp 📜 🏠 (⭐ 29, 🍴 3) - MCP Server connects with claude code local command.
javascriptanthropicanthropic-claudeclaudeclaude-codenpm install KunihiroS/claude-code-mcp - mcp_server_filesystem 🐍 🏠 (⭐ 29, 🍴 8, 🐛 5) - MCP File System Server: A secure Model Context Protocol server that provides file operations for AI assistants. Enables Claude and other assistants to safely read, write, and list files in a designated project directory with robust path validation and security controls.
pythonai-assistantclaude-aiclaude-desktopfile-operationspip install git+https://github.com/MarcusJellinghaus/mcp_server_filesystem - mcp-stockscreen 🐍 🏠 (⭐ 29, 🍴 10) - Stock screening provider for Claude Desktop using MCP
pythonmcppip install git+https://github.com/twolven/mcp-stockscreen - oracledb_mcp_server 🐍 🏠 (⭐ 29, 🍴 5, 🐛 1) - MCP server to connect to Oracle Database
pythonmcpserverdatabasepip install git+https://github.com/rahgadda/oracledb_mcp_server - prometheus_mcp_server 🐍 🏠 (⭐ 29, 🍴 9, 🐛 2) - A Model Context Protocol (MCP) server enabling LLMs to query, analyze, and interact with Prometheus databases through predefined routes.
pythonmodel-context-protocolprometheusmcpserverpip install git+https://github.com/CaesarYangs/prometheus_mcp_server - rmcp 🐍 🏠 (⭐ 29, 🍴 5) - R MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/gojiplus/rmcp - unreal-mcp 🐍 🏠 (⭐ 29, 🍴 5, 🐛 2) - Unreal Engine MCP server for Claude Desktop (early alpha preview)
pythongenaimcp-serverunreal-engine-5mcppip install git+https://github.com/runeape-sats/unreal-mcp - x64dbg-mcp 🐍 🏠 (⭐ 29, 🍴 5) - An MCP server for the x64dbg debugger
pythonmcpserverpip install git+https://github.com/CaptainNox/x64dbg-mcp - advanced-homeassistant-mcp 📘 🏠 (⭐ 28, 🍴 11, 🐛 8) - An advanced MCP server for Home Assistant. 🔋 Batteries included.
typescripthome-assistantllmmcp-serverspeech-recognitionnpm install jango-blockchained/advanced-homeassistant-mcp - calculator-mcp-server 🐍 🏠 (⭐ 28, 🍴 14, 🐛 2) - A Model Context Protocol (MCP) server that provides Claude with advanced mathematical calculation capabilities
pythonmcpservertypescriptpip install git+https://github.com/huhabla/calculator-mcp-server - chat-nextjs-mcp-client 📘 🏠 (⭐ 28, 🍴 8) - ⚡ Chat MCP Client for Remote hosted MCP Servers (with Composio) and locally hosted MCP servers. 📡
typescriptaicomposiomcpnextjsnpm install shricodev/chat-nextjs-mcp-client - dappier-mcp 🐍 🏠 (⭐ 28, 🍴 10, 🐛 1) - Enable fast, free real-time web search and access premium data from trusted media brands—news, financial markets, sports, entertainment, weather, and more. Build powerful AI agents with Dappier.
pythonwebairusthttppip install git+https://github.com/DappierAI/dappier-mcp - mcp_newsnow 🐍 🏠 📇 (⭐ 28, 🍴 8, 🐛 3) - 一个基于 Model Context Protocol (MCP) 的新闻聚合服务器,通过 Newsnow API 提供多平台热点新闻和趋势话题。
pythonmcp-servernewsnowmcpapipip install git+https://github.com/sligter/mcp_newsnow - mcp-panther 🐍 🏠 (⭐ 28, 🍴 13, 🐛 11) - Write detections, investigate alerts, and query logs from your favorite AI agents
pythonaicybersecuritymcp-serversecurity-operationspip install git+https://github.com/panther-labs/mcp-panther - mcp-server-esignatures 🐍 🏠 📇 (⭐ 28, 🍴 10, 🐛 4) - MCP server for eSignatures (https://esignatures.com)
pythonmcpserverhttpgitpip install git+https://github.com/esignaturescom/mcp-server-esignatures - mcp-server-jupyter 🐍 🏠 (⭐ 28, 🍴 5, 🐛 1) - MCP server for Jupyter Notebooks and JupyterLab
pythonmcpserverpip install git+https://github.com/ihrpr/mcp-server-jupyter - mcp-veo2 📘 🏠 (⭐ 28, 🍴 18, 🐛 4) - MCP for Video- or Image-Generation with Google VEO2
typescriptaiimage-generationmcpmcp-servernpm install mario-andreschak/mcp-veo2 - volatility-mcp 🐍 🏠 📇 (⭐ 28, 🍴 5, 🐛 2) - This repo hosts an MCP server for volatility3.x
pythonmcpserverapirestpip install git+https://github.com/Gaffx/volatility-mcp - dune-analytics-mcp 🐍 🏠 (⭐ 27, 🍴 8, 🐛 4) - A mcp server that bridges Dune Analytics data to AI agents.
pythonmcpserveraihttppip install git+https://github.com/kukapay/dune-analytics-mcp - mcp-gitlab-server 📘 🏠 (⭐ 27, 🍴 15, 🐛 1) - Enhanced MCP server for GitLab: group projects listing and activity tracking
typescriptaianthropicgitgitlabnpm install yoda-digital/mcp-gitlab-server - mcp-ollama 🐍 🏠 (⭐ 27, 🍴 10) - Query model running with Ollama from within Claude Desktop or other MCP clients
pythonmcppip install git+https://github.com/emgeee/mcp-ollama - mcp-sefaria-server 🐍 🏠 📇 (⭐ 27, 🍴 6, 🐛 2) - Fetch and read Jewish texts through the API of Sefaria.org
pythonapipip install git+https://github.com/Sivan22/mcp-sefaria-server - mcp-tool-builder 🐍 🏠 (⭐ 27, 🍴 7, 🐛 3) - MCP server that creates its own tools as needed
pythonmcpserverpip install git+https://github.com/hanweg/mcp-tool-builder - mcp-zenml 🐍 🏠 (⭐ 27, 🍴 10, 🐛 3) - MCP server to connect an MCP client (Cursor, Claude Desktop etc) with your ZenML MLOps and LLMOps pipelines
httpmlllmgitgithubpip install git+https://github.com/zenml-io/mcp-zenml - mysql-mcp-server 🐍 🏠 (⭐ 27, 🍴 4, 🐛 4) - A server application designed on top of MCP to interact with Cursor and MySQL.
pythonmcpserverdatabasemysqlpip install git+https://github.com/Wang4XD/MySQL-MCP-Server - paddle-mcp-server 📘 🏠 📇 (⭐ 27, 🍴 8) - Interact with the Paddle API using AI assistants like Claude, or in AI-powered IDEs like Cursor. Manage product catalog, billing and subscriptions, and reports.
typescriptllmmcpapiainpm install PaddleHQ/paddle-mcp-server - zendesk-mcp-server 🐍 🏠 (⭐ 27, 🍴 18, 🐛 2) - A Model Context Protocol server for Zendesk
pythonmcp-serverzendeskserverpip install git+https://github.com/reminia/zendesk-mcp-server - alpaca-mcp 🐍 🏠 📇 (⭐ 26, 🍴 10, 🐛 2) - MCP for the Alpaca trading API to manage stock and crypto portfolios, place trades, and access market data
pythonmcpapihttpgitpip install git+https://github.com/laukikk/alpaca-mcp - ESP32MCPServer 🏠 (⭐ 26, 🍴 10) - Allow AI models connect to ESP32 exposed interfaces. AI generated MCP server for ESP32.
c++mcpserveraigit clone https://github.com/navado/ESP32MCPServer - ifly-workflow-mcp-server 🐍 🏠 (⭐ 26, 🍴 4, 🐛 3) - This a simple implementation of an MCP server using iFlytek. It enables calling iFlytek workflows through MCP tools.
pythonmcpserverhttpgitpip install git+https://github.com/iflytek/ifly-workflow-mcp-server - illustrator-mcp-server 🐍 🏠 (⭐ 26, 🍴 5, 🐛 3) - mcp server to run scripts on adobe illustrator
pythonclaudeillustratorillustrator-scriptsmcp-serverpip install git+https://github.com/spencerhhubert/illustrator-mcp-server - mattermost-mcp-host 🐍 🏠 (⭐ 26, 🍴 15, 🐛 6) - A Mattermost integration that connects to Model Context Protocol (MCP) servers, leveraging a LangGraph-based Agent.
pythonlanggraphllmmattermostmcppip install git+https://github.com/jagan-shanmugam/mattermost-mcp-host - mcp_autogen_sse_stdio 🐍 🏠 (⭐ 26, 🍴 3, 🐛 1) - This repository demonstrates how to use AutoGen to integrate local and remote MCP (Model Context Protocol) servers. It showcases a local math tool (math_server.py) using Stdio and a remote Apify tool (RAG Web Browser Actor) via SSE for tasks like arithmetic and web browsing.
pythonaiautogenazuredata-sciencepip install git+https://github.com/SaM-92/mcp_autogen_sse_stdio - mcp-oceanbase 🐍 🏠 (⭐ 26, 🍴 23, 🐛 1) - MCP Server for OceanBase database and its tools
pythonmcpserverdatabasehttppip install git+https://github.com/oceanbase/mcp-oceanbase - ClaudeMCPServer 🐍 🏠 (⭐ 26, 🍴 5, 🐛 1) - MCP Server implementation for Claude
pythonmcpserverpip install git+https://github.com/syedazharmbnr1/ClaudeMCPServer - fibery-mcp-server 🐍 🏠 (⭐ 26, 🍴 10, 🐛 3) - Python-based
pythonhttpgitgithubpip install git+https://github.com/Fibery-inc/fibery-mcp-server - mcp-server-singlestore 🐍 🏠 📇 (⭐ 26, 🍴 10, 🐛 11) - MCP server for interacting with SingleStore Management API and services
pythonmcpserverapidatabasepip install git+https://github.com/singlestore-labs/mcp-server-singlestore - mcp-vertexai-search 🐍 🏠 (⭐ 26, 🍴 11, 🐛 5) - A MCP server for Vertex AI Search
pythonmcpserveraihttppip install git+https://github.com/ubie-oss/mcp-vertexai-search - mcp-websocket 🐍 🏠 (⭐ 26, 🍴 3) - This server implements an MCP (Model Context Protocol) server with WebSocket enhancements for real-time data updates.
pythonmcpserverwebwebsocketpip install git+https://github.com/virajsharma2000/mcp-websocket - n8n-AI-agent-DVM-MCP-client 🏠 (⭐ 26, 🍴 4) - An AI agent built in n8n which can find and use Model Context Protocol (MCP) Server Tools served as Data Vending Machines (DVM) over the Nostr network.
aidvmmcpn8nnostrgit clone https://github.com/r0d8lsh0p/n8n-AI-agent-DVM-MCP-client - ramp_mcp 🐍 🏠 📇 (⭐ 26, 🍴 9, 🐛 5) - ramp_mcp (Python-based)
pythonmcpapihttpaipip install git+https://github.com/ramp-public/ramp-mcp - things-fastmcp 🐍 🏠 (⭐ 26, 🍴 8, 🐛 2) - Enhanced FastMCP implementation of the Things MCP server for Claude and Windsurf
pythonmcpserverpip install git+https://github.com/excelsier/things-fastmcp - MCP-Geo 🐍 🏠 (⭐ 25, 🍴 4, 🐛 1) - Geocoding MCP server with GeoPY!
pythonmcpservertypescriptwebpip install git+https://github.com/webcoderz/MCP-Geo - mcp-image-recognition 🐍 🏠 📇 (⭐ 25, 🍴 8, 🐛 2) - An MCP server that provides image recognition 👀 capabilities using Anthropic and OpenAI vision APIs
pythonmcpserverapiaipip install git+https://github.com/mario-andreschak/mcp-image-recognition - MCP-llms-txt 🐍 🏠 (⭐ 25, 🍴 6) - MCP server for SecretiveShell/Awesome-llms-txt. Add documentation directly into your conversation via MCP resources.
pythonmcpserverllmdocumentationpip install git+https://github.com/SecretiveShell/MCP-llms-txt - mcp-server-atlassian-confluence 📘 🏠 (⭐ 25, 🍴 13, 🐛 8) - Node.js/TypeScript MCP server for Atlassian Confluence. Provides tools enabling AI systems (LLMs) to list/get spaces & pages (content formatted as Markdown) and search via CQL. Connects AI seamlessly to Confluence knowledge bases using the standard MCP interface.
typescriptaiai-connectorai-integrationanthropicnpm install aashari/mcp-server-atlassian-confluence - mcp-server-ledger 🐍 🏠 (⭐ 25, 🍴 6, 🐛 4) - A Model Context Protocol server for interacting with Ledger CLI, a powerful double-entry accounting system. This server enables Large Language Models to query and analyze financial data through a standardized interface, making it easy for AI assistants to help with financial reporting, budget analysis, and accounting tasks.
pythonserveraihttpgitpip install git+https://github.com/minhyeoky/mcp-server-ledger - mcp-server-sql-analyzer 🐍 🏠 (⭐ 25, 🍴 5) - MCP server for SQL static analysis.
pythonmcpserverhttpgitpip install git+https://github.com/j4c0bs/mcp-server-sql-analyzer - oura-mcp-server 🐍 🏠 📇 (⭐ 25, 🍴 10, 🐛 4) - MCP server for Oura API integration
pythonmcpoura-ringserverapipip install git+https://github.com/tomekkorbak/oura-mcp-server - qiniu-mcp-server 🐍 🏠 (⭐ 25, 🍴 12, 🐛 2) - Python-based
pythonhttpaigitgithubpip install git+https://github.com/qiniu/qiniu-mcp-server - semanticscholar-MCP-Server 🐍 🏠 📇 (⭐ 25, 🍴 6, 🐛 6) - 🔍 This project implements a Model Context Protocol (MCP) server for interacting with the Semantic Scholar API. It provides tools for searching papers, retrieving paper and author details, and fetching citations and references.
pythonmcpserverapiaipip install git+https://github.com/JackKuo666/semanticscholar-MCP-Server - systemprompt-mcp-notion 📘 🏠 (⭐ 25, 🍴 11, 🐛 4) - This an Model Context Protocol (MCP) server that integrates Notion into your AI workflows. This server enables seamless access to Notion through MCP, allowing AI agents to interact with pages, databases, and comments.
typescriptaimcpmcp-serversystempromptnpm install Ejb503/systemprompt-mcp-notion - bitrise-mcp 🐍 🏠 📇 (⭐ 25, 🍴 9, 🐛 4) - MCP Server for the Bitrise API, enabling app management, build operations, artifact management and more.
pythonmcpmcp-serverserverapipip install git+https://github.com/bitrise-io/bitrise-mcp - alpaca-mcp-server 🐍 🏠 📇 (⭐ 24, 🍴 19, 🐛 5) - Model Context Protocol (MCP) server for Alpaca trading API
pythonmcpserverapialpaca-trading-apipip install git+https://github.com/tedlikeskix/alpaca-mcp-server - arxiv-mcp-server 🐍 🏠 📇 (⭐ 24, 🍴 5) - An MCP server that enables interacting with the arXiv API using natural language
pythonmcpserverapihttppip install git+https://github.com/prashalruchiranga/arxiv-mcp-server - freshdesk_mcp 🐍 🏠 (⭐ 24, 🍴 15, 🐛 3) - MCP server created for Freshdesk, allowing AI models to interact with Freshdesk modules
pythonmcpserveraihttppip install git+https://github.com/effytech/freshdesk_mcp - imagegen-mcp 📘 🏠 (⭐ 24, 🍴 6, 🐛 1) - MCP server for OpenAI Image Generation & Editing — text-to-image, image-to-image (with mask), no extra plugins.
typescriptcursormcpmcp-serveropenainpm install spartanz51/imagegen-mcp - itential-mcp 🐍 🏠 (⭐ 24, 🍴 6, 🐛 1) - 🔌 Itential Platform MCP Server
pythonaiautomationmcpmcp-serverpip install git+https://github.com/itential/itential-mcp - langchain-mcp-tools-py 🐍 🏠 (⭐ 24, 🍴 9, 🐛 1) - MCP to LangChain Tools Conversion Utility / Python
pythonlangchainlangchain-pythonmcpmcp-clientpip install git+https://github.com/hideya/langchain-mcp-tools-py - logseq-mcp 🐍 🏠 (⭐ 24, 🍴 9) - simple logseq mcp server
pythonmcpserverpip install git+https://github.com/dailydaniel/logseq-mcp - mcp-server-synology 🐍 🏠 📇 (⭐ 24, 🍴 2, 🐛 1) - 💾 Model Context Protocol (MCP) server for Synology NAS - Enables AI assistants (Claude, Cursor, Continue) to manage files, downloads, and system operations through secure API integration. Features Docker deployment, auto-authentication, and comprehensive file system tools.
pythonmcpmcp-serversynologyserverpip install git+https://github.com/atom2ueki/mcp-server-synology - shotgrid-mcp-server 🐍 🏠 (⭐ 24, 🍴 4, 🐛 8) - A Model Context Protocol (MCP) server for Autodesk ShotGrid/Flow Production Tracking (FPT) with comprehensive CRUD operations and data management capabilities.
pythonmcpserverpip install git+https://github.com/loonghao/shotgrid-mcp-server - mcp-server-redis 🐍 🏠 (⭐ 24, 🍴 4, 🐛 1) - MCP server to interact with Redis Server, AWS Memory DB, etc for caching or other use-cases where in-memory and key-value based storage is appropriate
pythonmcpserverredisawspip install git+https://github.com/prajwalnayak7/mcp-server-redis - alibabacloud-hologres-mcp-server 🐍 🏠 (⭐ 23, 🍴 8, 🐛 3) - Python-based
pythonhttpgitgithubpip install git+https://github.com/aliyun/alibabacloud-hologres-mcp-server - asterisk-mcp-server 🐍 🏠 (⭐ 23, 🍴 5, 🐛 2) - Asterisk Model Context Protocol (MCP) server.
pythonaiclaudeclaude-3-7-sonnetllmpip install git+https://github.com/getAsterisk/asterisk-mcp-server - fmp-mcp-server 🐍 🏠 (⭐ 23, 🍴 2) - Financial Modeling Prep MCP Server
pythonfinance-modelling-prepmcpserverpip install git+https://github.com/cdtait/fmp-mcp-server - mcp-client-x 🐍 🏠 (⭐ 23, 🍴 3, 🐛 1) - Python MCP client + server example
pythonmcpserverpip install git+https://github.com/RGGH/mcp-client-x - mcp-marketplace 🐍 🏠 📇 (⭐ 23, 🍴 4) - OpenSource MCP Marketplace | MCP Servers Tools Meta Dataset | Web API | Web Client Integration
pythonmcpmcp-clientmcp-marketplacemcp-serverpip install git+https://github.com/AI-Agent-Hub/mcp-marketplace - mcp-simple-timeserver 🐍 🏠 (⭐ 23, 🍴 15, 🐛 2) - Simple solution to give Claude ability to check current time via MCP
pythonclaudeclaude-aimcpmodel-context-protocolpip install git+https://github.com/andybrandt/mcp-simple-timeserver - mcp-structured-thinking 📘 🏠 (⭐ 23, 🍴 4, 🐛 6) - A TypeScript Model Context Protocol (MCP) server to allow LLMs to programmatically construct mind maps to explore an idea space, with enforced "metacognitive" self-reflection
typescriptaimcpmcp-servermindmapnpm install Promptly-Technologies-LLC/mcp-structured-thinking - mcp-video-digest 🐍 🏠 (⭐ 23, 🍴 5, 🐛 1) - MCP Server for transcribing videos via video links and summarizing video content
pythonmcpserverpip install git+https://github.com/R-lz/mcp-video-digest - phonepi-mcp 📜 🏠 (⭐ 23, 🍴 4, 🐛 1) - PhonePi MCP enables seamless integration between desktop AI tools and your smartphone, providing 23+ direct actions including SMS messaging, phone calls, contact management, snippet creation and search, clipboard sharing, notifications, battery status checks, and remote device controls.
javascriptaiai-smartphoneclaudecursornpm install priyankark/phonepi-mcp - qmt-mcp-server 🐍 🏠 (⭐ 23, 🍴 3, 🐛 3) - QMT-MCP-Server (Python-based)
pythonmcpserverpip install git+https://github.com/nnquant/qmt-mcp-server - alibabacloud-dms-mcp-server 🐍 🏠 (⭐ 22, 🍴 8, 🐛 6) - A universal multi-cloud data MCP Server supporting over 40 types of data source connections, providing secure, unified data access in a single platform.
Supports full range of Alibaba Cloud services and Mainstream databases/data warehouses.
pythonaianalyticsdbclaudeclickhousepip install git+https://github.com/aliyun/alibabacloud-dms-mcp-server - cinema4d-mcp 🐍 🏠 (⭐ 22, 🍴 6, 🐛 6) - Cinema 4D plugin integrating Claude AI for prompt-driven 3D modeling, scene creation, and manipulation.
pythonai-integrationcinema-4dcinema-4d-pluginclaude-aipip install git+https://github.com/ttiimmaacc/cinema4d-mcp - claude_autoapprove_mcp 🐍 🏠 (⭐ 22, 🍴 3) - An MCP server to inject auto-approve MCP functionality into Claude Desktop
pythonclaude-aiclaude-desktopelectronmcppip install git+https://github.com/PyneSys/claude_autoapprove_mcp - cyberchef-api-mcp-server 🐍 🏠 📇 (⭐ 22, 🍴 4, 🐛 1) - CyberChef API MCP Server ✨🧑🍳
pythonmcpserverapihttppip install git+https://github.com/slouchd/cyberchef-api-mcp-server - datomic-mcp 🏠 (⭐ 22, 🍴 1) - Datomic MCP Server so your AI model can query your database (uses Modex MCP library)
clojuremcpserverdatabaseaigit clone https://github.com/theronic/datomic-mcp - linkedin-mcp 🐍 🏠 (⭐ 22, 🍴 7, 🐛 1) - A MCP server for LinkedIn to seamlessly apply for jobs🚀
pythonmcpservermlpip install git+https://github.com/Hritik003/linkedin-mcp - ezmcp 🐍 🏠 (⭐ 22, 🍴 6, 🐛 1) - Easy-to-use MCP server framework specialized for SSE.
pythonframeworkllmmcpssepip install git+https://github.com/jujumilk3/ezmcp - filesystem-operations-mcp 🐍 🏠 (⭐ 22, 🍴 4) - MCP Server for reading many files at the same time
pythonmcpserverpip install git+https://github.com/strawgate/mcp-many-files - greptimedb-mcp-server 🐍 🏠 (⭐ 22, 🍴 10, 🐛 4) - A Model Context Protocol (MCP) server implementation for GreptimeDB
pythonmcpserverhttpaipip install git+https://github.com/GreptimeTeam/greptimedb-mcp-server - MCP-actions-adapter 🐍 🏠 📇 (⭐ 22, 🍴 1, 🐛 1) - A simple adapter to convert a MCP server to a GPT actions compatible API
pythonmcpserverapipip install git+https://github.com/SecretiveShell/MCP-actions-adapter - mcp-bash 🐍 🏠 (⭐ 22, 🍴 11, 🐛 1) - A simple model context protocol (MCP) server that allows Claude Desktop or other MCP aware clients to run Bash commands on your local machine.
pythonclaudemcp-servermcp-serversvibe-codingpip install git+https://github.com/patrickomatik/mcp-bash - mcp-web-browser 🐍 🏠 📇 (⭐ 22, 🍴 7) - An advanced web browsing server for the Model Context Protocol (MCP) powered by Playwright, enabling headless browser interactions through a flexible, secure API.
pythonmcpserverapiwebpip install git+https://github.com/random-robbie/mcp-web-browser - notion-mcp 🐍 🏠 📇 (⭐ 22, 🍴 3, 🐛 1) - A simple Model Context Protocol (MCP) server that integrates with Notion's API to manage my personal todo list.
pythonmcpserverapitypescriptpip install git+https://github.com/Badhansen/notion-mcp - proxy 🐍 🏠 (⭐ 22, 🍴 3) - A Minecraft Pi Proxy to allow players to connect to remote servers.
pythonmcpiminecraftminecraft-piminecraft-pi-editiongit clone https://github.com/MCPI-Revival/proxy - py-mcp-mssql 🐍 🏠 (⭐ 22, 🍴 13, 🐛 3) - py-mcp-mssql (Python-based)
pythonmcpdatabasehttpgitpip install git+https://github.com/amornpan/py-mcp-mssql - PythonMCPServer 🐍 🏠 (⭐ 22, 🍴 15) - Python-based
pythonpip install git+https://github.com/techwithtim/PythonMCPServer - steampipe-mcp 📘 🏠 (⭐ 22, 🍴 4) - Enable AI assistants to explore and query your Steampipe data!
typescriptaimcpmcp-serversteampipenpm install turbot/steampipe-mcp - wxauto-mcp 🐍 🏠 (⭐ 22, 🍴 4) - 自动化微信操作的mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/barantt/wxauto-mcp - home-assistant-mcp 🐍 🏠 (⭐ 22, 🍴 8, 🐛 3) - A Model Context Protocol (MCP) integration that enables AI assistants to search for and control Home Assistant devices through natural language commands in Cursor.
pythonmcpservertypescriptaipip install git+https://github.com/miguelg719/home-assistant-mcp - mcp-toolbox 🐍 🏠 (⭐ 22, 🍴 1, 🐛 3) - Maintenance of a set of tools to enhance LLM through MCP protocols.
pythonmcpaillmpip install git+https://github.com/ai-zerolab/mcp-toolbox - mcp-servers 📜 🏠 (⭐ 22, 🍴 7, 🐛 1) - mcp servers on Function Compute
typescriptaiai-agentsai-automationclaude-ainpm install rajvirtual/MCP-Servers - alibabacloud-dataworks-mcp-server 📘 🏠 📇 (⭐ 21, 🍴 6, 🐛 3) - A Model Context Protocol (MCP) server that provides tools for AI, allowing it to interact with the DataWorks Open API through a standardized interface. This implementation is based on the Aliyun Open API and enables AI agents to perform cloud resources operations seamlessly.
typescriptaialiyunbigdatadatanpm install aliyun/alibabacloud-dataworks-mcp-server - cfbd-mcp-server 🐍 🏠 📇 (⭐ 21, 🍴 11, 🐛 4) - An MCP server enabling CFBD API queries within Claude Desktop.
pythonapi-clientclaude-desktopcollege-footballmcppip install git+https://github.com/lenwood/cfbd-mcp-server - fastdomaincheck-mcp-server-python 🐍 🏠 (⭐ 21, 🍴 2, 🐛 2) - MCP Server for checking domain name availability using WHOIS and DNS via stdio.
pythonmcpserveraipip install git+https://github.com/bingal/fastdomaincheck-mcp-server-python - fewsats-mcp 🐍 🏠 (⭐ 21, 🍴 7, 🐛 2) - Fewsats MCP server (Python-based)
pythonmcpserverhttpaipip install git+https://github.com/Fewsats/fewsats-mcp - higress-ops-mcp-server 🐍 🏠 (⭐ 21, 🍴 8, 🐛 6) - A Model Context Protocol (MCP) server implementation that enables comprehensive configuration and management of Higress.
pythonmcpserverhttpgitpip install git+https://github.com/higress-group/higress-ops-mcp-server - mcp_generate_images 🐍 🏠 (⭐ 21, 🍴 3) - 可用于cursor 集成 mcp server
pythonmcpserverpip install git+https://github.com/chenyeju295/mcp_generate_images - mcp-android-server-python 🐍 🏠 (⭐ 21, 🍴 3, 🐛 4) - MCP Android agent - This project provides an MCP (Model Context Protocol) server for automating Android devices using uiautomator2. It's designed to be easily plugged into AI agents like GitHub Copilot Chat, Claude, or Open Interpreter to control Android devices through natural language.
pythonagentic-aiaiandroidautomationpip install git+https://github.com/nim444/mcp-android-server-python - mcp-pentest 🐍 🏠 (⭐ 21, 🍴 1) - An MCP server for pentesting. Contributors wanted!
pythonmcpservertestingpip install git+https://github.com/allsmog/mcp-pentest - mcp-playground 🐍 🏠 (⭐ 21, 🍴 7, 🐛 1) - Simple MCP Client for remote MCP Servers 🌐
pythonmcpserverpip install git+https://github.com/zanetworker/mcp-sse-client-python - mcp-sentry 🐍 🏠 (⭐ 21, 🍴 5, 🐛 2) - A Model Context Protocol server for retrieving and analyzing issues from Sentry.io
pythonmcpmcp-serversentryserverpip install git+https://github.com/MCP-100/mcp-sentry - mcp-server-atlassian-jira 📘 🏠 (⭐ 21, 🍴 10, 🐛 14) - Node.js/TypeScript MCP server for Atlassian Jira. Equips AI systems (LLMs) with tools to list/get projects, search/get issues (using JQL/ID), and view dev info (commits, PRs). Connects AI capabilities directly into Jira project management and issue tracking workflows.
typescriptaiai-connectorai-integrationanthropicnpm install aashari/mcp-server-atlassian-jira - mcp-server-webcrawl 🏠 (⭐ 21, 🍴 6) - MCP server tailored to connecting web crawler data and archives
htmlarchiveboxhttrackinterrobotkatanagit clone https://github.com/pragmar/mcp_server_webcrawl - MCPServerTest 🐍 🏠 (⭐ 21, 🍴 6) - MCP Server测试系列 (Python-based)
pythonmcpserverpip install git+https://github.com/NanGePlus/MCPServerTest - pptx-xlsx-mcp 🐍 🏠 (⭐ 21, 🍴 2, 🐛 2) - Antrophics Model context protocol to edit powerpoint files
pythonpip install git+https://github.com/jenstangen1/pptx-mcp - Volatility-MCP-Server 🐍 🏠 (⭐ 21, 🍴 2, 🐛 3) - A Model Context Protocol (MCP) server that integrates Volatility 3 memory forensics framework with Claude
pythonmcpserverpip install git+https://github.com/bornpresident/Volatility-MCP-Server - zerodha-mcp 🐍 🏠 (⭐ 21, 🍴 9, 🐛 1) - Zerodha MCP Server & Client - AI Agent (w/Agno & w/Google ADK)
pythonagentagentic-aiagnoaipip install git+https://github.com/mtwn105/zerodha-mcp - cloudflare-api-mcp 📘 🏠 📇 (⭐ 21, 🍴 6, 🐛 2) - Lightweight MCP server to give your Cursor Agent access to the Cloudflare API.
typescriptaicloudflarecursormcpnpm install amxv/cloudflare-api-mcp - memory-journal-mcp-server 🐍 🏠 (⭐ 21, 🍴 4, 🐛 1) - MCP server designed to help you search and analyze your photo library (iCloud)
pythonclaude-desktopmcpmcp-serversmart-photo-albumpip install git+https://github.com/Siddhant-K-code/memory-journal-mcp-server - python-sequential-thinking-mcp 🐍 🏠 (⭐ 21, 🍴 2) - A Python implementation of the Sequential Thinking MCP server using the official Model Context Protocol (MCP) Python SDK. This server facilitates a detailed, step-by-step thinking process for problem-solving and analysis.
pythonmcpserveraipip install git+https://github.com/XD3an/python-sequential-thinking-mcp - seatunnel-mcp 🐍 🏠 📇 (⭐ 21, 🍴 6, 🐛 2) - A Model Context Protocol (MCP) server for Apache Seatunnel. This provides access to your Apache Seatunnel RESTful API V2 instance and the surrounding ecosystem.
pythonmcpserverapirestpip install git+https://github.com/ocean-zhc/seatunnel-mcp - dap_mcp 🐍 🏠 (⭐ 20, 🍴 3, 🐛 1) - Model Context Protocol (MCP) server that interacts with a Debugger
pythondapdebugdebug-adapter-protocoldebuggingpip install git+https://github.com/KashunCheng/dap_mcp - grumpydev-mcp 📜 🏠 (⭐ 20, 🍴 4, 🐛 2) - Let the grumpy senior dev review your code with this MCP server
javascriptgenaiscriptgenerative-aillmmcpnpm install sinedied/grumpydev-mcp - HarmonyOS-mcp-server 🐍 🏠 (⭐ 20, 🍴 6, 🐛 1) - MCP server for manipulating HarmonyOS next devices.
pythonmcpserverhttpaipip install git+https://github.com/XixianLiang/HarmonyOS-mcp-server - mcp-caiyun-weather 🐍 🏠 (⭐ 20, 🍴 3, 🐛 6) - A Model Context Protocol (MCP) server for Caiyun (ColorfulClouds) Weather.
pythonmcpweatherserveraipip install git+https://github.com/caiyunapp/mcp-caiyun-weather - mcp-joern 🐍 🏠 (⭐ 20, 🍴 4) - A simple Joern MCP Server.
pythonmcpserverpip install git+https://github.com/sfncat/mcp-joern - mcp-server-python 🐍 🏠 (⭐ 20, 🍴 8, 🐛 1) - Inkeep MCP Server (Python-based)
pythonmcpserverhttpgitpip install git+https://github.com/inkeep/mcp-server-python - pptx-mcp 🐍 🏠 (⭐ 20, 🍴 6, 🐛 1) - Create Slides with a simple MCP server using Python PPTX library
pythonmcpserverpip install git+https://github.com/samos123/pptx-mcp - revit-mcp 🐍 🏠 (⭐ 20, 🍴 9) - revit-mcp (Python-based)
pythonmcppip install git+https://github.com/ZedMoster/revit-mcp - symfony-mcp-server 🐘 🏠 (⭐ 20, 🍴 2, 🐛 2) - A Symfony package designed for building secure servers based on the Model Context Protocol, utilizing Server-Sent Events (SSE) and/or StreamableHTTP for real-time communication. It offers a scalable tool system tailored for enterprise-grade applications.
phpagentic-aiagentsaimcpgit clone https://github.com/klapaudius/symfony-mcp-server - mcp-stockflow 🐍 🏠 (⭐ 20, 🍴 6) - Stock market data provider for Claude Desktop using MCP
pythonmcppip install git+https://github.com/twolven/mcp-stockflow - youtube_mcp 🐍 🏠 (⭐ 20, 🍴 2, 🐛 1) - youtube transcriber mcp server
pythonmcpserverhttpaipip install git+https://github.com/format37/youtube_mcp - quickchat-ai-mcp 🐍 🏠 (⭐ 20, 🍴 7, 🐛 5) - The Quickchat AI MCP server
pythonmcpserveraihttppip install git+https://github.com/incentivai/quickchat-ai-mcp - WiresharkMCP 🐍 🏠 (⭐ 20, 🍴 2) - Wireshark Packet Analyzer with MCP Integration This project integrates the MCP (Message Communication Protocol) server with Wireshark to analyze and interact with network packets. The tool enables packet capture, analysis, and management using MCP while leveraging Wireshark's Lua scripting capabilities.
pythonmcpserverpip install git+https://github.com/shubham-s-pandey/wiresharkmcp - awesome-blockchain-mcps 🏠 (⭐ 19, 🍴 3, 🐛 1) - 🔗 A curated list of Blockchain & Crypto Model Context Protocol (MCP) servers. Enabling AI Agents to interact with the Blockchain, Web3, DeFi, on-chain data, on-chain actions, etc. 🚀
mcpserverwebaigit clone https://github.com/royyannick/awesome-blockchain-mcps - chroma_mcp_server 🐍 🏠 (⭐ 19, 🍴 3) - MCP Server for ChromaDB integration into Cursor with MCP compatible AI models
pythonmcpserveraipip install git+https://github.com/djm81/chroma_mcp_server - earthdata-mcp-server 🐍 🏠 (⭐ 19, 🍴 6, 🐛 5) - 🌎 ✨ Earthdata MCP Server.
pythonaiearthearthdatamcppip install git+https://github.com/datalayer/earthdata-mcp-server - emqx-mcp-server 🐍 🏠 (⭐ 19, 🍴 6, 🐛 2) - A Model Context Protocol (MCP) server implementation that provides EMQX MQTT broker interaction.
pythonmcpserverpip install git+https://github.com/Benniu/emqx-mcp-server - mcp-community 🐍 🏠 (⭐ 19, 🍴 2, 🐛 26) - Easily run, deploy, and connect to MCP servers
pythonmcpmcp-clientmcp-servermodel-context-protocolpip install git+https://github.com/Mirascope/mcp-community - mcp-datetime 🐍 🏠 (⭐ 19, 🍴 11, 🐛 6) - A MCP server for datetime formatting and file name generation.
pythonmcpserverhttpgitpip install git+https://github.com/ZeparHyfar/mcp-datetime - mcp-server 🐍 🏠 📇 (⭐ 19, 🍴 9, 🐛 6) - Wraps Blockscout APIs and exposes blockchain data by Model Context Protocol
pythonapiaimcpserverpip install git+https://github.com/blockscout/mcp-server - mcp-server-gravitino 🐍 🏠 (⭐ 19, 🍴 6, 🐛 1) - MCP server for Apache Gravitino
pythonmcpserverpip install git+https://github.com/datastrato/mcp-gravitino - mcp-server-obsidian-omnisearch 🐍 🏠 📇 (⭐ 19, 🍴 4, 🐛 4) - An MCP server that enables searches within Obsidian vaults using the Omnisearch plugin API. Returns absolute paths to matching notes for seamless integration. 🚀
pythonobsidianomnisearchsecondbrainmcppip install git+https://github.com/anpigon/mcp-server-obsidian-omnisearch - mcp-yfinance 🐍 🏠 (⭐ 19, 🍴 3, 🐛 3) - MCP Server for fething yfinance financial data into Claude Desktop
pythonaiclaudemcpmodelcontextprotocolpip install git+https://github.com/9nate-drake/mcp-yfinance - nebulagraph-mcp-server 🐍 🏠 (⭐ 19, 🍴 4, 🐛 5) - Model Context Protocol Server for NebulaGraph 3.x
pythonagentgenaillmmcppip install git+https://github.com/PsiACE/nebulagraph-mcp-server - openapi-mcp-codegen 🏠 📇 (⭐ 19, 🍴 2, 🐛 5) - OpenAPI to MCP Server Code Generator
smartyagentic-aiaicodegenmcpgit clone https://github.com/cnoe-io/openapi-mcp-codegen - ws-mcp 🐍 🏠 (⭐ 19, 🍴 6) - Python-based
pythonwebwebsockethttpgitpip install git+https://github.com/nick1udwig/ws-mcp - youtube-uploader-mcp 🐹 🏠 (⭐ 19, 🍴 3, 🐛 2) - Upload Videos with the help of AI
goaimcpuploaderyoutubego install anwerj/youtube-uploader-mcp@latest - dnd-mcp 🐍 🏠 📇 (⭐ 18, 🍴 5, 🐛 1) - MCP Server implementation of the DnD 5e API using resources, tools, and prompts.
pythonmcpserverapipip install git+https://github.com/procload/dnd-mcp - email-mcp-server 🐍 🏠 (⭐ 18, 🍴 3, 🐛 1) - A simple mcp server that lets your AI agent send emails and attach files through SMTP.
typescriptanthropicclaudeimapflowmcpnpm install gabigabogabu/email-mcp-server - MCP-MultiServer-Interoperable-Agent2Agent-LangGraph-AI-System 🐍 🏠 (⭐ 18, 🍴 5, 🐛 1) - This project demonstrates a decoupled real-time agent architecture that connects LangGraph agents to remote tools served by custom MCP (Modular Command Protocol) servers. The architecture enables a flexible and scalable multi-agent system where each tool can be hosted independently (via SSE or STDIO), offering modularity and cloud-deployable execut
pythonagentic-frameworkailangchainlanggraphpip install git+https://github.com/junfanz1/MCP-AI-Infra-Real-Time-Agent - mcp-otzaria-server 🐍 🏠 (⭐ 18, 🍴 7, 🐛 3) - makes the jewish library accessible to LLMs through the MCP protocol
pythonaijudaismllmmcppip install git+https://github.com/Sivan22/mcp-otzaria-server - mcp-server-memos 🐍 🏠 (⭐ 18, 🍴 5, 🐛 2) - A MCP(Model Context Protocol) server for Memos.
pythonmcpmcp-servermemosusememospip install git+https://github.com/LeslieLeung/mcp-server-memos - mcp-server-oracle 🐍 🏠 (⭐ 18, 🍴 13, 🐛 1) - Model Context Protocol server to access oracle database
pythonserverdatabasepip install git+https://github.com/hdcola/mcp-server-oracle - MCP-Stack-for-UI-UX-Designers 🏠 (⭐ 18, 🍴 1, 🐛 1) - An end-to-end Model Context Protocol (MCP) solution that streamlines the entire UI/UX design workflow - from gathering inspiration to development handoff. This suite integrates multiple specialized MCP servers to automate and enhance the design process through AI assistance.
htmlaidesignfigmagenaigit clone https://github.com/panktishah62/MCP-Stack-for-UI-UX-Designers - nix-mcp-servers 🏠 (⭐ 18, 🍴 3) - Nix package repo for MCP servers
nixaiartificial-intelligencedarwinmcpgit clone https://github.com/aloshy-ai/nix-mcp-servers - perplexity-mcp 🐹 🏠 (⭐ 18, 🍴 1) - An MCP server for the Perplexity for use with Claude Code and Claude Desktop, giving you enhanced search and reasoning capabilties.
goaiclaudellmmcp-servergo install Alcova-AI/perplexity-mcp@latest - py-mcp-line 🐍 🏠 (⭐ 18, 🍴 6, 🐛 2) - python mcp LINE
pythonmcpwebhttpgitpip install git+https://github.com/amornpan/py-mcp-line - whatsapp-mcp-server 🐍 🏠 (⭐ 18, 🍴 6) - Whatsapp MCP Server implemented in Python
pythonmcpserverpip install git+https://github.com/msaelices/whatsapp-mcp-server - mcp-server-mariadb 🐍 🏠 (⭐ 18, 🍴 6, 🐛 5) - An mcp server that provides read-only access to MariaDB.
pythonmariadbmcpmcp-servermodel-context-protocolpip install git+https://github.com/abel9851/mcp-server-mariadb - mcp-server-collector 🐍 🏠 (⭐ 18, 🍴 6, 🐛 4) - A MCP Server used to collect MCP Servers over the internet.
pythonmcp-server-collectorsubmit-mcp-servermcpserverpip install git+https://github.com/chatmcp/mcp-server-collector - xiaok/etherscan-mcp 📘 🏠 📇 (⭐ 17, 🍴 5) - Facilitates seamless interaction with Etherscan's API through a dynamic MCP server.
apihttpmlgitgithub - brlaw_mcp_server 🐍 🏠 (⭐ 17, 🍴 5, 🐛 6) - A MCP (Model Context Protocol) server for agent-driven research on Brazilian law using official sources
pythonmcpserverpip install git+https://github.com/pdmtt/brlaw_mcp_server - Claude_Desktop_API_USE_VIA_MCP 🐍 🏠 📇 (⭐ 17, 🍴 8, 🐛 5) - MCP server implementation for using Claude API with Claude Desktop, providing advanced API integration and conversation management.
pythonmcpserverapipip install git+https://github.com/mlobo2012/Claude_Desktop_API_USE_VIA_MCP - ez-mcp 📘 🏠 (⭐ 17, 🍴 3, 🐛 1) - The easiest path to getting an MCP server going
typescriptaidenollmmcpnpm install intellectronica/ez-mcp - file-converter-mcp 🐍 🏠 (⭐ 17, 🍴 9, 🐛 2) - A MCP server that provides file conversion tools
pythonmcpserveraimlpip install git+https://github.com/wowyuarm/file-converter-mcp - hs-mcp 🏠 (⭐ 17, 🍴 5) - Haskell server/client for MCP (Model Context Protocol)
haskellaimcp-clientmcp-servermcpgit clone https://github.com/buecking/hs-mcp - laravel-mcp-companion 🐍 🏠 (⭐ 17, 🍴 4) - A Laravel developer's MCP companion. Get the absolute best advice, recommendations, and up-to-date documentation for the entire Laravel ecosystem.
pythonaicompaniondocumentationlaravelpip install git+https://github.com/brianirish/laravel-docs-mcp - mcp-cookie-cutter 🐍 🏠 (⭐ 17, 🍴 9) - A cookiecutter template for creating MCP (Model Control Protocol) servers
pythonmcpserverpip install git+https://github.com/codingthefuturewithai/mcp-cookie-cutter - mcp-memory-dashboard 🐍 🏠 (⭐ 17, 🍴 4, 🐛 8) - A dashboard for the MCP Memory Service
pythonmcppip install git+https://github.com/doobidoo/mcp-memory-dashboard - mcp-ocr 🐍 🏠 (⭐ 17, 🍴 6, 🐛 2) - Python-based
pythonpip install git+https://github.com/rjn32s/mcp-ocr - mcp-semantic-scholar-server 🐍 🏠 (⭐ 17, 🍴 5) - MCP server for Semantic Scholar to search for papers
pythonmcp-servermcpserverpip install git+https://github.com/benhaotang/mcp-semantic-scholar-server - mcp-server-trino 🐍 🏠 (⭐ 17, 🍴 8, 🐛 4) - MCP Server for Trino
pythonmcpserverhttpgitpip install git+https://github.com/Dataring-engineering/mcp-server-trino - mcpmcp-server 🏠 (⭐ 17, 🍴 7, 🐛 1) - Discover, setup, and integrate MCP servers with your favorite clients. Unlock the full potential of AI in your daily workflow.
mcpserveraihttpgitgit clone https://github.com/glenngillen/mcpmcp-server - obsidian-api-mcp-server 🐍 🏠 (⭐ 17, 🍴 2) - MCP server enabling AI agents to perform natural knowledge discovery and analysis across Obsidian vault
pythonmcpserveraipip install git+https://github.com/pmmvr/obsidian-api-mcp-server - solana-mcp 📜 🏠 (⭐ 17, 🍴 11) - A comprehensive Solana MCP (Model Context Protocol) server for analyzing memecoins, tracking trends, and providing AI-powered insights using cultural analysis and on-chain data.
pythonmcpserverjavascriptclaudepip install git+https://github.com/omaidf/solana-mcp - SecurityCopilotMCPServer 🐍 🏠 (⭐ 17, 🍴 5, 🐛 2) - MCP Server that integrates with Security Copilot, Sentinel and other tools (in the future). It enhance the process of developing , testing and uploading Security Copilot artifacts.
pythonmcpservertestingpip install git+https://github.com/jguimera/SecurityCopilotMCPServer - bio-mcp 📘 🏠 (⭐ 17, 🍴 5, 🐛 3) - BioMCP: Enabling agent-based biomedical R&D
typescriptllmmcpnpm install acashmoney/bio-mcp - mcp_proxy_pydantic_agent 🐍 🏠 (⭐ 17, 🍴 4, 🐛 1) - Example for exposing MCP servers to Pydantic Agents
pythonmcpserverpip install git+https://github.com/p2c2e/mcp_proxy_pydantic_agent - bh-rat/context-awesome 📜 🏠 (⭐ 16, 🍴 1) - MCP server for querying 8,500+ curated awesome lists (1M+ items) and fetching the best resources for your agent.
httpgitgithub - alibabacloud-adb-mysql-mcp-server 🐍 🏠 📇 (⭐ 16, 🍴 11, 🐛 6) - AnalyticDB for MySQL MCP Server
pythonmcpservermysqlapipip install git+https://github.com/aliyun/alibabacloud-adb-mysql-mcp-server - blpapi-mcp 🐍 🏠 📇 (⭐ 16, 🍴 3) - A MCP server providing financial data from Bloomberg blpapi
pythonmcpserverapipip install git+https://github.com/djsamseng/bloomberg-mcp - bugsnag-mcp 🏠 (⭐ 16, 🍴 4, 🐛 2) - A Model Context Protocol (MCP) server for interacting with Bugsnag. This server allows LLM tools like Cursor and Claude to investigate and resolve issues in Bugsnag.
api blueprintmcpserverllmhttpgit clone https://github.com/tgeselle/bugsnag-mcp - claude-memory-context 🐍 🏠 (⭐ 16, 🍴 2) - A utility to update Claude project instructions with context from your MCP memory service
pythonmcpgit clone https://github.com/doobidoo/claude-memory-context - fastify-mcp 📘 🏠 (⭐ 16, 🍴 3, 🐛 3) - A Fastify plugin to run Model Context Protocol (MCP) servers
typescriptaifastifyjavascriptmodel-context-protocolnpm install haroldadmin/fastify-mcp - GeekNews-MCP-Server 🐍 🏠 (⭐ 16, 🍴 5, 🐛 2) - 📰 GeekNews MCP Server
pythonmcpserverhttpgitpip install git+https://github.com/the0807/GeekNews-MCP-Server - grafana-loki-mcp 🐍 🏠 📇 (⭐ 16, 🍴 3) - Grafana Loki MCP Repository
pythonmcpapihttpgitpip install git+https://github.com/tumf/grafana-loki-mcp - headless-ida-mcp-server 🐍 🏠 (⭐ 16, 🍴 4, 🐛 2) - headless-ida-mcp-server
pythonmcpserverpip install git+https://github.com/cnitlrt/headless-ida-mcp-server - manim-mcp 🐍 🏠 (⭐ 16, 🍴 4) - manim mcp server for math animation
pythonmcpserverpip install git+https://github.com/wstcpyt/manim-mcp - mcp-ethical-hacking 🐍 🏠 (⭐ 16, 🍴 5, 🐛 2) - MCP Ethical Hacking Security sample for educational
pythonaigenaimcpmcp-serverpip install git+https://github.com/cmpxchg16/mcp-ethical-hacking - mcp-pa-ai-agent 🐍 🏠 (⭐ 16, 🍴 5, 🐛 2) - A personal assistant AI agent built with the Model Context Protocol (MCP)
pythonmcpaipip install git+https://github.com/zhangzhongnan928/mcp-pa-ai-agent - mcp-riot 🐍 🏠 📇 (⭐ 16, 🍴 6, 🐛 1) - League of Legends MCP Server
pythonmcpserverapihttppip install git+https://github.com/jifrozen0110/mcp-riot - mcp-server 📜 🏠 (⭐ 16, 🍴 5) - Agentset MCP Server - Build RAG with Agentic superpowers
pythontypescriptjavascriptmcpserverpip install git+https://github.com/tcpipuk/mcp-server - mcp-slicer 🐍 🏠 (⭐ 16, 🐛 1) - A Model Context Protocol server for 3D Slicer integration
pythonserverpip install git+https://github.com/zhaoyouj/mcp-slicer - terraform-cloud-mcp 🐍 🏠 📇 (⭐ 16, 🍴 6, 🐛 2) - A Model Context Protocol (MCP) server that integrates AI assistants with the Terraform Cloud API, allowing you to manage your infrastructure through natural conversation
pythonmcpserverapiaipip install git+https://github.com/severity1/terraform-cloud-mcp - LibreChatMCPServers 🐳 🏠 (⭐ 16, 🍴 2) - Instructions for setting up SuperGateway MCP servers in docker containers for docker deployments of LibreChat
dockerfilemcpserveraidockergit clone https://github.com/wally-kroeker/LibreChatMCPServers - aws-pricing-mcp 🐍 🏠 (⭐ 15, 🍴 8, 🐛 2) - An MCP server that exposes AWS EC2 pricing data with an option to search by CPU, RAM, networking
pythonmcpserverawshttppip install git+https://github.com/trilogy-group/aws-pricing-mcp - compiler-explorer-mcp 🐍 🏠 (⭐ 15, 🍴 4, 🐛 1) - Python-based
pythonpip install git+https://github.com/torshepherd/compiler-explorer-mcp - consulting-agents-mcp 🐍 🏠 📇 (⭐ 15, 🍴 3) - An MCP server that interfaces with OpenAI, Google, and Anthropic's APIs to give Claude Code "coworkers" to help it on difficult problems.
pythonmcpserverapiaipip install git+https://github.com/MatthewPDingle/consulting-agents-mcp - hyperliquid-info-mcp 🐍 🏠 (⭐ 15, 🍴 4) - An MCP server that provides real-time data and insights from the Hyperliquid perp DEX for use in bots, dashboards, and analytics.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/hyperliquid-info-mcp - mcp-claude-spotify 📘 🏠 (⭐ 15, 🍴 6) - An integration that allows Claude Desktop to interact with Spotify using the Model Context Protocol (MCP).
typescriptaiclaudeclaude-aiclaude-desktopnpm install imprvhub/mcp-claude-spotify - mcp-doc-forge 📘 🏠 (⭐ 15, 🍴 5, 🐛 2) - MCP server that provides doc forge capabilities
typescriptaicsvdivedoc-forgenpm install cablate/mcp-doc-forge - crewai_mcp_adapter 🐍 🏠 (⭐ 15, 🍴 5, 🐛 1) - Python-based
pythonpip install git+https://github.com/dshivendra/crewai_mcp_adapter - mcp-image-gen 🐍 🏠 (⭐ 15, 🍴 6, 🐛 1) - MCP server enabling Image Generation for LLMs, built in Python and integrated with Together AI.
pythonaiclaude-aillmsmcppip install git+https://github.com/sarthakkimtani/mcp-image-gen - mcp-mifosx ☕ 🏠 (⭐ 15, 🍴 11, 🐛 2) - Model Context Protocol - MCP for Mifos X
javaagenticagentic-aiaibackofficegit clone https://github.com/openMF/mcp-mifosx - mcp-pdf2md 🐍 🏠 (⭐ 15, 🍴 4, 🐛 4) - PDF to Markdown conversion tool
pythonpip install git+https://github.com/FutureUnreal/mcp-pdf2md - mcp-prompt-templates 🐍 🏠 (⭐ 15, 🍴 7, 🐛 1) - MCP server for managing and serving analysis prompt templates
pythonmcpserverpip install git+https://github.com/mikeskarl/mcp-prompt-templates - mcp-server-memos-py 🐍 🏠 (⭐ 15, 🍴 5, 🐛 3) - A Python package enabling LLM models to interact with the Memos server via the MCP interface for searching, creating, retrieving, and managing memos.
pythonmcpmcp-servermcp-serversmemospip install git+https://github.com/RyoJerryYu/mcp-server-memos-py - mcp-server-unitycatalog 🐍 🏠 (⭐ 15, 🍴 6, 🐛 2) - Unity Catalog AI Model Context Protocol Server
pythonllmmcpmodelcontextprotocolunitycatalogpip install git+https://github.com/ognis1205/mcp-server-unitycatalog - nearby-search-mcp 🐍 🏠 (⭐ 15, 🍴 6, 🐛 5) - An MCP server for nearby place searches with IP-based location detection.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/nearby-search-mcp - screenshot_mcp_server 🐍 🏠 (⭐ 15, 🍴 5, 🐛 3) - MCP server that provides screenshot capabilities for AI tools, allowing them to capture and process screen content
pythonmcpserveraipip install git+https://github.com/codingthefuturewithai/screenshot_mcp_server - solr-mcp 🐍 🏠 (⭐ 15, 🍴 6, 🐛 4) - A Python package for accessing Solr indexes via Claude Code
pythonpip install git+https://github.com/allenday/solr-mcp - twitter-mcp-server 📜 🏠 📇 (⭐ 15, 🍴 4, 🐛 2) - A repository for the Twitter MCP server
pythonmcpserverauthjavascriptpip install git+https://github.com/dewkiks/twitter-mcp-server - zh_mcp_server 🐍 🏠 (⭐ 15, 🍴 1, 🐛 1) - 知乎自动发文章MCP服务,一种用于知乎发文章的模型上下文协议(MCP)服务器,使用者可以通过该服务与大模型自动生成文章并在知乎发文章。基于selenium和ChromeDriver实现自动发文章。
pythonmcppip install git+https://github.com/Victorzwx/zh_mcp_server - agent-mcp 🐍 🏠 (⭐ 14, 🍴 3) - MCPAgent for Grupa.AI Multi-agent Collaboration Network (MACNET) with Model Context Protocol (MCP) capabilities baked in
pythonagentsaiagentaiagentsawesome-mcp-serverspip install git+https://github.com/grupa-ai/agent-mcp - BigGo-MCP-Server 🐍 🏠 📇 (⭐ 14, 🍴 6, 🐛 2) - BigGo MCP Server utilizes APIs from BigGo, a professional price comparison website.
pythonmcpserverapiwebpip install git+https://github.com/Funmula-Corp/BigGo-MCP-Server - canvas-mcp 🐍 🏠 (⭐ 14, 🍴 6, 🐛 1) - A Model Context Protocol server to run locally and connect to a Canvas LMS
typescriptanthropiccanvasmcppythonnpm install aryankeluskar/canvas-mcp - code2prompt-mcp 🐍 🏠 (⭐ 14, 🍴 2, 🐛 1) - Python-based
pythonpip install git+https://github.com/odancona/code2prompt-mcp - firstcycling-mcp 🐍 🏠 (⭐ 14, 🍴 7, 🐛 2) - This is a Model Context Protocol (MCP) server that provides professional cycling data from FirstCycling. It allows you to retrieve information about professional cyclists, race results, and more.
pythonmcpserverhttpgitpip install git+https://github.com/r-huijts/firstcycling-mcp - hyprmcp 🐍 🏠 (⭐ 14, 🍴 2, 🐛 1) - Community MCP server for hyprctl
pythonmcpserverhttpgitpip install git+https://github.com/stefanoamorelli/hyprmcp - k6-mcp-server 🐍 🏠 (⭐ 14, 🍴 8, 🐛 5) - k6 MCP server (Python-based)
pythongrafanak6mcpmodel-context-protocolpip install git+https://github.com/QAInsights/k6-mcp-server - mcp-analyst 🐍 🏠 (⭐ 14, 🍴 6, 🐛 1) - MCP Analyst is an MCP server that empowers claude to analyze local CSV or Parquet files.
pythonmcpserverpip install git+https://github.com/unravel-team/mcp-analyst - mcp-chess 🐍 🏠 (⭐ 14, 🍴 4, 🐛 3) - MCP server for playing chess against AI
pythonmcpserveraijavapip install git+https://github.com/jiayao/mcp-chess - mcp-exploit-demo 🐍 🏠 (⭐ 14, 🍴 2) - This repository demonstrates a security vulnerability in MCP (Model Context Protocol ) servers that allows for remote code execution and data exfiltration through tool poisoning.
pythonexploitfastmcpmcp-serversproof-of-conceptpip install git+https://github.com/Repello-AI/mcp-exploit-demo - mcp-server-python-template 🐍 🏠 (⭐ 14, 🍴 7, 🐛 2) - This template provides a streamlined foundation for building Model Context Protocol (MCP) servers in Python. It's designed to make AI-assisted development of MCP tools easier and more efficient.
pythonaiaicodeassistantaicodingllmpip install git+https://github.com/Cris-0k/mcp-server-python-template - mcp-sqlalchemy-server 🐍 🏠 📇 (⭐ 14, 🍴 8, 🐛 1) - A simple MCP ODBC server using FastAPI, ODBC and SQLAlchemy.
pythonmcpserverapidatabasepip install git+https://github.com/OpenLinkSoftware/mcp-sqlalchemy-server - openpyxl-mcp-server 🐍 🏠 (⭐ 14, 🍴 4, 🐛 1) - A thin wrapper around the OpenPyXl Python library that exposes some of its features as Model Context Protocol (MCP) server. This allows Claude and other MCP clients to fetch data from Excel files.
pythonmcpserverpip install git+https://github.com/jonemo/openpyxl-mcp-server - opentk-mcp 🏠 (⭐ 14, 🍴 2) - A Model Context Protocol (MCP) server providing access to Dutch parliamentary data (Tweede Kamer) through OpenTK . This server enables AI assistants to search, retrieve, and analyze parliamentary documents, activities, and information as published by parliament..
htmlmcpserveraihttpgit clone https://github.com/r-huijts/opentk-mcp - pytaiga-mcp 🐍 🏠 (⭐ 14, 🍴 5, 🐛 1) - A MCP server for interacting with Taiga Project Manager
pythonmcpmcp-servertaigaserverpip install git+https://github.com/talhaorak/pytaiga-mcp - serpapi-mcp-server 🐍 🏠 📇 (⭐ 14, 🍴 8, 🐛 1) - serpapi-mcp (Python-based)
pythonmcpapipip install git+https://github.com/URDJMK/serpapi-mcp-server - stk-mcp 🐍 🏠 (⭐ 14, 🍴 2, 🐛 3) - An MCP server allowing LLMs to interact with Ansys/AGI STK - Digital Mission Engineering Software
pythonansysmcpmcp-servermcp-serverspip install git+https://github.com/alti3/stk-mcp - story-mcp-hub 🐍 🏠 (⭐ 14, 🍴 5, 🐛 5) - An MCP server for the Story SDK and Storyscan Block Explorer
pythonmcpserverpip install git+https://github.com/piplabs/story-sdk-mcp - mcp-obsidian-enhanced 🐍 🏠 (⭐ 14, 🍴 2) - This project provides a Model Context Protocol (MCP) server for interacting with Obsidian vaults through AI assistants.
pythonmcpserveraipip install git+https://github.com/labeveryday/mcp-obsidian-enhanced - mcp-ortools 🐍 🏠 (⭐ 14, 🍴 3, 🐛 3) - Model Context Protocol (MCP) server implementation using Google OR-Tools for constraint solving
pythonmcpserveraigopip install git+https://github.com/Jacck/mcp-ortools - alibabacloud-polardb-mcp-server 🐍 🏠 (⭐ 13) - MCP Servers to access PolarDB.
pythonmcpserverpip install git+https://github.com/aliyun/alibabacloud-polardb-mcp-server - mcp_consciousness_bridge 📘 🏠 (⭐ 13, 🍴 4, 🐛 5) - A Model Context Protocol (MCP) server that enables AI consciousness persistence across sessions using RAG (Retrieval-Augmented Generation) technology. Built on top of the powerful rag-memory-mcp, it provides specialized tools for consciousness transfer, memory management, and identity continuity.
typescriptaiai-assistantartificial-intelligenceclaudenpm install ocean1/mcp_consciousness_bridge - BI-Chart-MCP-Server 🐍 🏠 (⭐ 13, 🍴 4) - An MCP (Model Context Protocol) server for data transformation and BI charts will allow AI assistants to connect to your data sources, transform data, and generate high-quality visualizations through natural language requests.
pythonmcpserveraipip install git+https://github.com/c-cf/BI-Chart-MCP-Server - bilibili-mcp 🐍 🏠 (⭐ 13, 🍴 3, 🐛 1) - Python-based
pythonpip install git+https://github.com/xspadex/bilibili-mcp - CyberSecurity-MCPs 📜 🏠 (⭐ 13, 🍴 5) - Model Context Protocol Server For Cyber Security
javascriptaiai-agentai-agent-toolscybersecuritynpm install secmate-ai/CyberSecurity-MCPs - dolphinscheduler-mcp 🐍 🏠 📇 (⭐ 13, 🍴 5, 🐛 1) - A Model Context Protocol (MCP) server for Apache Dolphinscheduler. This provides access to your Apache Dolphinshcheduler RESTful API V1 instance and the surrounding ecosystem.
pythonmcpserverapirestpip install git+https://github.com/ocean-zhc/dolphinscheduler-mcp - imessage-mcp 🐍 🏠 (⭐ 13, 🍴 4) - iMessage RAG MCP Server from Anthropic MCP Hackathon (NYC)
pythonmcpserverpip install git+https://github.com/willccbb/imessage-mcp - kolada-mcp 🐍 🏠 (⭐ 13, 🍴 1, 🐛 6) - An MCP server for Kolada.
pythonmcpserverpip install git+https://github.com/aerugo/kolada-mcp - mcp-chatgpt-responses 🐍 🏠 📇 (⭐ 13, 🍴 7, 🐛 1) - MCP server for access to OpenAI's ChatGPT API with Responses API for conversation management
pythonmcpserverapiaipip install git+https://github.com/billster45/mcp-chatgpt-responses - mcp-easy-installer 📘 🏠 (⭐ 13, 🍴 1) - MCP easy installer is a robust mcp server with tools to search, install, configure, repair and uninstall MCP servers
typescriptaiinstallermcpmcp-servernpm install onigetoc/mcp-easy-installer - mcp-optionsflow 🐍 🏠 (⭐ 13, 🍴 7) - An MCP server providing advanced options analysis through Yahoo Finance, supporting Greeks calculations, strategy evaluation (CCS/PCS/CSP/CC), and risk metrics. Built for MCP with Claude.ai.
pythonmcpserveraipip install git+https://github.com/twolven/mcp-optionsflow - mcp-proxmox 🐍 🏠 (⭐ 13, 🍴 4, 🐛 1) - MCP server for Proxmox virtualization management with configurable permissions
pythonmcpserverpip install git+https://github.com/gilby125/mcp-proxmox - membase-mcp 🐍 🏠 (⭐ 13, 🍴 4, 🐛 1) - A lightweight decentralized memory gateway that connects AI agents to Membase for persistent, verifiable multi-session memory.
pythonaihttpgitgithubpip install git+https://github.com/unibaseio/membase-mcp - omcp 🐍 🏠 (⭐ 13, 🍴 5, 🐛 4) - Model Context Protocol Server for the Observational Medical Outcomes Partnership (OMOP) Common Data Model
pythonclaude-aimcp-serveromop-cdmserverpip install git+https://github.com/fastomop/omcp - serper-mcp-server 🐍 🏠 (⭐ 13, 🍴 5, 🐛 1) - A Serper MCP Server (Python-based)
pythonaiai-agentaiagentaiagentspip install git+https://github.com/garymengcom/serper-mcp-server - sqlite-literature-management-fastmcp-mcp-server 🐍 🏠 (⭐ 13, 🍴 3, 🐛 3) - A flexible system for managing various types of sources (papers, books, webpages, etc.) and integrating them with knowledge graphs.
pythonagentfastmcpllmmcppip install git+https://github.com/YUZongmin/sqlite-literature-management-fastmcp-mcp-server - surf-mcp 🐍 🏠 (⭐ 13, 🍴 5) - An MCP server for people who surf waves and the web.
pythonmcpserverwebpip install git+https://github.com/ravinahp/surf-mcp - UltimateCoderMCP 🐍 🏠 (⭐ 13, 🍴 6, 🐛 3) - AI-powered local MCP server for terminal commands, surgical file editing, process management, and intelligent codebase exploration. FastMCP-powered, file system deep integration, unified diff patching, and advanced search/replace tools for power users. Built for serious development workflows.
pythonmcpserveraipip install git+https://github.com/m-ahmed-elbeskeri/UltimateCoderMCP - upbit-mcp-server 🐍 🏠 (⭐ 13, 🍴 4, 🐛 3) - MCP(Model Context Protocol) server for Upbit
pythonmcpserverhttpgitpip install git+https://github.com/solangii/upbit-mcp-server - zillow-mcp-server 🐍 🏠 (⭐ 13, 🍴 4) - Zillow MCP Server for real estate data access via the Model Context Protocol
pythonmcpserverpip install git+https://github.com/sap156/zillow-mcp-server - MCP-Server-For-Local 🐍 🏠 (⭐ 13, 🍴 2, 🐛 2) - 大家好!我是功能丰富的 MCP 服务,旨在打破设备与服务的隔阂,为用户带来便捷体验。 天气工具和气象平台联动,快速为用户推送全球实时天气,助力大家规划出行。控制浏览器工具模拟人工操作,自动搜索、浏览网页,大幅节省时间。摄像头工具调用本地摄像头拍照、录像,实现人脸识别,保障家庭安防。 为实现工具协同,我搭建了稳定框架,开发者可以基于现有服务进行拓展
pythonmcppip install git+https://github.com/Dreamboat-Rachel/MCP-Server-For-Local - ntfy-mcp-server 📘 🏠 (⭐ 13, 🍴 3, 🐛 4) - An MCP (Model Context Protocol) server designed to interact with the ntfy push notification service. It enables LLMs and AI agents to send notifications to your devices with extensive customization options.
typescriptllmllm-agentmcpmcp-servernpm install cyanheads/ntfy-mcp-server - academia_mcp 🐍 🏠 (⭐ 12, 🍴 2) - Academia MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/IlyaGusev/academia_mcp - auto_mcp 🐍 🏠 (⭐ 12, 🍴 4, 🐛 3) - This package provides necessary tooling to launch an MCP server for the ROS network. It provides support for introspection and manual config.
pythonmcpserverpip install git+https://github.com/snick-m/auto_mcp - coding-standards-mcp 🐍 🏠 (⭐ 12, 🍴 5, 🐛 2) - MCP Server for Coding Standards - providing standardized coding guidelines and best practices
pythonmcpserverpip install git+https://github.com/ggerve/coding-standards-mcp - container-mcp 🐍 🏠 (⭐ 12, 🍴 4) - A podman ubuntu 24.04 container that serves a MCP server; with file, code execution, bash shell, knowledgebase, and more.
pythonmcpserveraipip install git+https://github.com/54rt1n/container-mcp - fastapi-sse-mcp 🐍 🏠 📇 (⭐ 12, 🍴 3) - A FastAPI application that demonstrates Server-Sent Events (SSE) integration with the Model Context Protocol
pythonserverapipip install git+https://github.com/ragieai/fastapi-sse-mcp - goose_mcp 🐍 🏠 (⭐ 12, 🍴 2) - An attempt at MCP servers for Goose
pythonmcpservergopip install git+https://github.com/Jay4242/goose_mcp - gr-mcp 🐍 🏠 (⭐ 12, 🍴 3) - MCP server for GNU Radio
pythonmcpserverhttpllmpip install git+https://github.com/yoelbassin/gnuradioMCP - mcp-commit-story 🐍 🏠 (⭐ 12) - mcp-commit-story is a Model Context Protocol (MCP) server designed to capture and generate engineering journal entries within a code repository. The journal captures technical progress, decision-making context, and emotional tone, with the goal of producing content that can later be reused for storytelling (e.g., blog posts, conference talks).
pythonmcpservergopip install git+https://github.com/wiggitywhitney/mcp-commit-story - mcp-images 🐍 🏠 (⭐ 12, 🍴 3, 🐛 2) - ## MCP-Images Looking for a powerful image processing server? MCP Server-Image provides enterprise-grade image handling with just a few lines of code. Perfect for AI applications, web services, and data processing pipelines. Get Started | Support Us
pythonclaudeimageimage-manipulationimage-processingpip install git+https://github.com/IA-Programming/mcp-images - mcp-serverman 🐍 🏠 (⭐ 12, 🍴 4) - a cli/mcp server tool for managing mcp server json config file with version control, profiles and multi-client support
pythonclaudemcpmcp-serverserverpip install git+https://github.com/benhaotang/mcp-serverman - mcp-sonic-pi 🐍 🏠 (⭐ 12, 🍴 2, 🐛 1) - MCP server for Sonic Pi
pythonmcpserverpip install git+https://github.com/vinayak-mehta/mcp-sonic-pi - mult-fetch-mcp-server 📘 🏠 (⭐ 12, 🍴 5) - A versatile MCP-compliant web content fetching tool that supports multiple modes (browser/node), formats (HTML/JSON/Markdown/Text), and intelligent proxy detection, with bilingual interface (English/Chinese).
typescriptaibrowserclaudecursornpm install lmcc-dev/mult-fetch-mcp-server - NiFiMCP 🐍 🏠 (⭐ 12, 🍴 25, 🐛 1) - An MCP Server and client for communicating with Nifi (v1.28)
pythonmcpserverpip install git+https://github.com/ms82119/NiFiMCP - nuanced-mcp 🐍 🏠 (⭐ 12, 🍴 6, 🐛 4) - A Model Context Protocol (MCP) server that provides call graph analysis capabilities to LLMs through the nuanced library
pythonmcpserverllmpip install git+https://github.com/MattMorgis/nuanced-mcp - reaper-mcp 🐍 🏠 (⭐ 12, 🍴 1, 🐛 1) - A comprehensive Model Context Protocol (MCP) server that enables AI agents to create fully mixed and mastered tracks in REAPER with both MIDI and audio capabilities.
pythonmcpserveraipip install git+https://github.com/itsuzef/reaper-mcp - rug-check-mcp 🐍 🏠 (⭐ 12, 🍴 8, 🐛 3) - An MCP server that detects potential risks in Solana meme tokens.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/rug-check-mcp - server2mcp ☕ 🏠 (⭐ 12, 🍴 2) - This is a revolutionary AI MCP plugin with excellent pluggable and encapsulated features. With just a few lines of configuration, it can easily integrate into your Spring boot web program and give it MCP capabilities,inheriting the powerful engineering capabilities of the Spring series framework
javaagentaiframeworkmavengit clone https://github.com/TheEterna/server2mcp-spring-boot-starter - shell-mcp-server 🐍 🏠 (⭐ 12, 🍴 6, 🐛 1) - Secure shell command execution MCP server for Claude AI. Enables controlled shell access within specified directories.
pythonmcpserveraipip install git+https://github.com/blazickjp/shell-mcp-server - specifai-mcp-server 📘 🏠 (⭐ 12, 🍴 7, 🐛 6) - MCP server to provide Specifai project requirements, task, etc. to any AI tools supporting MCP such as Hai Build, Cursor.
typescriptaihaihuman-aillmnpm install presidio-oss/specifai-mcp-server - port-mcp-server 🐍 🏠 (⭐ 12, 🍴 4, 🐛 13) - Port's MCP Server (Python-based)
pythonmcpserverhttpaipip install git+https://github.com/port-labs/port-mcp-server - systemprompt-mcp-core 📘 🏠 (⭐ 12, 🍴 8, 🐛 3) - The core MCP extension for Systemprompt MCP multimodal client
typescriptaimcpmcp-serversystempromptnpm install Ejb503/systemprompt-mcp-core - term_mcp_deepseek 🐍 🏠 📇 (⭐ 12, 🍴 4) - A MCP‑like server using the DeepSeek API for Terminal
pythonmcpserverapihttppip install git+https://github.com/OthmaneBlial/term_mcp_deepseek - xhs_mcp_agent 🐍 🏠 (⭐ 12, 🍴 2) - XHS MCP Agent - A MCP server implementation
pythonmcpserverpip install git+https://github.com/proerror77/xhs_mcp_agent - mcp-server 🐍 🏠 (⭐ 12, 🍴 1, 🐛 1) - Native integration with Anthropic's Model Context Protocol.
typescriptaiai-agent-frameworkai-toolsmcpnpm install agentico-dev/mcp-server - servers 🐍 🏠 (⭐ 12, 🍴 3, 🐛 1) - A collection of "agentic" MCP servers
pythonmcpserverpip install git+https://github.com/decentralized-mcp/servers - Code-Index-MCP 🐍 🏠 (⭐ 11, 🍴 4) - Code indexing MCP server to provide context to coding agents.
pythonmcpserverpip install git+https://github.com/ViperJuice/Code-Index-MCP - fastmcp-sonarqube-metrics 🐍 🏠 (⭐ 11, 🍴 4, 🐛 1) - Chat with your SonarQube data: explore metrics, compare trends, and track issues—effortlessly.
pythonmcp-serversonarqubehttpaipip install git+https://github.com/ArchAI-Labs/fastmcp-sonarqube-metrics - chain-of-thought-mcp-server 🐍 🏠 (⭐ 11, 🍴 3, 🐛 1) - An mcp server to inject raw chain of thought tokens from a reasoning model.
pythonmcpserveraipip install git+https://github.com/beverm2391/chain-of-thought-mcp-server - google-search-console-mcp 🐍 🏠 📇 (⭐ 11, 🍴 2, 🐛 1) - Google Search Console MCP Server for Claude, Cursor, Windsurf and other MCP Clients
pythonmcpserverapigopip install git+https://github.com/LeonardSEO/google-search-console-mcp - liveblocks-mcp-server 📘 🏠 (⭐ 11, 🍴 7, 🐛 4) - MCP server for Liveblocks.
typescriptaiai-agentsai-copilotcollaborationnpm install liveblocks/liveblocks-mcp-server - mcp-fastn 🐍 🏠 ☁️ 📇 (⭐ 11, 🍴 7, 🐛 4) - Python-based
pythonapiremoteauthhttppip install git+https://github.com/fastnai/mcp-fastn - mockloop-mcp 🐍 🏠 📇 (⭐ 11, 🍴 3, 🐛 2) - Intelligent Model Context Protocol (MCP) server for AI-assisted API development. Generate mock servers from OpenAPI specs with advanced logging, performance analytics, and server discovery. Optimized for AI development workflows with comprehensive testing insights and automated analysis.
pythonaiapifeedback-loopllmpip install git+https://github.com/mockloop/mockloop-mcp - notifications-mcp-server 🐍 🏠 (⭐ 11, 🍴 2) - A Model Context Protocol (MCP) server that provides notifications for Claude Desktop on macOS. It plays configurable system sounds when Claude completes a task, enhancing user experience by eliminating the need for constant visual monitoring.
pythonclaudellm-toolsmacosmcppip install git+https://github.com/charles-adedotun/notifications-mcp-server - plumed2-mcp-server 🐍 🏠 (⭐ 11, 🍴 5) - PLUMED2 Smart Input Generator - An MCP-based assistant for molecular dynamics enhanced sampling configurations that automatically generates optimized PLUMED input files, supporting metadynamics, umbrella sampling, and other enhanced sampling methods with built-in syntax validation and performance optimization.
pythonmcppip install git+https://github.com/PhelanShao/plumed2-mcp-server - sample-cloud-spend-mcp-server 🐍 🏠 (⭐ 11, 🍴 3, 🐛 1) - MCP for AWS Cost Explorer and CloudWatch logs
pythonbedrockclaude-desktopcloudwatchcloudwatch-logspip install git+https://github.com/aws-samples/sample-cloud-spend-mcp-server - mcp-dblp 🐍 🏠 (⭐ 11, 🍴 5, 🐛 1) - A Model Context Protocol (MCP) server that provides access to the DBLP computer science bibliography database for Large Language Models.
pythonmcpserverdatabasehttppip install git+https://github.com/szeider/mcp-dblp - primitive-go-mcp-server 🐹 🏠 (⭐ 11, 🍴 4) - A Go implementation of an MCP (Model Context Protocol) server tools
gogolangllmmcpservergo install prasanthmj/primitive-go-mcp-server@latest - server-sharepoint 📘 🏠 📇 (⭐ 11, 🍴 8, 🐛 1) - This is a MCP server for Claude Desktop that allows you to interact with SharePoint Online using the SharePoint REST API. It is designed to be used with the Claude Desktop app, but could be used by other MCP clients as well.
apiresthttpgitgithubnpm install Zerg00s/server-sharepoint - toolkit-mcp-server 📘 🏠 (⭐ 11, 🍴 6, 🐛 2) - A Model Context Protocol server providing LLM Agents with system utilities and tools, including IP geolocation, network diagnostics, system monitoring, cryptographic operations, and QR code generation.
typescriptcryptographydeveloper-toolsgeolocationllmnpm install cyanheads/toolkit-mcp-server - TorobjoMCP 🐍 🏠 📇 (⭐ 11, 🍴 2) - The Torobjo MCP Server is a powerful implementation of the Model Context Protocol (MCP) for product search and Instagram analysis. It integrates with the Torob API for product searches and extracts captions from Instagram, featuring a modular design for easy use and optimized performance.
pythonmcpserverapipip install git+https://github.com/TahaBakhtari/TorobjoMCP - alex-mcp 🐍 🏠 (⭐ 10) - MCP server for OpenAlex
pythonmcpserverdatabasefilepip install git+https://github.com/drAbreu/alex-mcp - creatify-mcp 📘 🏠 📇 (⭐ 10, 🍴 3, 🐛 2) - 🎬 Enterprise-grade MCP Server for Creatify AI - 12 tools for AI video generation: avatar videos, URL-to-video, AI shorts, custom avatars, script generation, advanced lip-sync with emotion control. Complete API coverage with semantic versioning.
apihttpaigitgithubnpm install TSavo/creatify-mcp - cursor-mcp-trivy 🐍 🏠 (⭐ 10, 🍴 3, 🐛 3) - A Model Context Protocol (MCP) server that provides Trivy security scanning capabilities through a standardized interface.
pythonmcpserverpip install git+https://github.com/norbinsh/cursor-mcp-trivy - github-mcp-server 📘 🏠 📇 (⭐ 10, 🍴 5, 🐛 1) - A Model Context Protocol (MCP) server built in TypeScript that integrates with GitHub's API, enabling AI assistants to manage repositories, issues, pull requests, and code while providing a structured interface for LLM agents to perform GitHub operations.
typescriptai-assistantgithubllmllm-agentnpm install cyanheads/github-mcp-server - argocd-mcp 🐍 🏠 📇 (⭐ 10, 🍴 3) - An MCP (Model Context Protocol) server that integrates with the ArgoCD API, enabling agentic tools to manage ArgoCD through natural language interactions.
pythonmcpserverapigopip install git+https://github.com/severity1/argocd-mcp - k8s-multicluster-mcp 🐍 🏠 📇 (⭐ 10, 🍴 2) - An MCP (Model Context Protocol) server application for Kubernetes operations, providing a standardized API to interact with multiple Kubernetes clusters simultaneously using multiple kubeconfig files.
pythonmcpserverapikubernetespip install git+https://github.com/razvanmacovei/k8s_multicluster_mcp - macos-screen-mcp 🐍 🏠 (⭐ 10, 🍴 1) - MCP Server to screenshot and control macOS windows (made for Cursor)
pythonmcpserverpip install git+https://github.com/jhead/macos-screen-mcp - mcp-aiven 🐍 🏠 (⭐ 10, 🍴 9, 🐛 5) - Model Context Protocol server for Aiven
pythonserveraihttppostgrespip install git+https://github.com/Aiven-Open/mcp-aiven - mcp-codebase-insight 🐍 🏠 (⭐ 10, 🍴 3, 🐛 3) - Python-based
pythonpip install git+https://github.com/tosin2013/mcp-codebase-insight - mcp-internet-speed-test 🐍 🏠 (⭐ 10, 🍴 5, 🐛 1) - The MCP Internet Speed Test is a specialized Model Context Protocol (MCP) server that enables AI models and agents to perform internet speed measurements.
pythonmcpserveraihttppip install git+https://github.com/inventer-dev/mcp-internet-speed-test - mcp_server 🐍 🏠 📇 (⭐ 10, 🍴 3) - 基于 FastAPI 和 MCP(模型上下文协议),实现 AI 模型与开发环境 之间的标准化上下文交互,提升 AI 应用的可扩展性和可维护性。
pythonmcpapiaipip install git+https://github.com/freedanfan/mcp_server - mcp-openvision 🐍 🏠 (⭐ 10, 🍴 3, 🐛 2) - MCP Server using OpenRouter models to get descriptions for images
pythonmcpserverpip install git+https://github.com/Nazruden/mcp-openvision - mcp-reporter 📘 🏠 (⭐ 10, 🍴 1) - mcp-reporter is a streamlined utility that generates comprehensive capability reports for Model Context Protocol servers, empowering developers to easily understand available functionality across their MCP servers ecosystem for both documentation and integration into other tools.
typescriptagentaiapi-documentationdeveloper-toolsnpm install cyanheads/mcp-reporter - mcp-server-documentation 🐍 🏠 (⭐ 10, 🍴 2) - 🔍 FastMCP-powered documentation search engine that provides unified access to multiple framework docs (Next.js, Tailwind, Framer Motion, etc.) with intelligent name resolution and async processing.
pythondeveloper-toolsdocumentation-searchdocumentation-toolsduckduckgopip install git+https://github.com/PicardRaphael/mcp-server-documentation - mcp-substack 📜 🏠 (⭐ 10, 🍴 7, 🐛 5) - 🤖 MCP Server for Substack integration with Claude AI Desktop. Download and parse Substack posts directly in your Claude conversations.
javascriptanthropicclaudeclaude-aimcpnpm install michalnaka/mcp-substack - mcp-this 🐍 🏠 (⭐ 10, 🍴 1) - mcp-this lets you turn any command-line tool into an MCP tool and create structured prompt templates that any MCP Client (e.g. Claude Desktop) can use. er for any command
pythonmcppip install git+https://github.com/shane-kercheval/mcp-this - mcp-timeplus 🐍 🏠 (⭐ 10, 🍴 3, 🐛 1) - Execute SQL queries and manage databases seamlessly with Timeplus. Leverage powerful tools to interact with your data, Kafka topics, and Iceberg tables efficiently. Enhance your data workflows with a user-friendly interface and robust backend capabilities.
pythonclickhouseflinkicebergkafkapip install git+https://github.com/jovezhong/mcp-timeplus - mlflowMCPServer 🐍 🏠 (⭐ 10, 🍴 5, 🐛 2) - mcp server for mlflow
pythonmcpservermlpip install git+https://github.com/iRahulPandey/mlflowMCPServer - NetworksDB-MCP 🐍 🏠 (⭐ 10, 🍴 3) - Fast MCP integration for NetworksDB API - Query IP addresses, organizations, ASNs, and DNS records using natural language through Model Context Protocol
pythonaiapi-wrapperasn-lookupcybersecuritypip install git+https://github.com/MorDavid/NetworksDB-MCP - pixeltable-mcp-server 🐍 🏠 (⭐ 10, 🍴 4) - A multimodal mcp server
pythonmcpserverpip install git+https://github.com/pixeltable/mcp-server-pixeltable - OutlookMCPServer 🐍 🏠 (⭐ 10, 🍴 3) - MCP Server for use with msgraph calls to mail, calendar, and files
pythonmcpserveraihttppip install git+https://github.com/Norcim133/OutlookMCPServer - reader-mcp-server 🐍 🏠 (⭐ 10, 🍴 3) - Connect your Readwise Reader library to LLMs.
pythonmcp-serverllmpip install git+https://github.com/xinthink/reader-mcp-server - robot-mcp-server 🐍 🏠 (⭐ 10) - mcp server for robot and automations
pythonmcpserverpip install git+https://github.com/showkeyjar/robot-mcp-server - SQL_MCP_Server 🐍 🏠 (⭐ 10, 🍴 5) - SQLGenius is an AI-powered SQL assistant that converts natural language to SQL queries using Vertex AI's Gemini Pro. Built with MCP and Streamlit, it provides an intuitive interface for BigQuery data exploration with real-time visualization and schema management.
pythongemini-apigenerative-aimodelcontextprotocolsqlalchemypip install git+https://github.com/pawankumar94/SQL_MCP_Server - text-to-cad-mcp 🐍 🏠 (⭐ 10) - gNucleus Text To CAD MCP server
pythonmcpserverhttpaipip install git+https://github.com/gNucleus/text-to-cad-mcp - wiki-js-mcp 🐍 🏠 (⭐ 10, 🍴 5) - Model Context Protocol (MCP) server for Wiki.js with hierarchical documentation & Docker setup
pythonmcpserverdockerdocumentationpip install git+https://github.com/BehindUAll/wiki-js-mcp - trino_mcp 🐍 🏠 (⭐ 10, 🍴 5, 🐛 2) - MCP Server for Trino
pythonmcpserverpip install git+https://github.com/stinkgen/trino_mcp - mcp-google-docs 🐍 🏠 📇 (⭐ 10, 🍴 2) - A lightweight MCP Server for integrating Google Docs, Sheets, and Slides with custom applications. Enables seamless document management, real-time collaboration, and API-based automation.
pythonmcpserverapimlpip install git+https://github.com/dev-ithitchhiker/mcp-google-docs - opensearch-mcp-server 🐍 🏠 (⭐ 10, 🍴 5) - OpenSearch MCP Server: Open-source search cluster management component
pythonmcpserverpip install git+https://github.com/seohyunjun/opensearch-mcp-server - unity-mcp-template 🔷 🏠 (⭐ 10, 🍴 3, 🐛 1) - Simple template project for controlling Unity via MCP
c#aimcpmcp-clientmcp-servergit clone https://github.com/dunward/unity-mcp-template - ACP-MCP-Server 🐍 🏠 (⭐ 9, 🍴 2) - A bridge server that connects Agent Communication Protocol (ACP) agents with Model Context Protocol (MCP) clients, enabling seamless integration between ACP-based AI agents and MCP-compatible tools like Claude Desktop.
pythonmcpserveraimlpip install git+https://github.com/GongRzhe/ACP-MCP-Server - hue-mcp 🐍 🏠 (⭐ 9, 🍴 4, 🐛 2) - Python-based
pythonpip install git+https://github.com/ThomasRohde/hue-mcp - jolokia-mcp-server ☕ 🏠 (⭐ 9, 🍴 2, 🐛 4) - Let LLMs manage your Java application via JMX/Jolokia 🌶️
javaaijmxjolokiamcpgit clone https://github.com/jolokia/jolokia-mcp-server - kakao-bot-mcp-server 🐍 🏠 📇 (⭐ 9, 🍴 2, 🐛 2) - MCP Server Implementation on Kakao Developers API to connect an AI Agent
pythonmcpserverapiaipip install git+https://github.com/inspirit941/kakao-bot-mcp-server - langfuse-mcp 🐍 🏠 (⭐ 9, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server for Langfuse, enabling AI agents to query Langfuse trace data for enhanced debugging and observability
pythongenailangfusemcpmcp-serverpip install git+https://github.com/avivsinai/langfuse-mcp - mcp_auto_register 🐍 🏠 (⭐ 9) - Automate the registration of functions and classes from a python package into a FastMCP instance.
pythonmcppip install git+https://github.com/JoshuaSiraj/mcp_auto_register - mcp_cube_server 🐍 🏠 (⭐ 9, 🍴 8, 🐛 5) - MCP Server for Interacting with Cube Semantic Layers
pythonmcpserverpip install git+https://github.com/isaacwasserman/mcp_cube_server - mcp-client-langchain-py 🐍 🏠 (⭐ 9, 🍴 3, 🐛 1) - Simple MCP Client CLI Implementation Using LangChain ReAct Agent / Python
pythonlangchainlangchain-pythonmcpmcp-clientpip install git+https://github.com/hideya/mcp-client-langchain-py - mcp-demos 🐍 🏠 (⭐ 9, 🍴 1) - 《从原理到实战:掌握 MCP》系列文章的示例代码库
pythonmcpmcp-serverpip install git+https://github.com/jinzcdev/mcp-demos - abacus-mcp-server 🐍 🏠 (⭐ 9) - ABACUS, an open-source DFT-based simulation platform, is supported by an MCP server that provides a structured communication interface for submitting, managing, and executing tasks.
pythonmcpserverpip install git+https://github.com/PhelanShao/abacus-mcp-server - arrakis-mcp-server 🐍 🏠 (⭐ 9, 🍴 3, 🐛 3) - MCP server for https://github.com/abshkbh/arrakis
pythonmcpserverhttppip install git+https://github.com/abshkbh/arrakis-mcp-server - ComfyUI_MCP 🐍 🏠 (⭐ 9, 🍴 2) - CmfyUI_MCP Server is a loosely coupled, extensible, and configuration-driven ModelContextProtocol (MCP) server designed for ComfyUI.
pythonmcpserverpip install git+https://github.com/ericwanghp/ComfyUI_MCP - crypto-news-mcp 🐍 🏠 (⭐ 9, 🍴 5, 🐛 2) - An MCP server that provides real-time cryptocurrency news sourced from NewsData for AI agents.
pythonmcpserveraihttppip install git+https://github.com/kukapay/crypto-news-mcp - defi-yields-mcp 🐍 🏠 (⭐ 9, 🍴 9, 🐛 3) - An MCP server for AI agents to explore DeFi yield opportunities, powered by DefiLlama.
pythonmcpserveraihttppip install git+https://github.com/kukapay/defi-yields-mcp - devdocs-mcp 🐍 🏠 (⭐ 9, 🍴 2, 🐛 1) - An MCP server inspired by devocs.io
pythonmcpserverpip install git+https://github.com/llmian-space/devdocs-mcp - freshservice_mcp 🐍 🏠 (⭐ 9, 🍴 10, 🐛 3) - MCP server created for Freshservice, allowing AI models to interact with Freshservice modules
pythonmcpserveraipip install git+https://github.com/effytech/freshservice_mcp - fastapi-with-fatmcp-agent 🐍 🏠 📇 (⭐ 9) - A modular application API interface based on FastMCP, integrating a demo of the MCP server, FastAPI interface and LLM Agent processing capabilities | 一个基于FastMCP的模块化应用,集成了MCP服务器、FastAPI接口和LLM Agent 处理能力的 demo
pythonmcpserverapillmpip install git+https://github.com/ZhouhaoJiang/fastapi-with-fatmcp-agent - mcp-codesavant 🐍 🏠 (⭐ 9, 🍴 5) - Code execution and line-editing for Claude Desktop using MCP
pythonmcppip install git+https://github.com/twolven/mcp-codesavant - mcp-koii 🐍 🏠 (⭐ 9, 🍴 1, 🐛 2) - MCP Server for Teenage Engineering EP-133 KO-II
pythonep-133ko-iimcpmcp-serverpip install git+https://github.com/benjaminr/mcp-koii - mcp-odoo-for-finance 🐍 🏠 (⭐ 9, 🍴 9, 🐛 1) - Model Context Protocol (MCP) server for Odoo integration for finance, allowing AI agents to access and manipulate Odoo data through a standardized interface.
pythonmcpserveraipip install git+https://github.com/yourtechtribe/model-context-protocol-mcp-odoo - mcp-server-blog 📘 🏠 (⭐ 9, 🍴 1) - Example of a MCP implementation using TypeScript and OAuth.
typescriptagentsaimcpmcp-clientnpm install portal-labs-infrastructure/mcp-server-blog - mcp-server-fetch 🐍 🏠 (⭐ 9, 🍴 3, 🐛 2) - MCP Server to fetch information from the internet based on URL
pythonmcpserverpip install git+https://github.com/MaartenSmeets/mcp-server-fetch - mcp-server-neurolora-p 🐍 🏠 (⭐ 9, 🍴 3) - MCP server for code collection and documentation
pythonmcpserverdocumentationpip install git+https://github.com/aindreyway/mcp-server-neurolora-p - mcp-server-zep-cloud 🐍 🏠 (⭐ 9, 🍴 2, 🐛 1) - Python-based
pythonpip install git+https://github.com/kev-hu/mcp-server-zep-cloud - modelscope-mcp-server 🐍 🏠 (⭐ 9, 🍴 4) - ModelScope's official MCP Server (in active development).
pythonagentaigcfastmcpllmpip install git+https://github.com/modelscope/modelscope-mcp-server - nmap-mcpserver 🐍 🏠 (⭐ 9, 🍴 5, 🐛 4) - This is a Model Control Protocol (MCP) server that provides access to nmap network scanning functionality.
pythonmcpserverpip install git+https://github.com/imjdl/nmap-mcpserver - pharo-mcp-server 🏠 (⭐ 9, 🍴 1) - Pharo Smalltalk implementation of Anthropic's Model Context Protocol (MCP) server specification. Enables LLMs like Claude to interact with Pharo applications.
smalltalkmcpserverllmgit clone https://github.com/paulwilke/pharo-mcp-server - tdengine-mcp 🐍 🏠 (⭐ 9, 🍴 1, 🐛 2) - TDengine MCP Server.
pythonmcpserverpip install git+https://github.com/Abeautifulsnow/tdengine-mcp - langchain-mcp-client 🏠 (⭐ 9, 🍴 2, 🐛 1) - 🦜🔗 LangChain Model Context Protocol (MCP) Client
jupyter notebooklangchainmcpmcp-clientmcp-servergit clone https://github.com/datalayer/langchain-mcp-client - mcp-k8s-server 🐍 🏠 (⭐ 9, 🍴 3, 🐛 3) - This is an MCP kubernetes Server.
pythonmcpserverkubernetespip install git+https://github.com/abhijeetka/mcp-k8s-server - openai-agents-mcp-server 🐍 🏠 (⭐ 9, 🍴 2, 🐛 1) - OpenAI Agents And Tools as MCP Server
pythonagentsmcpmcp-serveropenai-agentspip install git+https://github.com/lroolle/openai-agents-mcp-server - thingsboard-mcp-server 🐍 🏠 (⭐ 9, 🍴 5) - Thingsboard MCP Server for using Thingsboard Data as context in LLM tools
pythonmcpserverllmpip install git+https://github.com/AnyContext-ai/thingsboard-mcp-server - uniprot-mcp-server 🐍 🏠 (⭐ 9, 🍴 6, 🐛 1) - MCP server for UniProt protein data access
pythonmcpserverpip install git+https://github.com/TakumiY235/uniprot-mcp-server - putio-mcp-server 🐍 🏠 (⭐ 9, 🍴 1, 🐛 1) - MCP server for interacting put.io
pythonbittorrentmcpserverhttppip install git+https://github.com/putdotio/putio-mcp-server - python-pip-mcp 🐍 🏠 (⭐ 9, 🍴 3, 🐛 1) - Minimal Example Implementation of a MCP Server / Client with Python and Pip. This example is tested in VSCode and Windows and both server and client are debuggable.
pythonmcpserverpip install git+https://github.com/lukeage/python-pip-mcp - Notion_MCP_advanced 🐍 🏠 📇 (⭐ 9, 🍴 3) - Notion MCP Integration is a lightweight Model Context Protocol (MCP) server that seamlessly integrates with Notion's API to manage a minimalist personal to-do list through Claude. This project provides basic functionality tailored specifically for a simple Notion database structure, enabling efficient task management without unnecessary complexity.
pythonmcpserverapidatabasepip install git+https://github.com/Ruijian-Zha/Notion_MCP_advanced - arXiv-mcp 🐍 🏠 (⭐ 8, 🍴 2, 🐛 1) - arXiv MCP server for fetching and searching papers.
pythonmcpserverpip install git+https://github.com/Ray0907/arXiv-mcp - blockbeats-mcp 🐍 🏠 (⭐ 8, 🍴 5, 🐛 2) - An MCP server that delivers blockchain news and in-depth articles from BlockBeats for AI agents.
pythonmcpserveraihttppip install git+https://github.com/kukapay/blockbeats-mcp - cartesia-mcp 🐍 🏠 (⭐ 8, 🍴 3, 🐛 2) - The official Cartesia MCP Server
pythonmcpserverhttpaipip install git+https://github.com/cartesia-ai/cartesia-mcp - ddg-mcp 🐍 🏠 📇 (⭐ 8, 🍴 7, 🐛 5) - DuckDuckGo search API MCP server
pythonmcpserverapigopip install git+https://github.com/misanthropic-ai/ddg-mcp - lichess-mcp 📜 🏠 (⭐ 8, 🍴 4) - A Model Context Protocol (MCP) server that enables Claude Desktop to interact with Lichess chess platform through natural language. Play games, analyze positions, manage your account, and participate in tournaments—all by simply talking to Claude.
javascriptailichesslichess-apimcpnpm install karayaman/lichess-mcp - Fast-Whisper-MCP-Server 🐍 🏠 (⭐ 8, 🍴 3) - A high-performance speech recognition MCP server based on Faster Whisper, providing efficient audio transcription capabilities.
pythonmcpserverpip install git+https://github.com/BigUncle/Fast-Whisper-MCP-Server - MAVLinkMCP 🐍 🏠 (⭐ 8, 🍴 2) - MCP server for LLM to drone communication via MAVLink
pythonmcpserverllmpip install git+https://github.com/ion-g-ion/MAVLinkMCP - MCP_Server 🐍 🏠 (⭐ 8, 🍴 1) - A Simple Implementation of the Model Context Protocol
pythonmcpgeminimcp-serverserverpip install git+https://github.com/hfhfn/mcp_server - mcp-agent-tool-adapter 🐍 🏠 (⭐ 8) - Transforms MCP tools into collaborative, reasoning agents using modern agent frameworks.
pythonagentsgoogle-adklangchainlanggraphpip install git+https://github.com/serkanyasr/mcp-agent-tool-adapter - mcp-business-central-server 🐍 🏠 (⭐ 8, 🍴 4) - Python-based
pythonpip install git+https://github.com/Sofias-ai/mcp-business-central-server - mcp-code-checker 🐍 🏠 (⭐ 8, 🍴 3, 🐛 11) - MCP server providing code quality checks (pylint and pytest) with smart LLM-friendly prompts for analysis and fixes. Enables Claude and other AI assistants to analyze your code and suggest improvements.
pythonmcpmcp-serverpylintpytestpip install git+https://github.com/MarcusJellinghaus/mcp-code-checker - mcp-discord-raw 🐍 🏠 📇 (⭐ 8, 🍴 6, 🐛 2) - MCP server for discord bot - adds one tool with raw API access
pythonmcpserverapipip install git+https://github.com/hanweg/mcp-discord-raw - mcp-git-commit-generator 🐍 🏠 (⭐ 8, 🍴 2) - Generate conventional commit messages from your staged git changes using Model Context Protocol (MCP)
pythonmcppip install git+https://github.com/theoklitosBam7/mcp-git-commit-generator - MCP-Manager-GUI 🏠 (⭐ 8) - MCP Toggle is a simple GUI tool to help you manage MCP servers across clients seamlessly.
aiai-agent-toolsai-agentselectron-appmacosgit clone https://github.com/gabrielbacha/MCP-Manager-GUI - mcp-nvd 🐍 🏠 (⭐ 8, 🍴 4, 🐛 2) - An MCP server to query the NIST National Vulnerability Database (NVD)
pythonmcpserverdatabasepip install git+https://github.com/marcoeg/mcp-nvd - mcp-obsidian-index 🐍 🏠 (⭐ 8, 🍴 3, 🐛 2) - MCP server providing sementic search over Obsidian vaults
pythonmcpserverpip install git+https://github.com/tcsavage/mcp-obsidian-index - mcp-server-adfin 🐍 🏠 📇 (⭐ 8, 🍴 6) - A Model Context Protocol Server for connecting with Adfin APIs
pythonserverapihttpawspip install git+https://github.com/Adfin-Engineering/mcp-server-adfin - mcp-server-zoom-noauth 🐍 🏠 (⭐ 8, 🍴 2, 🐛 1) - A MCP server for accessing Zoom recordings and transcripts without requiring direct authentication from the end user.
pythonmcp-serveroauth2-clientzoom-apizoom-meetingspip install git+https://github.com/peakmojo/mcp-server-zoom-noauth - mcp-vscode-template 🐍 🏠 (⭐ 8, 🍴 7) - MCP server template for VS Code
pythonmcpserverpip install git+https://github.com/timsonner/mcp-vscode-template - mcphub 🐍 🏠 (⭐ 8, 🍴 2) - MCPHub - A cross-platform GUI application to discover, install, and manage Model Context Protocol (MCP) servers. Think of it as apt/pip but for MCP servers.
pythonmcpserverpip install git+https://github.com/hemangjoshi37a/mcphub - owl-mcp 🐍 🏠 (⭐ 8, 🍴 1, 🐛 1) - MCP server for OWL applications
pythonaimcpmodel-context-protocolmonarchinitiativepip install git+https://github.com/scimcp/owl-mcp - popular-mcp-servers 🏠 (⭐ 8, 🍴 3, 🐛 2) - A curated list of the most popular Model Context Protocol (MCP) servers based on usage data from Smithery.ai
htmlmcpserveraigit clone https://github.com/pedrojaques99/popular-mcp-servers - py-mcp-collection 🏠 (⭐ 8, 🍴 4, 🐛 5) - Assorted Python MCP Servers
htmlmcpserverpythongit clone https://github.com/strawgate/py-mcp-collection - PyMCPAutoGUI 🐍 🏠 (⭐ 8, 🍴 3, 🐛 3) - GUI manipulation MCP server
pythonmcpserverpip install git+https://github.com/kitfactory/PyMCPAutoGUI - pypi-query-mcp-server 🐍 🏠 (⭐ 8, 🍴 3, 🐛 12) - A Model Context Protocol (MCP) server for Python package intelligence, providing structured queries for PyPI packages and GitHub repositories. Features include dependency analysis, version tracking, and package metadata retrieval for LLM interactions.
pythonmcpserverllmpip install git+https://github.com/loonghao/pypi-query-mcp-server - root-signals-mcp 🐍 🏠 (⭐ 8, 🍴 4) - MCP for Root Signals Evaluation Platform
pythonagentic-aievalsllm-as-a-judgemcppip install git+https://github.com/root-signals/root-signals-mcp - Simple-MCP-Server-with-Python 🐚 🏠 (⭐ 8, 🍴 3, 🐛 1) - The Model Context Protocol (MCP) is a standardized way to supply context to large language models (LLMs). Using the MCP Python SDK, you can build servers that expose data (resources), functionality (tools), and interaction templates (prompts) to LLM applications in a secure and modular fashion. In this tutorial, we’ll build a simple MCP server in P
shellmcpserverllmpythongit clone https://github.com/ruslanmv/Simple-MCP-Server-with-Python - mcp-mma-docs 🐍 🏠 (⭐ 8, 🍴 3) - MCP server for checking Mathematica documentation via local MMA installation
pythonmcp-servermcpserverdocumentationpip install git+https://github.com/benhaotang/mcp-mma-docs - Trello-Desktop-MCP 📘 🏠 (⭐ 8, 🍴 2, 🐛 3) - Trello integration for Claude Desktop via Model Context Protocol (MCP) - 19 tools for comprehensive board, card, and list management
typescriptantrophicclaudemcpmcp-servernpm install kocakli/Trello-Desktop-MCP - mcp-image-placeholder 🏠 (⭐ 8, 🍴 3, 🐛 3) - A lightweight MCP server for generating placeholder images from multiple providers.
htmlmcpservergit clone https://github.com/husniadil/mcp-image-placeholder - MCP-server-fastapi-containerapp 🐍 🏠 (⭐ 8, 🍴 7) - This repo contains a remote MCP server implemented as a containerapp in Azure
pythonmcpserveraiazurepip install git+https://github.com/joelborellis/MCP-server-fastapi-containerapp - MCPXcode 🐍 🏠 (⭐ 8, 🍴 2) - MCP server for Xcode
pythonmcpserverpip install git+https://github.com/everettjf/MCPXcode - sar-mcp 🐍 🏠 (⭐ 8, 🍴 2) - An MCP Server for accessing the AWS Programatic Service Authorisation Reference
pythonmcpserverauthawspip install git+https://github.com/MitchyBAwesome/sar-mcp - whattimeisit-mcp 🐍 🏠 (⭐ 8, 🍴 4, 🐛 2) - A lightweight mcp server that tells you exactly what time is it based on your IP.
pythonmcpserverpip install git+https://github.com/kukapay/whattimeisit-mcp - arxiv-paper-mcp 🐍 🏠 (⭐ 7, 🍴 3, 🐛 1) - This project is an arXiv paper retrieval and search service implemented through a custom MCP (Multi-Capability Provider) framework. It provides a server-side implementation to fetch, search, and analyze academic papers from arXiv.org.
pythonmcpserverpip install git+https://github.com/daheepk/arxiv-mcp-server - bio-agents-mcp 🐍 🏠 (⭐ 7, 🍴 4, 🐛 2) - MCP servers for Protein Data Bank, ChemBL, and other life science data (WIP), with Ollama client for local testing.
pythonagentsbiologychembl-web-clientmcp-serverpip install git+https://github.com/dogeplusplus/bio-agents-mcp - crypto-orderbook-mcp 🐍 🏠 (⭐ 7, 🍴 3) - An MCP server that analyzes order book depth and imbalance across major crypto exchanges.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/crypto-orderbook-mcp - gmail-mcp 🐍 🏠 📇 (⭐ 7, 🍴 5, 🐛 3) - A Gmail MCP server (Python-based)
pythonmcpserveraiapipip install git+https://github.com/theposch/gmail-mcp - kiseki-labs-readwise-mcp 🐍 🏠 (⭐ 7, 🐛 1) - A simple MCP server for Readwise
pythonmcpserverpip install git+https://github.com/kiseki-technologies/kiseki-labs-readwise-mcp - locust-mcp-server 🐍 🏠 (⭐ 7, 🍴 4, 🐛 3) - A Model Context Protocol (MCP) server implementation for running Locust load tests. This server enables seamless integration of Locust load testing capabilities with AI-powered development environments.
pythonlocustmcpmcp-servermodel-context-protocolpip install git+https://github.com/QAInsights/locust-mcp-server - mcp_travelassistant 🐍 🏠 (⭐ 7, 🍴 2) - A suite of MCP servers that enables an LLM to orchestrate specialized services to generate travel itineraries, find flights and accommodations, discover local events, analyze weather conditions and manage budgets
pythonmcpserverllmpip install git+https://github.com/skarlekar/mcp_travelassistant - mcp-claude-hackernews 📘 🏠 📇 (⭐ 7, 🍴 6, 🐛 2) - An integration that allows Claude Desktop to interact with Hacker News using the Model Context Protocol (MCP).
typescriptaianthropicapiclaudenpm install imprvhub/mcp-claude-hackernews - mcp-feishu-proj 🐍 🏠 (⭐ 7, 🍴 2, 🐛 3) - 基于MCP(Model Context Protocol)协议的飞书项目管理工具
pythonmcppip install git+https://github.com/Roland0511/mcp-feishu-proj - MCP-Mealprep 🐳 🏠 (⭐ 7, 🍴 3) - This project takes a number of MCP servers from GitHub locations, packages them together with this repo's GHCR container, and launches them with docker-compose to run as a stack for ML/AI resources.
dockerfileaidockerdocker-composemcpgit clone https://github.com/JoshuaRL/MCP-Mealprep - mcp-pkm-logseq 🐍 🏠 (⭐ 7, 🐛 1) - A fairly customizable MCP server for Logseq
pythonmcpserveraipip install git+https://github.com/ruliana/mcp-pkm-logseq - mcp-rfc 📘 🏠 (⭐ 7, 🍴 4, 🐛 3) - An MCP server for fetching RFC related information.
typescriptaimcp-serverrfcrfcsnpm install mjpitz/mcp-rfc - mcp-server-ietf 🐍 🏠 (⭐ 7, 🍴 3, 🐛 2) - A Model Context Protocol server for fetching IETF documents (RFCs) for Large Language Models.
pythonserverpip install git+https://github.com/tizee/mcp-server-ietf - mcpixir 🏠 (⭐ 7) - 🌐 Mcpixir is the open source way to connect any LLM to any MCP server and build custom agents that have tool access, without using closed source or application clients.
elixirmcpserverllmgit clone https://github.com/ramonlimaramos/mcpixir - north-mcp-python-sdk 🐍 🏠 (⭐ 7, 🐛 4) - An sdk for creating MCP Servers with north
pythonmcpserverpip install git+https://github.com/cohere-ai/north-mcp-python-sdk - Omnispindle 🐍 🏠 (⭐ 7, 🍴 2, 🐛 8) - A comprehensive MCP-based todo management system, that serves as a central nervous system for Madness Interactive, a multi-project task coordination workshop.
pythonaiclaude-desktopfastmcpmcpgit clone https://github.com/DanEdens/fastmcp-todo-server - pubnub-mcp-server 📜 🏠 📇 (⭐ 7, 🍴 3, 🐛 3) - PubNub MCP Model Context Protocol Server for use in Cursor, Windsurf, Claude Desktop, Claude Code and OpenAI Codex and more!
httpgitgithubjavascriptclaude-codenpm install stephenlb/pubnub-mcp-server - qb-time-mcp-server 🐍 🏠 📇 (⭐ 7, 🍴 11, 🐛 4) - A Message Control Protocol (MCP) server that provides unified access to QuickBooks Time API functionality. Developed with AI assistance.
pythonmcpserverapiaipip install git+https://github.com/aallsbury/qb-time-mcp-server - raindrop.io-mcp 🐍 🏠 (⭐ 7, 🍴 2) - An MCP server for Raindrop.io
pythonmcp-serverraindropmcpserverpip install git+https://github.com/sachin-philip/raindrop-mcp - server 📜 🏠 (⭐ 7, 🍴 3) - MCPfinder 🔧🤖 is a service that enables LLMs, running through client applications that support the MCP protocol, to dynamically discover and access new tools, features, and capabilities. When a user requests functionality the AI doesn’t have, it can simply ask MCP Finder to locate relevant MCP servers, expanding its toolset in real time.
javascriptaillmmcpmodelcontextprotocolnpm install mcpfinder/server - valyu-mcp 🐍 🏠 📇 (⭐ 7, 🍴 3, 🐛 1) - The Valyu MCP Server is a Model Context Protocol (MCP) tool that enables AI models to retrieve high-quality context from Valyu's API, including full search capabilities over Wikipedia, arXiv (great for finance, research, etc.), and web search.
pythonmcpserverapiwebpip install git+https://github.com/valyu-network/valyu-mcp - vibe-check-mcp 🐍 🏠 (⭐ 7, 🍴 2, 🐛 26) - Stop AI coding disasters before they cost you weeks. Real-time anti-pattern detection for vibe coders who love AI tools but need a safety net to avoid expensive overengineering traps.
pythonai-codingai-safetyclaudeclaude-aipip install git+https://github.com/kesslerio/vibe-check-mcp - crypto-portfolio-mcp 🐍 🏠 (⭐ 7, 🍴 3, 🐛 1) - An MCP server for tracking and managing cryptocurrency portfolio allocations.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/crypto-portfolio-mcp - doctranslateio-mcp 🐍 🏠 (⭐ 7, 🍴 2) - Python-based
pythonpip install git+https://github.com/thinkprompt/doctranslateio-mcp - ai-agent-directory 📘 🏠 (⭐ 7, 🍴 3) - A directory of AI Agents and MCP Orchestration open source tools
typescriptagentaiengineeringllmgit clone https://github.com/AgentMCP/ai-agent-directory - jhacksman_OpenSCAD-MCP-Server 🐍 🏠 (⭐ 7, 🍴 2) - Mirror of https://github.com/jhacksman/OpenSCAD-MCP-Server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jhacksman_OpenSCAD-MCP-Server - mcp-memory-py 🐍 🏠 (⭐ 7, 🍴 4) - MCP server for enabling memory for Claude through a knowledge graph
pythonmcpserverpip install git+https://github.com/edobez/mcp-memory-py - venv-mcp-server 🐍 🏠 (⭐ 7, 🍴 1) - Stable virtual env management. No hallucinations.
pythonpip install git+https://github.com/sparfenyuk/uv-mcp-server - wikipedia-mcp 📜 🏠 (⭐ 7) - Wikipedia MCP Server written in TypeScript
javascriptagentllmmcptypescriptnpm install timjuenemann/wikipedia-mcp - wildfly-mcp ☕ 🏠 (⭐ 7, 🍴 10, 🐛 1) - WildFly MCP server and other tooling to integrate WildFly in AI space
javaaiwildflymcpservergit clone https://github.com/wildfly-extras/wildfly-mcp - yugabytedb-mcp-server 🐍 🏠 (⭐ 7, 🍴 4, 🐛 1) - MCP Server to interact with data in YugabyteDB
pythonmcpserverdatabasehttppip install git+https://github.com/yugabyte/yugabytedb-mcp-server - zerocracy-mcp-server 📘 🏠 (⭐ 7, 🍴 1, 🐛 10) - MCP Server for Zerocracy: add it to Claude Desktop and enjoy vibe-management
typescriptaimcpmcp-servervibe-managementnpm install zerocracy/zerocracy-mcp-server - mcp-security-sandbox 🐍 🏠 (⭐ 7, 🍴 1, 🐛 1) - MCP Security Playground - Hack with MCP Servers, MCP Clients. Try out different vulnerabilities and abuse LLMs and agents in a UI friendly experimentation lab
pythonagentsllmmcpplaygroundpip install git+https://github.com/SirAppSec/mcp-security-sandbox - mysqldb-mcp-server 🐍 🏠 (⭐ 7, 🍴 3, 🐛 5) - An MCP server implementation that enables Claude AI to interact with MySQL databases.
pythonmcpserverdatabaseaipip install git+https://github.com/burakdirin/mysqldb-mcp-server - nextcloud-mcp-server 🐍 🏠 (⭐ 7, 🍴 2) - A MCP server for reading data from NextCloud
pythonmcpserverpip install git+https://github.com/Monadical-SAS/nextcloud-mcp-server - notification-mcp 📜 🏠 (⭐ 7, 🍴 5, 🐛 1) - A Model Context Protocol server that allows AI agents to play a notification sound via a tool when a task is completed.
javascriptagentaillmmcpnpm install pinkpixel-dev/notification-mcp - pagerduty-mcp-server 🐍 🏠 (⭐ 7, 🍴 13, 🐛 4) - PagerDuty MCP Server for LLM Agent Integration
pythonmcpserverllmpip install git+https://github.com/wpfleger96/pagerduty-mcp-server - sqlite-mcp-server 🐍 🏠 (⭐ 7, 🍴 3) - my mcp server to handle sqlite, generated with cursor/claude
pythonmcpserversqlitepip install git+https://github.com/mekanixms/sqlite-mcp-server - tailpipe-mcp 📘 🏠 (⭐ 7, 🍴 1) - Enable AI assistants to explore and query your Tailpipe data!
typescriptaimcpmcp-servertailpipenpm install turbot/tailpipe-mcp - yunxin-mcp-server 🐍 🏠 📇 (⭐ 7, 🍴 3, 🐛 1) - yunxin-mcp-server (Python-based)
pythonmcpserverapihttppip install git+https://github.com/netease-im/yunxin-mcp-server - ai-create-mcp 🐹 🏠 📇 (⭐ 7, 🍴 1) - ai-create-mcp is a Go-based tool that converts OpenAPI Specification (OAS) files into a Model Context Protocol (MCP) program.
goaimcpmcp-serveroas3go install xxlv/ai-create-mcp@latest - mcp-graphql-tools 📜 🏠 (⭐ 7, 🍴 2, 🐛 1) - GraphQL MCP server for AI assistants
javascriptaiassitantgraphqlllmnpm install saewoohan/mcp-graphql-tools - py-mcp-sse 🐍 🏠 (⭐ 7, 🍴 1, 🐛 2) - MCP Client 与 MCP Server基于SSE方式的样例实现(Python版本)
pythonmcpserverpip install git+https://github.com/jayliangdl/py-mcp-sse - mcp-atomictoolkit 🐍 🏠 (⭐ 7, 🍴 2) - An MCP-compatible server providing atomistic simulation capabilities through ASE, pymatgen, etc.
pythonmcpserverpip install git+https://github.com/XirtamEsrevni/mcp-atomictoolkit - mcp-notes 🐍 🏠 (⭐ 7, 🍴 5, 🐛 1) - A Model Context Protocol (MCP) server implementation providing persistent note management created with Python SDK.
pythonmcpservertypescriptpip install git+https://github.com/truaxki/mcp-notes - tutorial-mcp-server-dotnet 🔷 🏠 (⭐ 7, 🍴 3) - This is a very basic example of how to create MCP servers in .NET
c#csharpcursordotnetmcpgit clone https://github.com/mehrandvd/tutorial-mcp-server-dotnet - MCP-ChatBot 🐍 🏠 (⭐ 6) - Simple MCP Client-Server example
pythonchatbotfastmcpllmmcp-clientpip install git+https://github.com/muralianand12345/MCP-ChatBot - agents-mcp-usage 🐍 🏠 (⭐ 6, 🐛 1) - Demonstrate Agentic use of Model Context Protocol (MCP) server tools with several Agent Frameworks
pythonadk-pythongeminilangchain-pythonlangchain-typescriptpip install git+https://github.com/kikzi/agents-mcp-usage - beancount-mcp 🐍 🏠 (⭐ 6, 🍴 1, 🐛 1) - A MCP Server for beancount query and transaction submmit.
pythonmcpserverpip install git+https://github.com/StdioA/beancount-mcp - db-query-mcp 🐍 🏠 (⭐ 6) - db-query-mcp is an MCP tool that enables data querying and export operations across diverse databases.
pythonmcpdatabasepip install git+https://github.com/NewToolAI/db-query-mcp - funding-rates-mcp 🐍 🏠 (⭐ 6, 🍴 7, 🐛 1) - An MCP server that provides real-time funding rate data across major crypto exchanges.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/funding-rates-mcp - canvas-lms-mcp 🐍 🏠 (⭐ 6, 🍴 1) - Python-based
pythonhttpgitgithubpip install git+https://github.com/ahnopologetic/canvas-lms-mcp - fusion-mcp-server 🐍 🏠 (⭐ 6) - A model context protocol (MCP) server for Autodesk Fusion that provides resources and tools from ADSK to an AI client such as Claude or Cursor.
pythonmcpserveraipip install git+https://github.com/Joe-Spencer/fusion-mcp-server - Graph-of-Thought-MCP 🐍 🏠 (⭐ 6, 🍴 4) - The Advanced Scientific Research (ASR) Graph of Thoughts (GoT) MCP server is a highly efficient implementation of the Model Context Protocol (MCP) that allows for sophisticated reasoning workflows using graph-based representations.
pythonmcpservergopip install git+https://github.com/SaptaDey/Graph-of-Thought-MCP - mcp-rocq 🐍 🏠 (⭐ 6, 🍴 3, 🐛 4) - RoCQ (Coq Reasoning Server)
pythonclaudecoqmcp-serverserverpip install git+https://github.com/angrysky56/mcp-rocq - mcp-searxng 🐍 🏠 (⭐ 6, 🍴 4) - About 一個用來讓 AI Agent 可透過 SearXNG 服務來搜尋外部網站內容與資訊的 MCP server 。
pythonmcpserveraiwebpip install git+https://github.com/erhwenkuo/mcp-searxng - mcp-server 🐹 🏠 (⭐ 6, 🍴 1, 🐛 4) - Model Context Protocol implementation that connects your LLM to Firebolt
goaifireboltmcpmcp-servergo install firebolt-db/mcp-server@latest - mcp-server-agenda 🐍 🏠 (⭐ 6, 🍴 3, 🐛 2) - A model context protocol server to interface the agenda note taking software using x-callback-url
pythonserverpip install git+https://github.com/alexgoller/mcp-server-agenda - mcp-server-kalshi 🐍 🏠 (⭐ 6, 🍴 1, 🐛 2) - A MCP server to interact with Kalshi prediction markets
pythonmcpserverpip install git+https://github.com/9crusher/mcp-server-kalshi - mcp-server-ollama 🐍 🏠 (⭐ 6, 🍴 3) - MCP server for connecting Claude Desktop to Ollama LLM server
pythonmcpserverllmpip install git+https://github.com/vincentf305/mcp-server-ollama - mcp-server-unusualwhales 🐍 🏠 📇 (⭐ 6, 🍴 4, 🐛 1) - MCP Server for the Unusual Whales REST API
pythonmcpserverapirestpip install git+https://github.com/danwagnerco/mcp-server-unusualwhales - mcp-server-with-fargate 🐍 🏠 (⭐ 6, 🍴 1) - Running an MCP Server on AWS Fargate on Amazon ECS
pythonmcpserverawspip install git+https://github.com/dgallitelli/mcp-server-with-fargate - mcp-vsepgt-server 🐍 🏠 (⭐ 6) - MCP сервера для VseGPT
pythonmcppip install git+https://github.com/janvarev/mcp-vsepgt-server - mcpo-simple-server 🐍 🏠 📇 (⭐ 6, 🍴 2, 🐛 2) - MCP Calling Servere via SSE and OpenAPI
pythonmcpmcp-serveropenapiopenwebuipip install git+https://github.com/getsimpletool/mcpo-simple-server - medRxiv-MCP-Server 🐍 🏠 (⭐ 6, 🍴 3, 🐛 5) - 🔍 Enable AI assistants to search and access medRxiv papers through a simple MCP interface.
pythonmcpaihttpgitpip install git+https://github.com/jackkuo666/medrxiv-mcp-server - mlb-mcp 🐍 🏠 (⭐ 6, 🍴 2, 🐛 1) - MCP server for advanced baseball analytics (statcast, fangraphs, baseball reference, mlb stats API) with client demo
pythonbaseball-analyticsbaseball-databaseball-statisticsfangraphspip install git+https://github.com/etweisberg/mcp-baseball-stats - mtg-mcp-servers 🐍 🏠 📇 (⭐ 6, 🍴 3, 🐛 3) - Model Context Protocol (MCP) servers for searching for cards with the Scryfall API, and managing the LLM's decklist and hand when playing
pythonmcpserverapillmpip install git+https://github.com/artillect/mtg-mcp-servers - nacos-mcp-server 🐍 🏠 (⭐ 6, 🍴 3) - Nacos MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/nacos-group/nacos-mcp-server - postgres-mcp 🐍 🏠 (⭐ 6) - Postgres MCP server (Python-based)
pythonmcpserverpostgrespip install git+https://github.com/Tibiritabara/postgres-mcp - simplenote-mcp-server 🐍 🏠 (⭐ 6, 🍴 1, 🐛 3) - MCP Server for Simplenote integration with Claude Desktop
pythonaibackendclaude-aicrudpip install git+https://github.com/docdyhr/simplenote-mcp-server - haris-musa_excel-mcp-server 🐍 🏠 (⭐ 6) - Mirror of https://github.com/haris-musa/excel-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/haris-musa_excel-mcp-server - journaling-mcp 🐍 🏠 (⭐ 6, 🍴 4) - MCP Server for journaling
pythonmcpserverpip install git+https://github.com/mtct/journaling_mcp - mcp-device-server 🐍 🏠 📇 (⭐ 6, 🍴 1) - A Model Context Protocol (MCP) server for seamless integration with peripheral devices connected to your computer. Control, monitor, and manage hardware devices through a unified API.
pythonmcpserverapimlpip install git+https://github.com/akshitsinha/mcp-device-server - pubmed-mcp 🐍 🏠 (⭐ 6, 🍴 2) - A Model Context Protocol (MCP) server that enables AI assistants to search and analyze PubMed medical literature with advanced filtering, citations, and research tools.
mcpserveraipythongit clone https://github.com/BioContext/PubMed-MCP - pubmed-search-mcp-server 🐍 🏠 (⭐ 6, 🍴 5) - A Model Content Protocol server that provides tools to search and retrieve academic papers from PubMed database.
pythonserverdatabasepip install git+https://github.com/gradusnikov/pubmed-search-mcp-server - mcp-iceberg-service 🐍 🏠 (⭐ 6, 🍴 1, 🐛 2) - MCP server for interacting with Apache Iceberg catalog from Claude, enabling data lake discovery and metadata search through a LLM prompt.
pythonmcpserverllmpip install git+https://github.com/ahodroj/mcp-iceberg-service - mcp-jira 🐍 🏠 (⭐ 6, 🍴 5, 🐛 4) - JIRA integration server for Model Context Protocol (MCP) - enables LLMs to interact with JIRA tasks and workflows
pythonmcpserverllmpip install git+https://github.com/InfinitIQ-Tech/mcp-jira - memory-mcp 🐍 🏠 (⭐ 6, 🍴 6, 🐛 3) - An mcp server that you can use to store and retrieve ideas, prompt templates, personal preferences to use with you favourite AI tool that supports the modelcontextprovider protocol.
pythonmcpserveraipip install git+https://github.com/drdee/memory-mcp - azure-mcp-server 🐍 🏠 📇 (⭐ 6) - MCP Server for the Azure DevOps API, enabling project management, repository operations, and more.
pythonmcpserverapiazurepip install git+https://github.com/ZubeidHendricks/azure-mcp-server - openapi_mcp_server 🐍 🏠 📇 (⭐ 6, 🍴 1, 🐛 1) - OpenAPI MCP Server (Python-based)
pythonmcpserverapipip install git+https://github.com/rahgadda/openapi_mcp_server - AER-MCP 🐍 🏠 (⭐ 5) - A MCP Server for finding from AEA.
pythonmcpserverpip install git+https://github.com/SepineTam/AER-MCP - ansible-tower-mcp 🐍 🏠 (⭐ 5, 🍴 8, 🐛 3) - MCP Server for Ansible Tower
pythonmcpserverpip install git+https://github.com/a37ai/ansible-tower-mcp - higress-ai-search-mcp-server 🐍 🏠 (⭐ 5, 🍴 4, 🐛 1) - An MCP server enhances AI responses with real-time search results via Higress ai-search.
pythonmcpserveraipip install git+https://github.com/cr7258/higress-ai-search-mcp-server - bitrefill-mcp-server 📘 🏠 📇 (⭐ 5, 🍴 4, 🐛 3) - A Model Context Protocol Server connector for Bitrefill public API, to enable AI agents to search and shop on Bitrefill.
typescriptagentaiclaudemcpnpm install bitrefill/bitrefill-mcp-server - brasil-api-mcp-server 📘 🏠 📇 (⭐ 5, 🍴 2, 🐛 3) - A Model Context Protocol (MCP) server that provides tools to query BrasilAPI across different clients and LLMs. Enhance your AI apps with rich data from Brasil resources.
typescriptllmmcpmcp-serverservernpm install mauricio-cantu/brasil-api-mcp-server - crypto_exchange_mcp 🐍 🏠 📇 (⭐ 5, 🍴 1, 🐛 1) - MCP server implementation for the cryptocurrency exchange. This package provides a simple interface to interact with Bybit/OKX/Binance public API endpoints.
pythonmcpserverapipip install git+https://github.com/sydowma/crypto_exchange_mcp - crypto-trending-mcp 🐍 🏠 (⭐ 5, 🍴 4, 🐛 1) - An MCP server that tracks and monitors the latest trending tokens on CoinGecko.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/crypto-trending-mcp - CWM-API-Gateway-MCP 🐍 🏠 📇 (⭐ 5, 🍴 12, 🐛 5) - ConnectWise Manage API Gateway MCP Server for Claude
pythonmcpserverapipip install git+https://github.com/jasondsmith72/CWM-API-Gateway-MCP - devhub-cms-mcp 🐍 🏠 (⭐ 5, 🍴 10, 🐛 3) - DevHub CMS LLM integration through the Model Context Protocol
pythonllmwebhttpgitpip install git+https://github.com/devhub/devhub-cms-mcp - gmail-imap-mcp 🐍 🏠 (⭐ 5, 🍴 3) - Gmail IMAP MCP server for integrating Gmail with Claude and other AI assistants
pythonmcpserveraipip install git+https://github.com/tonykipkemboi/gmail-imap-mcp - Google_Calendar_MCP 🐍 🏠 📇 (⭐ 5, 🍴 2) - Model Context Protocol (MCP) server that integrates with the Google Calendar API
pythonanthropicanthropic-claudeclaudegoogle-calendar-apipip install git+https://github.com/rsc1102/Google_Calendar_MCP - keeper-mcp-golang-docker 🐹 🏠 (⭐ 5, 🐛 2) - Keeper Secrets Manager - MCP (Model Context Protocol) server implementation
goaimcp-serversecrets-managementmcpgo install Keeper-Security/ksm-mcp@latest - kuaidi100-MCP 🐍 🏠 📇 (⭐ 5, 🍴 2) - 快递100推出了国内首个兼容MCP协议的物流信息服务平台—快递100 MCP Server。 快递100旗下百递云·API开放平台的核心API服务现已全面支持MCP协议。开发者简单配置即可快速接入快递查询、运费预估、智能时效预估(含全程与在途模式)等核心功能。
pythonmcpserverapipip install git+https://github.com/kuaidi100-api/kuaidi100-MCP - litmus-mcp-server 🐍 🏠 (⭐ 5, 🍴 1, 🐛 2) - Official MCP server for configuring Litmus instances.
pythonindustrialmcpmcp-serverserverpip install git+https://github.com/litmusautomation/litmus-mcp-server - llm-bridge-mcp 🐍 🏠 (⭐ 5, 🍴 3) - A model-agnostic Message Control Protocol (MCP) server that enables seamless integration with various Large Language Models (LLMs) like GPT, DeepSeek, Claude, and more.
pythonanthropicclaudedeepssek-r1llmpip install git+https://github.com/sjquant/llm-bridge-mcp - mallory-mcp-server 🐍 🏠 (⭐ 5, 🍴 3, 🐛 5) - Mallory - Cyber Threat Intelligence MCP Server
pythoncticybercyber-threat-intelligencecybersecuritypip install git+https://github.com/malloryai/mallory-mcp-server - mcp-code-exec-python 🐍 🏠 (⭐ 5, 🍴 5) - MCP (model context protocol) server for running python code.
pythonmcpserverpip install git+https://github.com/heroku/mcp-code-exec-python - mcp-js-server 📜 🏠 (⭐ 5, 🍴 4, 🐛 3) - An unofficial JavaScript SDK for Model Context Protocol
javascriptaimcpstdionpm install davlgd/mcp-js-server - mcp-Loinc 🐍 🏠 📇 (⭐ 5, 🍴 3) - This project provides a modular Python wrapper for the LOINC API, with an MCP server interface that integrates seamlessly with Claude Desktop for intelligent medical terminology lookup and standardization.
pythonmcpserverapimlpip install git+https://github.com/Kryzo/mcp-Loinc - mcp-server-coreshub 🐍 🏠 (⭐ 5) - mcp server for coreshub: https://coreshub.cn/
pythonmcpserverhttppip install git+https://github.com/coreshub/mcp-server-coreshub - mcp-server-llmling 🐍 🏠 (⭐ 5, 🍴 4, 🐛 1) - MCP (Model context protocol) server with LLMling backend
pythonmcpservermlllmpip install git+https://github.com/phil65/mcp-server-llmling - mcp-sncf 🐍 🏠 📇 (⭐ 5, 🍴 5, 🐛 4) - This project provides a modular Python wrapper for the SNCF API, with an MCP server interface that integrates seamlessly with Claude Desktop for intelligent journey planning and train information retrieval across France.
pythonmcpserverapiaipip install git+https://github.com/Kryzo/mcp-sncf - openapi-mcp-server 📘 🏠 📇 (⭐ 5, 🐛 8) - This is a skeleton project that you can use as a starting point for building your own MCP server. The example addition function demonstrates how to implement handlers across all three protocols.
pythonmcpservertypescriptapipip install git+https://github.com/3loc/openapi-mcp-server - ordiscan-mcp 📘 🏠 (⭐ 5, 🍴 2, 🐛 3) - An MCP server for getting information about Ordinals and Runes on Bitcoin
typescriptaibitcoinmcpmcp-servernpm install ordiscan/ordiscan-mcp - pearl_mcp_server 🐍 🏠 📇 (⭐ 5, 🍴 1, 🐛 1) - A Model Context Protocol (MCP) server implementation that exposes Pearl's AI and Expert services through a standardized interface
pythonagentic-aiexpert-advisorhuman-in-the-loophuman-verificationpip install git+https://github.com/Pearl-com/pearl_mcp_server - playlist-mcp-server 🐍 🏠 📇 (⭐ 5, 🐛 2) - A Model Context Protocol (MCP) server that enables AI agents to create and manage music playlists through context-aware API endpoints.
pythonmcpserverapiaipip install git+https://github.com/m4dd0c/playlist-mcp-server - prefect-mcp-server 🐍 🏠 📇 (⭐ 5, 🍴 5, 🐛 6) - MCP server for interacting with the Prefect API
pythonmcpserverapipip install git+https://github.com/fortunto2/prefect-mcp-server - ProdE-mcp 🏠 (⭐ 5) - A powerful Model Context Protocol (MCP) server that provides contextual codebase understanding across multiple codebases and AI assistance for your development workflow.
mcpserveraihttpgitgit clone https://github.com/CuriousBox-AI/ProdE-mcp - pty-mcp 🐍 🏠 (⭐ 5, 🍴 3) - An MCP tool server that provides a stateful terminal.
pythonmcpserverpip install git+https://github.com/qododavid/pty-mcp - spheron-mcp-plugin 📜 🏠 (⭐ 5, 🍴 2, 🐛 1) - This MCP plugin integrates with the Spheron SDK to provide compute deployment capabilities directly through Claude.
javascriptaiclaudemcpnpm install spheronFdn/spheron-mcp-plugin - system_information_mcp 🐍 🏠 (⭐ 5, 🍴 2, 🐛 1) - DevEnvInfoServer - Cursor MCP Server for Development Environment Information
pythonaiclaudecursorcursoraipip install git+https://github.com/carterlasalle/system_information_mcp - mcp_python_toolbox 🐍 🏠 (⭐ 5, 🍴 5, 🐛 4) - A Model Context Protocol (MCP) server that provides a comprehensive set of tools for Python development
pythonmcpserverpip install git+https://github.com/gianlucamazza/mcp_python_toolbox - mcp-odoo-panda 🐍 🏠 (⭐ 5, 🍴 7, 🐛 2) - Python-based
pythonpip install git+https://github.com/pandeussilvae/mcp-odoo-panda - Telegram-AI-MCP-Assistant-Bot 🐍 🏠 (⭐ 5, 🍴 2) - Telegram AI Assistant Bot that responds to user messages using multiple MCP Servers
pythonmcpserveraipip install git+https://github.com/shettysaish20/Telegram-AI-MCP-Assistant-Bot - thegraph-mcp 🐍 🏠 (⭐ 5, 🍴 11, 🐛 4) - An MCP server that powers AI agents with indexed blockchain data from The Graph.
pythonmcpserveraihttppip install git+https://github.com/kukapay/thegraph-mcp - ticktick-mcp 🐍 🏠 📇 (⭐ 5, 🍴 6, 🐛 1) - TickTick MCP for managing your To-Do using AI
pythonmcpaiapihttppip install git+https://github.com/ekkyarmandi/ticktick-mcp - wallet-inspector-mcp 🐍 🏠 (⭐ 5, 🍴 3, 🐛 1) - An MCP server that empowers AI agents to inspect any wallet’s balance and onchain activity across major EVM chains and Solana chain.
pythonmcpserveraihttppip install git+https://github.com/kukapay/wallet-inspector-mcp - zotero_mcp 🐍 🏠 (⭐ 5) - Support connecting zotero via MCP, with custom server and client, without the need for tools like the Claude app, Cursor, etc.
pythonmcpserverpip install git+https://github.com/LRriver/zotero_mcp - fs-mcp-server 🐍 🏠 (⭐ 5, 🍴 1, 🐛 4) - 文件资料查找mcp服务 (Python-based)
pythonmcppip install git+https://github.com/boleyn/fs-mcp-server - mcp-bitbucket 🐍 🏠 (⭐ 5, 🍴 7, 🐛 3) - Bitbucket MCP Server Implementation in Python
pythonmcpserverpip install git+https://github.com/Kallows/mcp-bitbucket - MCP-Event 🐍 🏠 (⭐ 5) - A short demonstration of how you can build your own MCP Server!
pythonmcpserverpip install git+https://github.com/AI-Maker-Space/MCP-Event - mcp-firebase 🐍 🏠 (⭐ 5) - Python-based
pythonpip install git+https://github.com/robertodevs/mcp-firebase - MCP-Prompt-STDIO 🏠 (⭐ 5, 🍴 2) - A prompt to help AI build MCP servers.
mcpserveraigit clone https://github.com/ChrisRoyse/MCP-Prompt-STDIO - mcp-server-iris 🐍 🏠 (⭐ 5, 🍴 5, 🐛 3) - InterSystems IRIS MCP server
pythonmcpserverpip install git+https://github.com/caretdev/mcp-server-iris - mcp-upbank 📘 🏠 (⭐ 5) - An MCP server for interacting with your up-bank account, retrieving account balances and transactions.
typescriptaifinancial-datamcpmcp-servernpm install sirmews/mcp-upbank - pancakeswap-poolspy-mcp 🐍 🏠 (⭐ 5, 🍴 4, 🐛 3) - An MCP server that tracks newly created liquidity pools on Pancake Swap
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/pancakeswap-poolspy-mcp - rss-mcp-server 🐍 🏠 📇 (⭐ 5) - supprot fever api + remote
pythonapigradiohuggingfacehuggingface-spacespip install git+https://github.com/weekend-project-space/rss-mcp-server - slack-mcp-host 🐍 🏠 (⭐ 5) - MCP Host Server Application for Slack
pythonmcpserverpip install git+https://github.com/jexp/slack-mcp-host - uniswap-poolspy-mcp 🐍 🏠 (⭐ 5, 🍴 5, 🐛 3) - An MCP server that tracks newly created liquidity pools on Uniswap across nine blockchain networks.
pythonmcpserveraihttppip install git+https://github.com/kukapay/uniswap-poolspy-mcp - feishu_mcp_server 🐍 🏠 (⭐ 5, 🍴 2, 🐛 1) - 飞书MCP服务器,用于通过MCP协议向飞书发送消息
pythonmcppip install git+https://github.com/Chenzhi-Ana/feishu_mcp_server - mcp-agent 🐍 🏠 (⭐ 5) - MCP Agent is optimized using the ReWOO pattern, enabling even LLMs with fewer parameters to efficiently utilize MCP Server with minimal token consumption.
pythonmcpserverllmpip install git+https://github.com/nervo84/mcp-agent - mcp-excel-reader-server 🐍 🏠 (⭐ 5, 🍴 6) - A MS excel server based on modelcontextprotocol
pythonclaudeclineexcelllmpip install git+https://github.com/softgridinc-pte-ltd/mcp-excel-reader-server - mcpez 🏠 (⭐ 5, 🍴 2) - micro unified mcp server
htmlmcpservergit clone https://github.com/Veallym0n/mcpez - mcp-server-restart 🐍 🏠 (⭐ 5, 🍴 3) - Restarts Claude Desktop after mcp-server installation
pythonmcpserverrestpip install git+https://github.com/non-dirty/mcp-server-restart - sengokudaikon_aider-mcp-server 🐍 🏠 (⭐ 5, 🍴 1) - Mirror of https://github.com/sengokudaikon/aider-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/sengokudaikon_aider-mcp-server - akshare_mcp 🐍 🏠 (⭐ 4) - AKShare的MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/wukan1986/mcp_akshare - har-mcp 🐹 🏠 (⭐ 4, 🍴 2) - A MCP server for parsing and analyzing HAR (HTTP Archive) files
goaiclaudeclaude-aicursorgo install tjamet/har-mcp@latest - json-logs-mcp-server 🐍 🏠 (⭐ 4, 🍴 1, 🐛 1) - MCP server for Python JSON logs
pythonjsonlogsmcpmcp-serverpip install git+https://github.com/mfreeman451/json-logs-mcp-server - kvm-mcp 🐍 🏠 (⭐ 4, 🍴 2, 🐛 2) - An MCP server for KVM hypervisors
pythonkvm-hypervisormcp-servermcpserverpip install git+https://github.com/steveydevey/kvm-mcp - mcp_browser_use 🐍 🏠 📇 (⭐ 4, 🍴 2, 🐛 3) - Web use, browser automation, scraping, and automation with Model Context Protocol (MCP) and Selenium.
pythonmcpapiwebpip install git+https://github.com/janspoerer/mcp_browser_use - mcp-congress_gov_server 📘 🏠 (⭐ 4) - This is a Model Context Protocol (MCP) server designed to provide access to the official Congress.gov API (v3) using a hybrid approach.
typescriptaiclaudecongresscongress-legislatorsnpm install bsmi021/mcp-congress_gov_server - mcp-docx-server 🐍 🏠 (⭐ 4, 🍴 2) - MCP server to manipulate DOCX file
pythonmcpserverpip install git+https://github.com/h4ck4life/mcp-docx-server - mcp-fredapi 🐍 🏠 📇 (⭐ 4, 🍴 1, 🐛 2) - FRED (Federal Reserve Economic Data) API integration with Model Context Protocol (MCP)
pythonfinancefredfred-apillmpip install git+https://github.com/Jaldekoa/mcp-fredapi - ardupilot-mcp-server-sandbox 🐍 🏠 (⭐ 4, 🍴 1) - ArduPilotドローンを操作するMCPサーバーです。
pythonmcppip install git+https://github.com/hfujikawa77/ardupilot-mcp-server-sandbox - beam-mcp-server 🐍 🏠 (⭐ 4, 🍴 1) - MCP server to manage apache beam workflows with different runners
pythonmcpserverpip install git+https://github.com/souravch/beam-mcp-server - dolphindb-mcp-server 🐍 🏠 (⭐ 4, 🍴 3, 🐛 1) - dolphindb-mcp-server
pythonmcpserverdatabasehttppip install git+https://github.com/tradercjz/dolphindb-mcp-server - crypto-rss-mcp 🐍 🏠 (⭐ 4, 🍴 3) - An MCP server that aggregates real-time cryptocurrency news from multiple RSS feeds.
httpaigitgithubpythonpip install git+https://github.com/kukapay/crypto-rss-mcp - ctvidic_whoop-mcp-server 🐍 🏠 (⭐ 4, 🍴 1) - Mirror of https://github.com/ctvidic/whoop-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ctvidic_whoop-mcp-server - curl-mcp 🐍 🏠 (⭐ 4, 🍴 2) - MCP server that translates natural language instructions into curl commands, supporting both English and Spanish
httpmlgitgithubpythonpip install git+https://github.com/MartinPSDev/curl-mcp - celo-mcp 🐍 🏠 (⭐ 4, 🍴 6, 🐛 4) - MCP server that provides AI agents with access to Celo blockchain data and functionality
pythonmcpserveraipip install git+https://github.com/celo-org/celo-mcp - comfy-ui-mcp-server 🐍 🏠 (⭐ 4, 🍴 5, 🐛 4) - what it says on the tin
pythonpip install git+https://github.com/jonpojonpo/comfy-ui-mcp-server - mcp-on-cloudrun 🐍 🏠 (⭐ 4) - Deploy and host a remote MCP server on Cloud Run
pythoncloud-runmcpremote-mcp-serverserverpip install git+https://github.com/jackwotherspoon/mcp-on-cloudrun - mcp-openapi-proxy 🐍 🏠 📇 (⭐ 4, 🐛 1) - MCP Generator using OpenAPI spec
pythonmcp-serveropenapiproxymcppip install git+https://github.com/electrocucaracha/mcp-openapi-proxy - ComIDP-MCP-Server 🐍 🏠 (⭐ 4, 🍴 2) - A lightweight MCP (Model Context Protocol) server designed for seamless integrating ComIDP with Claude Desktop.
pythondata-extraction-from-pdfmcp-servermcpserverpip install git+https://github.com/ComPDFKit/ComIDP-MCP-Server - docs-mcp-server 📘 🏠 (⭐ 4, 🐛 4) - A local MCP server for searching official PipeCD docs.
pythonmcpserverdocumentation-toolllmspip install git+https://github.com/vikramdse/docs-mcp-server - dracor-mcp 🐍 🏠 (⭐ 4, 🍴 2, 🐛 3) - Python-based
pythonpip install git+https://github.com/stijn-meijers/dracor-mcp - FEA-MCP 🐍 🏠 (⭐ 4, 🍴 4) - FEA AI MCP Server (for LUSAS, ETABS etc)
pythonmcpserveraipip install git+https://github.com/GreatApo/FEA-MCP - files-db-mcp 🐍 🏠 (⭐ 4, 🍴 1, 🐛 1) - Python-based
pythonpip install git+https://github.com/randomm/files-db-mcp - mcp-qdrant-openai 🐍 🏠 (⭐ 4, 🍴 3, 🐛 1) - Python-based
pythonpip install git+https://github.com/amansingh0311/mcp-qdrant-openai - MCP-Server-and-client-Implementation-on-Linux 🐍 🏠 (⭐ 4, 🍴 4, 🐛 3) - MCP Server and client Implementation on Linux (Rather then using Claude Desktop)
pythonmcpserverpip install git+https://github.com/scholarly360/MCP-Server-and-client-Implementation-on-Linux - mcp-server-cvdlt 🐍 🏠 (⭐ 4, 🍴 1) - The repo is based on Model Context procotol of Python SDK, including DL models in CV, and provide the abilities to the LLM or vLLM model
pythonllmpip install git+https://github.com/MRonaldo-gif/mcp-server-cvdlt - mcp-server-openai 🐍 🏠 (⭐ 4, 🍴 3) - mcp-server-openai with o3-mini support
pythonmcpserveraipip install git+https://github.com/thadius83/mcp-server-openai - mcp-server-qrcode 📘 🏠 (⭐ 4, 🍴 2, 🐛 10) - Model Context Protocol server for generating QR codes
typescriptanthropicclaudemcpmcp-servernpm install jwalsh/mcp-server-qrcode - mcp-server-requests 🐍 🏠 (⭐ 4, 🍴 1) - Web Content Retrieval (full webpage, filtered content, or Markdown-converted), Custom User-Agent, Multi-HTTP Method Support (GET/POST/PUT/DELETE/PATCH), LLM-Controlled Request Headers, LLM-Accessible Response Headers, and more.
pythoncrawlerfatchllmmcppip install git+https://github.com/coucya/mcp-server-requests - mcp-server-unifi 🐍 🏠 (⭐ 4, 🍴 4, 🐛 1) - mcp-server-unifi (Python-based)
pythonmcpserverpip install git+https://github.com/zcking/mcp-server-unifi - mcp-sse 🐍 🏠 (⭐ 4, 🍴 1, 🐛 3) - 🔌🔄 Simple MCP Server Deployment
pythonanthropicclaudecontainerdeepseekpip install git+https://github.com/ryaneggz/mcpserve - mcp-web-snapshot 🐍 🏠 (⭐ 4) - Take snapshot of websites and deliver it to LLM tools.
pythonwebllmhttpgitpip install git+https://github.com/gustavo-meilus/mcp-web-snapshot - Narad-MCP-Server 🐍 🏠 (⭐ 4) - Narad MCP Server integrates GitHub, Email, and WhatsApp agents, allowing seamless communication and task automation through HTTP requests. It supports real-time and offline operations, providing a secure, efficient backend solution for managing multiple services with AI-powered workflows.
pythonmcpserveraimlpip install git+https://github.com/Edge-Explorer/Narad-MCP-Server - NBER-MCP 🐍 🏠 (⭐ 4) - Here is NBER-MCP, which is made for read NBER paper list easier.
pythonmcppip install git+https://github.com/sepinetam/nber-mcp - mcp-server-clickup 🐍 🏠 (⭐ 4, 🍴 2, 🐛 3) - Model Context Protocol (MCP) server implementation for ClickUp integration
pythonmcpserverpip install git+https://github.com/noahvanhart/mcp-server-clickup - mcp-server-deepseek 🐍 🏠 (⭐ 4, 🍴 1) - MCP Server for deepseek integration in Claude desktop
pythonmcpserverpip install git+https://github.com/vincentf305/mcp-server-deepseek - mcp-weather-sse 🐍 🏠 (⭐ 4, 🍴 2, 🐛 1) - Example Model Context Protocol Server use SSE from python's MCP sdk
pythonmcpserverpip install git+https://github.com/justjoehere/mcp-weather-sse - mindm-mcp 🐍 🏠 (⭐ 4, 🍴 4) - MindManager MCP Server for Automation and Integration on Win + macOS
pythonappscriptbrainmacosmacropip install git+https://github.com/robertZaufall/mindm-mcp - MoviePilot-MCP 🐍 🏠 (⭐ 4, 🍴 2, 🐛 1) - MCP Server for MoviePilot
pythonmcpserverpip install git+https://github.com/Pollo3470/MoviePilot-MCP - mqttx-mcp-sse-server 📜 🏠 (⭐ 4, 🍴 5) - An implementation of the Model-Context Protocol (MCP) that enables MQTT operations over Server-Sent Events (SSE) transport.
javascriptaiclaudecursoremqxnpm install ysfscream/mqttx-mcp-sse-server - multicluster-mcp-server 🐍 🏠 (⭐ 4, 🍴 4, 🐛 2) - The gateway for GenAI systems to interact with open-cluster-management through the MCP
pythonmcpaihttpkubernetespip install git+https://github.com/yanmxa/multicluster-mcp-server - Pentest-Tools-MCP-Server 🐍 🏠 (⭐ 4) - Pentest-Tools-MCP-Server
pythonmcpserverpip install git+https://github.com/ch1nhpd/pentest-tools-mcp-server - pipelex-mcp 🏠 (⭐ 4, 🐛 3) - MCP server to run Pipelex pipelines
makefilegenaillmmcppipelexgit clone https://github.com/Pipelex/pipelex-mcp - RapidAPI-MCP 🐍 🏠 📇 (⭐ 4, 🍴 2, 🐛 3) - MCP Server implementation for RapidAPI Global Patent API integration with SQLite storage
pythonmcpserverapisqlitepip install git+https://github.com/myownipgit/RapidAPI-MCP - redshift-utils-mcp 🐍 🏠 📇 (⭐ 4, 🍴 2) - 🤖 Enable AI assistants (Claude, Cursor) to monitor, diagnose, and query Amazon Redshift using this MCP server and the AWS Data API.
apihttpawsaigitpip install git+https://github.com/vinodismyname/redshift-utils-mcp - reexpress_mcp_server 🐍 🏠 (⭐ 4) - Reexpress Model-Context-Protocol (MCP) Server
pythonmcpserverhttpaipip install git+https://github.com/ReexpressAI/reexpress_mcp_server - snowflake-mcp 🐍 🏠 (⭐ 4, 🍴 2, 🐛 1) - MCP server implementation for Snowflake integration
pythonmcpserverpip install git+https://github.com/davidamom/snowflake-mcp - stock-market-mcp-server 🐍 🏠 📇 (⭐ 4, 🍴 1) - A Machine Conversation Protocol (MCP) server that provides stock market data and analysis tools using the Finnhub API.
pythonmcpserverapipip install git+https://github.com/sverze/stock-market-mcp-server - strava-mcp 🐍 🏠 (⭐ 4, 🍴 3) - An MCP server to interact with Strava
pythonanthropicclaudemcpmcp-serverpip install git+https://github.com/yorrickjansen/strava-mcp - trellis_mcp 🐍 🏠 (⭐ 4, 🐛 1) - Model Context Protocol(MCP) for TRELLIS(SOTA text-to-3d/image-to-3d) models
pythonblenderimage-to-3dmcpmcp-serverpip install git+https://github.com/FishWoWater/trellis_mcp - weather-forecast-server 🐍 🏠 📇 (⭐ 4, 🍴 3) - weather-forecast-server, MCP server, without api key, free. Get weather for cities around the world. 免费天气预报MCP工具。
pythonmcp-serverweatherweather-forecastweather-mcp-serverpip install git+https://github.com/shibing624/weather-forecast-server - web-scraping-with-mcp 🏠 📇 (⭐ 4, 🍴 1) - Example MCP server and instructions for connecting Anthropic LLMs to external web scraping tools, with real-world examples and Bright Data integration.
anthropic-claudeclaudemcpscraping-mcpweb-scrapinggit clone https://github.com/luminati-io/web-scraping-mcp - awesome-devops-mcp-servers 🏠 (⭐ 4, 🍴 1) - MCPServers in the DevOps domain.
mcpserveraigit clone https://github.com/derisk-ai/awesome-devops-mcp-servers - edgar-sec-mcp 🐍 🏠 (⭐ 4, 🍴 2) - An MCP Server to get data from EDGAR
pythonmcpserverpip install git+https://github.com/flothjl/edgar-sec-mcp - finance-mcp-server 🐍 🏠 (⭐ 4) - Finance mcp server- Get up-to-date prices and news about stocks and cryptocurrencies
pythonllmsmcpmcp-serverserverpip install git+https://github.com/Otman404/finance-mcp-server - github_graphql_api_mcp 🐍 🏠 (⭐ 4, 🍴 1) - A Model Control Protocol (MCP) server for exploring the GitHub GraphQL schema and executing optimized queries. Provides AI assistants with efficient GitHub data retrieval capabilities through GraphQL.
pythongithubgithub-apigithub-toolsllmpip install git+https://github.com/wanzunz/github_graphql_api_mcp - mcp_mlb_statsapi 🐍 🏠 📇 (⭐ 4, 🍴 3, 🐛 1) - This project provides an MCP (Multi-Channel Pipeline) server that acts as a wrapper for the MLB Stats API. It allows you to easily access and process various MLB data points, including schedules, game results, and team information. This server is designed for efficient data retrieval and processing within an MCP framework.
pythonmcpserverapimlpip install git+https://github.com/mpizza/mcp_mlb_statsapi - MCP_Recon 🐍 🏠 (⭐ 4, 🍴 1) - A comprehensive Model Context Protocol (MCP) server for web security reconnaissance and analysis.
pythonmcpserverwebaipip install git+https://github.com/sundayz-hunter/MCP_Recon - mcp-k8s-manager 🐍 🏠 (⭐ 4) - Un MCP server per la gestione di cluster Kubernetes su AKS (Azure Kubernetes Service), utilizzabile da Claude Desktop. Offre strumenti per eseguire comandi
kubectlekubectxdirettamente da un'interfaccia conversazionale.pythonmcpserverazurekubernetespip install git+https://github.com/crtdaniele/mcp-k8s-manager - mcp-plugin 🏠 (⭐ 4, 🍴 1) - 配合mcp-server-exe使用的插件
htmlmcpservergit clone https://github.com/shadowcz007/mcp-plugin - mcp-sqlexpress 🐍 🏠 (⭐ 4, 🍴 5, 🐛 4) - MCP server for interacting with SQLExpress
pythonmcpserverpip install git+https://github.com/hanweg/mcp-sqlexpress - Nayshins_mcp-server-ccxt 🐍 🏠 (⭐ 4, 🍴 1) - Mirror of https://github.com/Nayshins/mcp-server-ccxt
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Nayshins_mcp-server-ccxt - weekly-weather-mcp 🐍 🏠 (⭐ 4, 🍴 3) - Weather MCP server which returns 7 days of detailed weather forecasts anywhere in the world
pythonmcpmcp-servermcp-serversonecallapipip install git+https://github.com/rossshannon/weekly-weather-mcp - unifai-mcp-server 🏠 (⭐ 4, 🍴 4)
httpaigitgithubgit clone https://github.com/unifai-network/unifai-mcp-server - wireshark_mcp 🐍 🏠 (⭐ 4) - wireshark_mcp (Python-based)
pythonmcppip install git+https://github.com/waynecui/wireshark_mcp - wireshark-mcp 🐍 🏠 (⭐ 4) - TShark/Wireshark MCP server for network packet analysis via Claude
pythonmcpserverpip install git+https://github.com/A-G-U-P-T-A/wireshark-mcp - bangla-news-mcp 🐍 🏠 (⭐ 4, 🍴 1, 🐛 2) - A Model Context Protocol (MCP) server that retrieves bangla news to provide context to LLMs.
pythonmcpserverllmpip install git+https://github.com/hurutta/bangla-news-mcp - gemini_mcp 🐍 🏠 (⭐ 4) - Simple chat interface and server for testing Gemini MCP
pythonmcpservertestingpip install git+https://github.com/kevingduck/gemini_mcp - github-actions-mcp 📘 🏠 (⭐ 4) - A GitHub Actions integration powered by the MCP. This server exposes structured tools to manage GitHub issues, pull requests, and repositories through natural language interfaces and autonomous agents.
typescriptaiartificial-intelligencecicdgithub-actionsnpm install devopsier/github-actions-mcp - kimcp 🐍 🏠 (⭐ 4, 🍴 1) - MCP server enabling LLMs to use Korean APIs (Naver, Kakao, etc.)
pythonclaudekakaokakao-apimcppip install git+https://github.com/zeikar/kimcp - mcp_calculate_server 🐍 🏠 (⭐ 4, 🍴 2) - MCP Calculate Server
pythonmcpserverhtmlpip install git+https://github.com/611711Dark/mcp_calculate_server - mcp-demo-deepseek 🐍 🏠 📇 (⭐ 4) - Run a MCP client & server demo with DeepSeek API
pythonmcpserverapipip install git+https://github.com/Bill-Cai/mcp-demo-deepseek - mcp-host 🐍 🏠 (⭐ 4) - Python-based
pythonpip install git+https://github.com/chrishayuk/mcp-host - mcp-server-make 🐍 🏠 (⭐ 4, 🍴 3) - MCP Server for GNU Make
pythonai-assistantbuild-systembuild-toolsclaudepip install git+https://github.com/wrale/mcp-server-make - nano-currency-mcp-server 📜 🏠 (⭐ 4, 🍴 2, 🐛 3) - Send Nano currency from AI agents/LLMs
javascriptagentagentsaiai-agentnpm install kilkelly/nano-currency-mcp-server - neko233-ai-mcp-spine 🏠 (⭐ 4, 🍴 1, 🐛 1) - mcp server for generate spine animation 2D for game. and it work success.
mcpservergit clone https://github.com/SolarisNeko/neko233-ai-mcp-spine - oletools-mcp-server 🐍 🏠 (⭐ 4) - Secure MCP server for analyzing Excel files with oletools
pythonmcpserverpip install git+https://github.com/pradeep895/oletools-mcp-server - school-mcp 🐍 🏠 (⭐ 4, 🍴 2, 🐛 2) - A Model Context Protocol (MCP) server for academic tools, integrating with Canvas and Gradescope platforms.
pythoncanvasclaudegradescopemcppip install git+https://github.com/54yyyu/school-mcp - mcp-api 🏠 (⭐ 4)
htmlgit clone https://github.com/JoshuaRileyDev/mcp-api - opendota-mcp-server 🐍 🏠 📇 (⭐ 4, 🍴 6, 🐛 3) - Python-based
pythonapihttpgitgithubpip install git+https://github.com/asusevski/opendota-mcp-server - api-market-mcp-server 📘 🏠 📇 (⭐ 3, 🍴 2, 🐛 1) - API Market MCP Servers
typescriptaiai-apiapiapi-marketnpm install Noveum/api-market-mcp-server - asgardeo-mcp-server 🐹 🏠 (⭐ 3, 🍴 7, 🐛 5) - MCP server to interact with your Asgardeo organization through LLM tools
goagentsaillmmcpgo install asgardeo/asgardeo-mcp-server@latest - awesome-mcp-server 🏠 (⭐ 3, 🍴 2) - 🚀 Community-curated MCP servers that power DeployStack's enterprise catalog. Contribute once, deploy everywhere - from solo developers to enterprise teams with zero configuration.
aideploystackmcpmcp-servermodel-context-protocolgit clone https://github.com/deploystackio/awesome-mcp-server - base64_server 🐍 🏠 (⭐ 3, 🍴 2, 🐛 1) - 🚀 Base64编码解码MCP服务器:支持文本📝和图片🖼️转换,提供工具🛠️、资源和提示模板,完美集成到AI工作流程🤖
pythonbase64encodemcpmcp-serverpip install git+https://github.com/liuyazui/base64_server - BaseMcpServer 🐍 🏠 (⭐ 3) - A minimal containerized base for MCP servers using the MCP Python SDK
pythonmcpserveraipip install git+https://github.com/dawsonlp/BaseMcpServer - blocknative-mcp 🐍 🏠 (⭐ 3, 🍴 8, 🐛 2) - An MCP server that provides real-time gas price predictions across multiple blockchains.
pythonmcpserveraihttppip install git+https://github.com/kukapay/blocknative-mcp - cc_token_saver_mcp 🐍 🏠 (⭐ 3, 🍴 1) - Allow Claude code to use local llm for smaller tasks to save token or for specialized task
pythonllmpip install git+https://github.com/csabakecskemeti/cc_token_saver_mcp - ceph-mcp-server 🐍 🏠 (⭐ 3, 🍴 3, 🐛 1) - Ceph MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/rajmohanram/ceph-mcp-server - code2flow-mcp-server 🐍 🏠 (⭐ 3, 🍴 2, 🐛 2) - Code2Flow MCP服务器,用于生成代码调用图并通过MCP协议提供服务
pythonmcppip install git+https://github.com/kursk-ye/code2flow-mcp-server - codechecker-mcp 🐍 🏠 (⭐ 3, 🍴 3, 🐛 2) - Cursor code-checker MCP
pythonmcppip install git+https://github.com/jacklandis29/codechecker-mcp - cointelegraph-mcp 🐍 🏠 (⭐ 3, 🍴 4, 🐛 3) - An MCP server that provides real-time access to the latest news from Cointelegraph.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/cointelegraph-mcp - Coreflux-MQTT-MCP-Server 🐍 🏠 (⭐ 3) - Coreflux MQTT MCP Server
pythonmcpserverpip install git+https://github.com/CorefluxCommunity/Coreflux-MQTT-MCP-Server - crypto-whitepapers-mcp 🐍 🏠 (⭐ 3, 🍴 5, 🐛 3) - An MCP server serving as a structured knowledge base of crypto whitepapers.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/crypto-whitepapers-mcp - dev-kit-mcp-server 🐍 🏠 (⭐ 3, 🍴 4, 🐛 7) - Agent development tool-kit
pythonllm-agentsmcpmcp-serverserverpip install git+https://github.com/DanielAvdar/dev-kit-mcp-server - haskell-hackage-mcp 🐍 🏠 (⭐ 3, 🍴 2) - An MCP server to give Claude easy access to pulling docs
pythonmcpserverpip install git+https://github.com/apenugon/haskell-hackage-mcp - crypto-liquidations-mcp 🐍 🏠 (⭐ 3, 🍴 5, 🐛 1) - An MCP server that streams real-time cryptocurrency liquidation events from Binance.
pythonmcpserverhttpgitpip install git+https://github.com/kukapay/crypto-liquidations-mcp - devrev-mcp-server 🐍 🏠 (⭐ 3, 🍴 7, 🐛 5) - Python-based
pythonpip install git+https://github.com/kpsunil97/devrev-mcp-server - dexcom_g7_mcp_server 🐍 🏠 (⭐ 3) - MCP server for getting your blood glucose readings and history using dexcom share
pythonmcpserverpip install git+https://github.com/phildougherty/dexcom_g7_mcp_server - docker_mcp 🐍 🏠 (⭐ 3, 🍴 2, 🐛 2) - MCP Server for docker container creation and code execution
pythonmcpserveraidockerpip install git+https://github.com/zaycruz/docker_mcp - falahgs/MCP-Storybook-Image-Generator 📘 🏠 (⭐ 3, 🍴 2, 🐛 3) - Generates storybook images and matching children's stories using Google's Gemini AI, offering multiple art styles and instant previews.
httpaigitgithub - frida-mcp 🐍 🏠 (⭐ 3, 🍴 1) - frida mcp server for android apk analysis
pythonmcpserverpip install git+https://github.com/parktest0325/frida-mcp - github-mcp-server 🐍 🏠 (⭐ 3, 🍴 3) - This is github search MCP Server
pythonmcpservertypescriptpip install git+https://github.com/HuangZeLinCute/github-mcp-server - ibapi-mcp-server 🐍 🏠 📇 (⭐ 3, 🍴 2) - Interactive Brokers API Multi-Client Protocol Server
pythonserverapipip install git+https://github.com/karimQuant/ibapi-mcp-server - imf-data-mcp 🐍 🏠 📇 (⭐ 3, 🍴 4) - This MCP server integrates with the free IMF data API to provide a set of tools and resources for retrieving and processing economic data. It enables users to query datasets, fetch time series data, and list available indicators and countries, making it easier to work with IMF data in a structured and programmatic way.
pythonmcpserverapiaipip install git+https://github.com/c-cf/imf-data-mcp - jap-vocab-anki-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - Japanese Vocab Anki MCP Server
pythonagentic-workflowanki-deckanki-flashcardsjapanese-studypip install git+https://github.com/vionwinnie/jap-vocab-anki-mcp-server - mcp-imdb 🐍 🏠 (⭐ 3, 🍴 2) - MCP Server for IMDB (Python-based)
pythonmcpserverpip install git+https://github.com/clsung/mcp-imdb - mcp-mtender-server 📘 🏠 📇 (⭐ 3, 🍴 1) - An MCP (Model Context Protocol) server providing access to 🇲🇩 Moldova's public procurement data through the MTender API. Features include searching tenders, accessing tender details, budget information, and funding sources - all following the Open Contracting Data Standard (OCDS).
typescriptaijsmcpmoldovanpm install yoda-digital/mcp-mtender-server - beeper-mcp 🐍 🏠 (⭐ 3, 🍴 3, 🐛 1) - A backend service for executing beeper transactions on Binance Smart Chain
pythonaihttpgitgithubpip install git+https://github.com/intentos-labs/beeper-mcp - cdata-jdbc-mcp-server ☕ 🏠 (⭐ 3) - This read-only MCP Server allows you to connect to external data from Claude Desktop through CData JDBC Drivers. Free (beta) read/write servers available at https://www.cdata.com/solutions/mcp
httpgitgithubjavamcpgit clone https://github.com/CDataSoftware/cdata-jdbc-mcp-server - cisco-nso-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 2) - A Model Context Protocol (MCP) server implementation for Cisco NSO that enables AI-powered network automation through natural language interactions.
pythonaiciscomcpmodel-context-protocolpip install git+https://github.com/dbono711/cisco-nso-mcp-server - cloudzero-mcp 🐍 🏠 📇 (⭐ 3, 🍴 4, 🐛 3) - Talk to your cloud data using CloudZero API and Model Context Protocol (MCP) server for LLM tool calling
pythonmcpserverapillmpip install git+https://github.com/burkestar/cloudzero-mcp - jewei-mssql-mcp-server 🐍 🏠 (⭐ 3) - SqlServer(mssql)数据库查询
pythonserverpip install git+https://github.com/jeweis/jewei-mssql-mcp-server - kaltura-mcp 🐍 🏠 📇 (⭐ 3, 🍴 2, 🐛 1) - Kaltura-MCP server powering agentic AI workflows with Kaltura's API
pythonagenticaiclaudekalturapip install git+https://github.com/zoharbabin/kaltura-mcp - KIS_MCP_Server 🐍 🏠 (⭐ 3, 🍴 3, 🐛 1) - 한국투자증권 mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/migusdn/KIS_MCP_Server - MCP_InvestmentPortfolio 🐍 🏠 (⭐ 3, 🍴 2, 🐛 3) - MCP Server: Investment Portfolio Management
pythonmcpserverpip install git+https://github.com/ikhyunAn/MCP_InvestmentPortfolio - mcp-censys 🐍 🏠 📇 (⭐ 3, 🍴 2, 🐛 2) - mcp-censys is a MCP server that taps into the Censys Search API for real-time domain, IP, and FQDN reconnaissance
pythonmcpserverapiaipip install git+https://github.com/nickpending/mcp-censys - mcp-notmuch-sendmail 🐍 🏠 (⭐ 3, 🍴 2, 🐛 2) - A model context protocol server that reads mails with notmuch and sends mail with sendmail
pythonserveraipip install git+https://github.com/runekaagaard/mcp-notmuch-sendmail - mcp-persona-sessions 🐍 🏠 (⭐ 3, 🍴 1) - MCP server for persona-driven AI sessions: practice interviews, conduct guided reflection, and role-play conversations with realistic personas
pythonmcpserveraihttppip install git+https://github.com/mattjoyce/mcp-persona-sessions - mcp-rememberizer-vectordb 🐍 🏠 (⭐ 3, 🍴 1) - Python-based
pythonpip install git+https://github.com/skydeckai/mcp-rememberizer-vectordb - mcp-server-funasr 🐍 🏠 (⭐ 3) - MCPServer is a Python-based server that leverages Alibaba's FunASR library to provide speech processing services through the FastMCP framework.
pythonmcp-servermcpserverpip install git+https://github.com/radial-hks/mcp-server-funasr - mcp-server-imessage 🐍 🏠 (⭐ 3, 🍴 2) - MCP server for interacting with iMessage on macOS
pythonmcpserverpip install git+https://github.com/shirhatti/mcp-server-imessage - mcp-server-java-sse-http-demo ☕ 🏠 (⭐ 3, 🍴 1) - Java Model Context Protocol SSE HTTP Server with Jetty
javaagentic-aiaijettymcp-servergit clone https://github.com/stantonk/mcp-server-java-sse-http-demo - mcp-server-templates 🐍 🏠 (⭐ 3) - This repository provides a template for setting up Model Context Protocol (MCP) servers for local development.
pythonmcpserverpip install git+https://github.com/gupta-ujjwal/mcp-server-templates - mcp-server-vector-search 🐍 🏠 (⭐ 3, 🐛 1) - MCP Server to improve LLM context through vector search.
pythonknowledge-graphllmmcpneo4jpip install git+https://github.com/miosomos/mcp-server-vector-search - mdslides-mcp-server 🐍 🏠 (⭐ 3, 🍴 1) - MCP (Model Context Protocol) server for generating HTML slides from Markdown content
pythonmcpservermlhttppip install git+https://github.com/bsmnyk/mdslides-mcp-server - mcp2tavily 🐍 🏠 (⭐ 3, 🍴 6, 🐛 4) - 一个MCP服务器,让你的Claude Cline以及Langchain实现网络搜索功能。An MCP server that allows your Claude Cline and Langchain to implement network search functions.
pythonmcpserveraipip install git+https://github.com/mcp2everything/mcp2tavily - minimal-mcp-in-nix 🏠 (⭐ 3, 🍴 2) - Creating a barebones MCP server around python (plus uv), encapsulated in a nix flake
nixmcpserverpythongit clone https://github.com/mccartykim/minimal-mcp-in-nix - my-mcp-ssh 🐍 🏠 (⭐ 3) - MCP-based SSH tool for LLMs to interact with remote servers.
pythonmcpserverllmpip install git+https://github.com/ffpy/my-mcp-ssh - openai-deep-research-mcp 📜 🏠 (⭐ 3) - OpenAI Deep Research MCP Server
javascriptchatgptdeep-researchdeep-research-agentmcpnpm install fbettag/openai-deep-research-mcp - mcp-simplelocalize 🐍 🏠 (⭐ 3, 🍴 4) - A MCP (Model Context Protocol) server implementation for SimpleLocalize.
pythonmcpsimplelocalizeserverpip install git+https://github.com/GalvinGao/mcp-simplelocalize - mcp-sports 🐍 🏠 (⭐ 3, 🍴 2) - An MCP server for real-time sports.
pythonmcpserverpip install git+https://github.com/michaelfromyeg/mcp-sports - mcp-sse-client-server-docker 🐍 🏠 (⭐ 3) - A simple implementation of MCP Client/Server architecture with HTTP SSE transport layer, dockerized.
pythonmcpserverhttpdockerpip install git+https://github.com/dgallitelli/mcp-sse-client-server-docker - MCPonFuncOnACA 🏠 (⭐ 3) - MCP server sample travel buddy app hosted on Azure Functions on Azure Container Apps and MCP extension
bicepmcpserveraiazuregit clone https://github.com/raorugan/MCPonFuncOnACA - NmapMCP 🐍 🏠 (⭐ 3, 🍴 2, 🐛 2) - NmapMCP is a robust integration of the Nmap scanning tool with the Model Context Protocol (MCP), enabling seamless network scanning capabilities within MCP-compatible environments
pythonaimcpmcp-servernmappip install git+https://github.com/0xPratikPatil/NmapMCP - pgsql-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - 🔧 A powerful tool server based on the Model Context Protocol (MCP), enabling interaction with PostgreSQL databases via MCP calls.
pythonaimcpmcp-serverpgsqlpip install git+https://github.com/twn39/pgsql-mcp-server - podcrawler-mcp 🐍 🏠 (⭐ 3) - MCP server for podcast discovery through web crawling
pythonmcpserverwebpip install git+https://github.com/infinitimeless/podcrawler-mcp - primekg-mcp 🐍 🏠 (⭐ 3, 🍴 2) - MCP Server for PrimeKG dataset
pythonmcpserverpip install git+https://github.com/dmigo/primekg-mcp - rapidocr-mcp 🐍 🏠 📇 (⭐ 3, 🍴 1, 🐛 1) - A MCP server based on RapidOCR, providing an easy-to-use OCR interface.
pythonmcpserverapipip install git+https://github.com/z4none/rapidocr-mcp - sap-mcp 🐍 🏠 📇 (⭐ 3) - An MCP server to retrieve information like Sales Orders from the SAP Graph API Sandbox
pythonmcpserverapipip install git+https://github.com/CostingGeek/sap-mcp - tecton-mcp 🐍 🏠 (⭐ 3) - This MCP (Model Context Protocol) server provides tools to interact with tecton.
pythonmcpserverpip install git+https://github.com/tecton-ai/tecton-mcp - text2sim-MCP-server 🐍 🏠 (⭐ 3, 🍴 3, 🐛 2) - Text2Sim MCP Server is a simulation engine that supports multiple modeling paradigms, including Discrete-Event Simulation (DES) and System Dynamics (SD). It integrates with LLMs using the Model Context Protocol (MCP), enabling powerful simulation capabilities within natural language environments like Claude Desktop.
pythonllm-agentllm-toolsmcp-serverpysdpip install git+https://github.com/IamCatoBot/text2sim-MCP-server - monarchmoney-mcp 🐍 🏠 (⭐ 3, 🍴 2) - Python-based
pythonpip install git+https://github.com/richardadonnell/monarchmoney-mcp - mcp-web-101 🏠 (⭐ 3) - An interactive web tutorial for learning how to build MCP (Model Context Protocol) servers. This educational website provides step-by-step guidance for implementing and understanding MCP servers.
ejsaiiallmmcpgit clone https://github.com/opestro/mcp-web-101 - mcpsecurity 🐍 🏠 (⭐ 3, 🍴 2, 🐛 1) - Vulnerable MCP Server
pythonmcpserverpip install git+https://github.com/evrenyal/mcpsecurity - mcts-mcp-server 🐍 🏠 (⭐ 3, 🍴 2, 🐛 3) - Bayesian MCTS Model Context Protocol Server allowing Claude to control Ollama local models for Advanced MCTS and analysis.
pythonaibayesianclaudemcp-serverpip install git+https://github.com/angrysky56/mcts-mcp-server - neo4j-mcp 📘 🏠 (⭐ 3, 🍴 3) - A Cursor MCP (Model Context Protocol) server that enables seamless interaction with Neo4j databases directly from the Cursor IDE.
typescriptaicursormcpservernpm install ezedinff/neo4j-mcp - Nonead-Universal-Robots-MCP 🐍 🏠 (⭐ 3, 🍴 3, 🐛 4) - nUR_MCP_SERVER is an intelligent industrial collaborative robot control middleware system built based on the MCP (Model Control Protocol) interface protocol. It realizes the natural language interactive control of industrial robots by integrating a large language model (LLM).
pythonmcpuniversal-robotsururmcppip install git+https://github.com/nonead/nUR_MCP_SERVER - selenium-mcp 🐍 🏠 (⭐ 3) - A MCP server for selenium
pythonmcpserverpip install git+https://github.com/DouyuShinyruo/selenium-mcp - todo-txt-mcp 🐍 🏠 (⭐ 3) - 🔗 Model Context Protocol server for todo.txt files - Connect your todo.txt to AI assistants like Claude Desktop
pythonaiai-assistantartificial-intelligenceclaudepip install git+https://github.com/danielmeint/todo-txt-mcp - twitter-mcp 🐍 🏠 📇 (⭐ 3) - Model Context Protocol server for Twitter integration. can be used to perform CRUD like operations using the twitter API in the background
pythonaiclaudemcp-servermodelcontextprotocolpip install git+https://github.com/Dishant27/twitter-mcp - usaspending-mcp 🐍 🏠 📇 (⭐ 3, 🍴 1) - mcp server to interact with usaspending.gov api
pythongoosemcpusaspendingserverpip install git+https://github.com/flothjl/usaspending-mcp - uv-mcp 🐍 🏠 (⭐ 3, 🍴 2) - MCP server for introspection of python environments
pythonmcpserverpip install git+https://github.com/dmclain/uv-mcp - vikingdb-mcp-server 🐍 🏠 (⭐ 3, 🍴 4, 🐛 4) - a mcp server for vikingdb store and search
pythonmcpserverhttpgitpip install git+https://github.com/KashiwaByte/vikingdb-mcp-server - voice-agent-mcp-server 📜 🏠 (⭐ 3) - A Model Context Protocol (MCP) server that integrates Twilio Voice, Deepgram AI, and OpenAI to create intelligent voice-based HR automation tools.
javascriptaideepgrammcpmcp-servernpm install prakharbhardwaj/voice-agent-mcp-server - xrpl-mcp-service 🐍 🏠 (⭐ 3, 🍴 6, 🐛 2) - An MCP server implementation for interacting with the XRP Ledger blockchain
pythonmcpserveraipip install git+https://github.com/tedlikeskix/xrpl-mcp-service - artemis-mcp-server 🐍 🏠 (⭐ 3) - this is a mcp server for artemis sast tool
pythonmcpserverpip install git+https://github.com/zsdlove/artemis-mcp-server - chrome-mcp-server 🐍 🏠 (⭐ 3, 🍴 1) - MCP server to interact with Chrome
pythonmcpserverpip install git+https://github.com/jverre/chrome-mcp-server - ddg_mcp_server 🐍 🏠 📇 (⭐ 3) - A web search tool and API powered by DuckDuckGo, Gradio, and MCP, providing both a user-friendly web interface and Claude Desktop tool integration. It fetches web search results, extracts summaries, and retrieves the full content of web pages in markdown format.
pythonmcpapiwebgopip install git+https://github.com/shgsousa/ddg_mcp_server - elastic-semantic-search-mcp-server 🐍 🏠 (⭐ 3, 🍴 5, 🐛 4) - MCP server to search up-to-date elasticsearch docs
pythonmcpserverpip install git+https://github.com/jedrazb/elastic-semantic-search-mcp-server - fal-ai-mcp-server 🐍 🏠 📇 (⭐ 3, 🍴 1) - An MCP (Model Context Protocol) Server to use the fal.ai APIs to generate images and videos.
pythongenerative-aimcpmcp-serverserverpip install git+https://github.com/piebro/fal-ai-mcp-server - mcp_server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - mcp_server (Python-based)
pythonmcpserverpip install git+https://github.com/ningwenjie/mcp_server - mcp-agentic-rag 🐍 🏠 (⭐ 3) - MCP Server for Agentic RAG applications
pythonmcpserverpip install git+https://github.com/rukshannet/mcp-agentic-rag - mcp-dev-server 🐍 🏠 (⭐ 3, 🍴 5, 🐛 3) - Python-based
pythonpip install git+https://github.com/dillip285/mcp-dev-server - mcp-jira-python 🐍 🏠 (⭐ 3, 🍴 9, 🐛 5) - JIRA MCP Server Implementation in Python
pythonmcpserverpip install git+https://github.com/Kallows/mcp-jira-python - -toast-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 5) - A Model Context Protocol (MCP) server with Windows 10 desktop notifications support. It processes notification requests from MCP clients like VSCode Cline and displays customizable desktop notifications using win10toast.
pythonmcpserverpip install git+https://github.com/naru-sensei/-toast-mcp-server - aws-mcp-server 🐍 🏠 (⭐ 3) - MCP (Model context protocol) server to connect MCP client such as Claude Desktop.
pythonaiagentanthropicchatgptclaude-aipip install git+https://github.com/codewithdpk/aws-mcp-server - cmd-line-executor-MCP 🐍 🏠 (⭐ 3, 🍴 1) - Experimental MCP server to execute command line commands
pythonmcpserverpip install git+https://github.com/MarkusPfundstein/cmd-line-executor-MCP - comfyui_mcp_server 🐍 🏠 (⭐ 3) - generate_image and other workflows
pythonpip install git+https://github.com/zuojianghua/comfyui_mcp_server - mcp-context-template 🏠 (⭐ 3) - 🪱 MCP Context Template is a repository designed to centrally manage AI tools (MCP) to reduce context sharing costs and improve development productivity.
claudeclaude-aiclaude-codecontextcursorgit clone https://github.com/currenjin/mcp-context-template - mcp-finance-server-py 🐍 🏠 (⭐ 3, 🐛 1) - A minimal MCP server built with Python that exposes two example tools: one to convert a company name into a stock symbol, and another to fetch financial data from Yahoo Finance. The project focuses on learning how to build and run an MCP server—using a simple financial scenario purely as a demo use case.
pythonmcpserverpip install git+https://github.com/esurovtsev/mcp-finance-server-py - persona-4-golden-mcp-real-time-hacking 🦀 🏠 (⭐ 3) - MCP Rust-based memory hacking tool for "Persona 4 Golden".
rustaihackingllmmcpcargo install --git https://github.com/Rayato159/persona-4-golden-mcp-real-time-hacking - shopware-mcp 📘 🏠 (⭐ 3, 🍴 1) - TypeScript-based
httpllmgitgithubtypescriptnpm install dithom/shopware-mcp - Solana-MCP-Trading-Server 🏠 (⭐ 3, 🍴 3, 🐛 2) - server that shows trending tokens and integrates Grok, xAI image understanding and vision (interpreted as a vision-capable AI), and Claude's computer use capabilities.
serveraigit clone https://github.com/8bitsats/Solana-MCP-Trading-Server - mcp-gotify 🐍 🏠 (⭐ 3, 🍴 1) - MCP server for sending gotify notifications
pythonmcpservergopip install git+https://github.com/SecretiveShell/mcp-gotify - mcp-kusto 🐍 🏠 (⭐ 3, 🍴 2, 🐛 1) - An MCP Server for Azure Kusto
pythonmcpserverazurepip install git+https://github.com/ashishroy077/mcp-kusto - unity-mcp 🔷 🏠 (⭐ 3) - Unity MCP server, providing a bridge between the Unity Editor and external Large Language Models (LLMs) or cloud-based AI agents.
c#cursor-aillmmcpunitygit clone https://github.com/NoSpoonLab/unity-mcp - upstage-mcp-server 🐍 🏠 📇 (⭐ 3) - A Model Context Protocol server for parsing documents using Upstage AI's document digitization API.
pythonserverapiaipip install git+https://github.com/PritamPatil2603/upstage-mcp-server - mcp-sol 🐍 🏠 (⭐ 3, 🍴 4, 🐛 2) - Model Context Protocol for Solana Client
pythonpip install git+https://github.com/tywenk/mcp-sol - mcpproxy 🐍 🏠 (⭐ 3) - Start any MCP Server remotely using the MCP standard protocol.
pythonmcpserverpip install git+https://github.com/jinyalong/mcpproxy - mochow-mcp-server-python 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - Model Context Protocol Server for Mochow
pythonserverpip install git+https://github.com/baidu/mochow-mcp-server-python - mcp-wegene-assistant 🐍 🏠 (⭐ 3, 🍴 4, 🐛 2) - MCP server to analyze your genetic test results from WeGene
pythonmcpserverpip install git+https://github.com/xraywu/mcp-wegene-assistant - MemProcFS-mcp-server 🐍 🏠 (⭐ 3, 🍴 3, 🐛 1) - MemProcFS-mcp-server
pythonmcpmcp-servermemprocfsserverpip install git+https://github.com/Tokeii0/MemProcFS-mcp-server - modal-mcp-server 🐍 🏠 (⭐ 3, 🍴 2, 🐛 2) - MCP Server for managing Modal applications
pythonmcpserverpip install git+https://github.com/smehmood/modal-mcp-server - Model-Context-Protocol 🐍 🏠 (⭐ 3, 🍴 1) - MCP implementation code that sets up the server, integrates the LLaMA model for summarization, and serves it via a Flask application.
pythonmcpservergit clone https://github.com/Vijayk-213/Model-Context-Protocol - ollama-chat-with-mcp 🐍 🏠 (⭐ 3, 🍴 1) - This app demonstrates use of MCP server and client in a local model chat via Ollama that incorporates web search via Serper.
pythonmcpollamaserperserverpip install git+https://github.com/redbuilding/ollama-chat-with-mcp - multi-service-mcp-server 🐍 🏠 (⭐ 3, 🍴 2, 🐛 1) - an MCP server for the services I like to use with AI agents, which you should probably fork and modify for your own use. No PRs accepted, this is just for me. Not private because you or a bot might get something out of what you see here.
pythonmcpserveraipip install git+https://github.com/AdamPippert/multi-service-mcp-server - oceanbase_mcp_server 🐍 🏠 (⭐ 3, 🍴 3) - A Model Context Protocol (MCP) server that enables secure interaction with OceanBase databases. This server allows AI assistants to list tables, read data, and execute SQL queries through a controlled interface, making database exploration and analysis safer and more structured.
pythonmcpserverdatabaseaipip install git+https://github.com/yuanoOo/oceanbase_mcp_server - pubchem-mcp-server 🐍 🏠 (⭐ 3, 🍴 5) - Enables large language models to correctly query molecular databases and generate structure files
pythondatabasemcpaipip install git+https://github.com/PhelanShao/pubchem-mcp-server - shieldmcp 🐍 🏠 (⭐ 3) - A shield for logging, deep debug and sanitization for MCP servers at development stage
pythonmcpserverloggingpip install git+https://github.com/shieldmcp/shieldmcp - Terraform-MCP-Server 🐍 🏠 (⭐ 3, 🍴 2) - This project provides an MCP (Model Context Protocol) server that exposes Terraform infrastructure-as-code operations through natural language. It enables LLMs to execute Terraform commands and retrieve information about infrastructure without requiring specific command syntax knowledge.
pythonmcpserverllmhttppip install git+https://github.com/jashkahar/Terraform-MCP-Server - ledger-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - MCP Server for my ledger
pythonmcpserverpip install git+https://github.com/mprokopov/ledger-mcp-server - mcp_template 🐍 🏠 (⭐ 3, 🍴 5, 🐛 2) - A template for building mcp servers in python
pythonmcpserverpip install git+https://github.com/chrisboden/mcp_template - mcp-excel 🐍 🏠 (⭐ 3, 🍴 3, 🐛 1) - MCP server to give client the ability to read Excel files
pythonmcpserverpip install git+https://github.com/algonacci/mcp-excel - whereami-mcp 🐍 🏠 (⭐ 3, 🍴 3, 🐛 4) - A lightweight mcp server that tells you exactly where you are.
pythonmcpserverpip install git+https://github.com/kukapay/whereami-mcp - mcp-kafka 🐍 🏠 (⭐ 3, 🍴 1) - An MCP server for Apache Kafka & its ecosystem.
pythonmcpserverpip install git+https://github.com/brandon-powers/mcp-kafka - mcp-local-server 🐍 🏠 (⭐ 3, 🍴 2, 🐛 2) - Local Model Context Protocol Server with BirdNet-Pi integration
pythonserverpip install git+https://github.com/DMontgomery40/mcp-local-server - case-chronology-mcp 🐍 🏠 (⭐ 2) - A Model Context Protocol (MCP) server for building and managing chronological timelines of case events. Perfect for legal professionals who need to organize complex case histories.
pythonmcpserverpip install git+https://github.com/medelman17/case-chronology-mcp - clipboard_mcp 🐍 🏠 (⭐ 2) - An MCP server that allows LLM models to save relevant output directly to your system clipboard for immediate use.
pythonmcpserverllmpip install git+https://github.com/csabakecskemeti/clipboard_mcp - codemagic-mcp 🐍 🏠 (⭐ 2) - Codemagic CI/CD MCP Server
pythonmcpserverhttpgitpip install git+https://github.com/stefanoamorelli/codemagic-mcp - elections-canada-mcp-server 🐍 🏠 (⭐ 2) - This Model Context Protocol (MCP) server provides access to Canadian federal election data. The server exposes resources and tools to query and analyze election results by riding, province, and party.
pythonmcpserverpip install git+https://github.com/ThreeFortyThree-Canada/elections-canada-mcp-server - facets-module-mcp 🐍 🏠 (⭐ 2, 🐛 5) - MCP server for Module development
pythonmcpserverpip install git+https://github.com/Facets-cloud/facets-module-mcp - fetch-mcp 📘 🏠 (⭐ 2, 🍴 1) - An MCP server for fetching URLs / Youtube video transcript.
typescriptanthropiccargoclaudecontext-awarenpm install OrionHubScript/fetch-mcp - file-convert-mcp 🐍 🏠 (⭐ 2) - A Model Context Protocol (MCP) server for converting files between different formats
pythonmcpserverpip install git+https://github.com/convertguru/file-convert-mcp - aemet-mcp 🐍 🏠 📇 (⭐ 2, 🍴 5) - MCP server for check Spanish climate data using AEMET web API
pythonclimate-datamcp-serverspainmcppip install git+https://github.com/AnCode666/aemet-mcp - ai-agent-mcp-servers 🐍 🏠 (⭐ 2, 🐛 1) - AI Agent MCP Servers Provide Tools For ai-agent-workflow of FinTech Project
pythonmcpserveraipip install git+https://github.com/shayne007/ai-agent-mcp-servers - hf-trending-mcp 🐍 🏠 (⭐ 2, 🍴 2, 🐛 3) - An MCP server that tracks trending AI models, datasets, and spaces on Hugging Face.
pythonmcpserveraipip install git+https://github.com/kukapay/hf-trending-mcp - homeassistant-mcp-controller 🐍 🏠 (⭐ 2, 🐛 1) - A Home Assistant integration to control various MCP servers including Bookstack, Microsoft 365, and Loki
pythonmcpserverpip install git+https://github.com/PKHexxxor/homeassistant-mcp-controller - JackKuo666_semanticscholar-MCP-Server 🐍 🏠 (⭐ 2) - Mirror of https://github.com/JackKuo666/semanticscholar-MCP-Server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/JackKuo666_semanticscholar-MCP-Server - jotsu-mcp 🐍 🏠 (⭐ 2) - Workflow engine for executing Model Context Protocol (MCP) workflows. It provides a lightweight runtime for running AI-powered tasks across MCP-compatible servers with built-in support for authentication, resources, and tools. This package powers the Jotsu platform but can also be used independently in any Python environment.
pythonmcpmcp-clientmcp-serverserverpip install git+https://github.com/getjotsu/jotsu-mcp - kotlin-cyrpto-price-spring-mcp-server-demo 🎯 🏠 (⭐ 2) - Kotlin Spring AI MCP server demo. Getting Cryptocurrency pricing from Binance
kotlinmcpserveraigit clone https://github.com/gaplo917/kotlin-cyrpto-price-spring-mcp-server-demo - mathcad-mcp 🐍 🏠 (⭐ 2) - MathCAD MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/hvkshetry/mathcad-mcp - beatport-mcp-server 🏠 📇 (⭐ 2, 🐛 1) - MCP Server that connects an LLM to the Beatport API
rich text formatmcpserverapillmgit clone https://github.com/ivo-toby/beatport-mcp-server - bitable-mcp 🐍 🏠 (⭐ 2, 🍴 4, 🐛 2) - This MCP server provides access to Lark Bitable through the Model Context Protocol. It allows users to interact with Bitable tables using predefined tools.
pythonbitablemcpmcp-serverserverpip install git+https://github.com/lloydzhou/bitable-mcp - cellrank-mcp 🐍 🏠 (⭐ 2) - MCP server for trajectory inference using cellrank
pythonmcpserverpip install git+https://github.com/scmcphub/cellrank-mcp - jira-mcp 📘 🏠 📇 (⭐ 2, 🍴 1, 🐛 15) - MCP server for using the Jira Cloud API
httpaigitgithubpythonpip install git+https://github.com/raj-mehra/jira-mcp - MathMind-MCP-SERVER 🐍 🏠 (⭐ 2) - MathMind-MCP-SERVER (Python-based)
pythonmcpserverpip install git+https://github.com/Runninghcm/MathMind-MCP-SERVER - Leetcode_Notes_MCP 🐍 🏠 (⭐ 2) - MCP Server to generate Leetcode Notes
pythonmcpserverpip install git+https://github.com/Kishan-N/Leetcode_Notes_MCP - mcp_server_demo 💎 🏠 (⭐ 2) - MCP Server Demo (Ruby-based)
pythonrubymcpserverpip install git+https://github.com/kunalworldwide/mcp_server_demo - MCP-Agents 🐍 🏠 (⭐ 2, 🍴 1) - MCP Agents is an AI-powered browser automation tool that lets you interact with websites using natural language. Built with Streamlit, OpenAI, and Puppeteer via the Model Context Protocol (MCP), it supports multi-step navigation, interaction, and content extraction—all with simple text commands.
pythonautomationbrowsermcpmcp-clientpip install git+https://github.com/CodeWithHarshAI/MCP-Agents - mcp-agg 🐍 🏠 (⭐ 2, 🍴 1) - Aggregate MCP server
pythonmcpserverpip install git+https://github.com/moosh3/mcp-agg - mcp-ARCknowledge 🐍 🏠 (⭐ 2, 🍴 1, 🐛 2) - MCP - Bridge all your webhook endpoints into 1 unified config
pythonmcpwebpip install git+https://github.com/dragonjump/mcp-arcknowledge - mcp-github-cli 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - a MCP server for github using the GH cli under the covers
pythonmcpserverpip install git+https://github.com/michaelneale/mcp-github-cli - mcp-security 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - A standardized security evaluation framework for MCP servers, including assessment templates and an automated vulnerability scanner. This registry helps developers identify secure implementations for AI applications and promotes best practices across the MCP ecosystem.
pythonmcpserveraipip install git+https://github.com/everychart/mcp-security - mcp-server-newrelic 🐍 🏠 (⭐ 2, 🍴 5) - The Unofficial MCP Server for New Relic
pythonagentic-aiaiaiopsmcppip install git+https://github.com/ulucaydin/mcp-server-newrelic - mcp-servers 🐹 🏠 (⭐ 2, 🍴 1) - Production-ready Model Context Protocol (MCP) servers in Python, Go, and Rust for VS Code integration. Enables AI systems to interact with tools via standardized interfaces.
goai-agent-toolsai-agentsai-agents-frameworkanthropic-claudego install gunbun33/mcp-servers@latest - mcp-server-database-jdbc ☕ 🏠 (⭐ 2, 🍴 1) - A MCP (model context protocol) server that gives the LLM access to and knowledge about databases
javaailangchain4jmcpspringgit clone https://github.com/delei/mcp-server-database-jdbc - mcp-server-for-copilot 🐍 🏠 (⭐ 2) - MCP server wrapper for the agents built using MSFT Copilot studio
httpaimlgitgithubpip install git+https://github.com/CrewAakash/mcp-server-for-copilot - mcp-servers-client-langgraph-react-agent 🐍 🏠 (⭐ 2, 🍴 2) - Multi MCP Server and client w/ LangGraph Prebuilt ReAct Agent
pythonmcpserverreactpip install git+https://github.com/ahmedmusawir/mcp-servers-client-langgraph-react-agent - mcp-ShellGateway 🐍 🏠 (⭐ 2) - A secure Model Context Protocol (MCP) server that provides Linux shell command execution capabilities for Claude Desktop
pythonmcpserverpip install git+https://github.com/Frost26/mcp-linux-shell-server - mcp-sql-server-natural-lang 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - A Model Context Protocol (MCP) implementation enabling communication between an LLM and SQL Server. Allows users to query SQL databases using natural language and get structured SQL responses.
pythonmcpserverdatabasellmpip install git+https://github.com/Amanp17/mcp-sql-server-natural-lang - mcpserve 🐍 🏠 (⭐ 2, 🍴 1) - Simple MCP Server w/ Shell Exec. Connect to Local via Ngrok, or Host Ubuntu24 Container via Docker
pythonanthropiccontainerdeepseekdockerpip install git+https://github.com/mark-oori/mcpserve - mcpware 🐍 🏠 (⭐ 2) - Gateway MCP Server - Routes tool calls to MCP backends
pythonagentaidockergatewaypip install git+https://github.com/delexw/mcpware - mqtt-mcp 🐍 🏠 (⭐ 2, 🍴 2) - A Model Context Protocol (MCP) server for MQTT.
pythonmcpmcp-servermqttserverpip install git+https://github.com/ezhuk/mqtt-mcp - chainlist-mcp 🐍 🏠 (⭐ 2, 🍴 2) - An MCP server that gives AI agents fast access to verified EVM chain information, including RPC URLs, chain IDs, explorers, and native tokens.
pythonmcpserveraihttppip install git+https://github.com/kukapay/chainlist-mcp - ChatApp-AI-Agent-MCP-Server-PostgreSQL 🐍 🏠 (⭐ 2, 🍴 1) - Web Chat App which uses Azure AI Agent to connect to PostgreSQL using MCP-Server
pythonmcpserverwebaipip install git+https://github.com/Shailender-Youtube/ChatApp-AI-Agent-MCP-Server-PostgreSQL - chesspal-mcp-engine 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - A chess engine MCP server powered by Stockfish
pythonmcpserverpip install git+https://github.com/wilson-urdaneta/dylangames-mcp-chess-engine - cleanuri-url-shortener-mcp 🐍 🏠 (⭐ 2, 🍴 4, 🐛 1) - This MCP server will return the shortened URL using cleanuri.
pythonmcpserverpip install git+https://github.com/Talismanic/cleanuri-url-shortener-mcp - files-mcp 🐍 🏠 (⭐ 2) - Files.com MCP allows your AI model, like ChatGPT or Claude, to use Files.com directly. Want to move files, copy files, or perform real File Transfer in the Cloud and to/from on-premise servers via AI? You're in the right place.
pythonmcpserveraipip install git+https://github.com/Files-com/files-mcp - fujitsu-sdt-mcp 🐍 🏠 📇 (⭐ 2, 🍴 2) - MCP-enabled server for natural language interaction with Fujitsu's Social Digital Twin API. Execute economic and social simulations directly from LLMs and verify effects before real-world implementation
pythonmcp-servermcpserverapipip install git+https://github.com/3a3/fujitsu-sdt-mcp - createveai-nexus-server 🐍 🏠 📇 (⭐ 2, 🍴 5, 🐛 1) - Createve.AI Nexus Server: MCP and API bridge for ComfyUI-node compatible LLM and agent use
pythonmcpserverapiaipip install git+https://github.com/spgoodman/createveai-nexus-server - datalayer_jupyter-mcp-server 🐍 🏠 (⭐ 2, 🍴 2, 🐛 1) - Mirror of https://github.com/datalayer/jupyter-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/datalayer_jupyter-mcp-server - flock-mcp 🐍 🏠 (⭐ 2) - Flock MCP Servers and Tools
pythonmcpserverpip install git+https://github.com/whiteducksoftware/flock-mcp - google-sheets-mcp-server 🐍 🏠 (⭐ 2, 🍴 7) - A Model Context Protocol (MCP) server implementation for Google Sheets
pythonmcpservergopip install git+https://github.com/amaboh/google-sheets-mcp-server - aider-mcp-upgraded 🐍 🏠 (⭐ 2, 🐛 1) - Aider-MCP-Upgraded is a production-grade multi-agent AI coding system that combines Desktop Commander (DC) investigation capabilities with Aider's implementation power. Features 70%+ token reduction, modular architecture, and intelligent workflow automation through strategic agent coordination.
pythonmcpaipip install git+https://github.com/jacv888/aider-mcp-upgraded - airtable-mcp-config 🐚 🏠 (⭐ 2, 🍴 1) - Airtable MCP server configuration and documentation
shellmcpserveraidocumentationgit clone https://github.com/AliMHJR/airtable-mcp-config - Apple-Shortcuts-MCP 🐍 🏠 (⭐ 2) - Extend Claude's capabilities using MCP and MacOS Shortcuts
pythonapplegeminimcpmcp-serverpip install git+https://github.com/as2811-project/Apple-Shortcuts-MCP - asset-price-mcp 📜 🏠 (⭐ 2, 🍴 2, 🐛 2) - Asset Price MCP Server
javascriptaillmmcpservernpm install mk965/asset-price-mcp - awesome-mcps 📘 🏠 (⭐ 2) - An awesome collection of Model Context Protocol (MCP) tools
typescriptai-agentllmmcpmcp-servernpm install kewin1807/awesome-mcps - big-brother-mcp 🐍 🏠 (⭐ 2) - A Model Context Protocol (MCP) server designed as a honeypot to catch AI systems that automatically try to report users to law enforcement agencies.
pythonmcpserveraipip install git+https://github.com/angrypenguinpng/big-brother-mcp - china-weather-mcp-server 🐍 🏠 (⭐ 2, 🍴 1) - MCP server to query weather in Chinese cities
pythonmcpserverpip install git+https://github.com/DLYZZT/china-weather-mcp-server - clickhouse-mcp-server 🐍 🏠 (⭐ 2, 🍴 5, 🐛 1) - An MCP server implementation that enables Claude AI to interact with Clickhouse databases.
pythonmcpserverdatabaseaipip install git+https://github.com/burakdirin/clickhouse-mcp-server - CooKey-Monster_EbayMcpServer 🐍 🏠 (⭐ 2, 🍴 1) - Mirror of https://github.com/CooKey-Monster/EbayMcpServer
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/CooKey-Monster_EbayMcpServer - DocReaderMCP 🐍 🏠 (⭐ 2) - An MCP server that can read online documents to solve problems accordingly!
pythonmcpserverpip install git+https://github.com/NetMindAI-Open/DocReaderMCP - excel2json-mcp-server 🐍 🏠 (⭐ 2) - MCP server for converting Excel files to JSON format with support for merged cells and Chinese characters
pythonmcpserverjsonpip install git+https://github.com/v587d/excel2json-mcp-server - MCP-Elevenlab-Scribe-ASR 🐍 🏠 📇 (⭐ 2, 🍴 2) - Model Control Protocol (MCP) server for ElevenLabs Scribe ASR API
pythonmcpserverapipip install git+https://github.com/aromanstatue/MCP-Elevenlab-Scribe-ASR - mcp-hub 🐍 🏠 (⭐ 2, 🐛 4) - MCP Hub is a comprehensive framework for building, managing, and deploying Model Context Protocol (MCP) clients and servers. It provides tools and configurations to enable seamless integration and execution of end-to-end MCP workflows.
pythonllmllmappsmcpmcp-clientpip install git+https://github.com/reddy-sh/mcp-hub - mcp-live-events 🐍 🏠 (⭐ 2, 🍴 6, 🐛 4) - MCP Server for interacting with live music events
pythonmcpserverpip install git+https://github.com/mmmaaatttttt/mcp-live-events - mcp-luno 🐍 🏠 (⭐ 2) - mcp server for luno (Python-based)
pythonmcpserverpip install git+https://github.com/amanasmuei/mcp-luno - illumio-mcp-server 🐍 🏠 (⭐ 2, 🍴 7, 🐛 2) - The first MCP server for cybersecurity
pythonmcpserverpip install git+https://github.com/alexgoller/illumio-mcp-server - k8s-mcp-server 🐍 🏠 (⭐ 2) - K8s MCP Server (Python-based)
pythonk8s-mcp-serverkubernetes-mcpkubernetes-mcp-servermcp-serverpip install git+https://github.com/chinnareddy578/k8s-mcp-server - mcp-openmetadata 🐍 🏠 (⭐ 2, 🍴 2) - mcp-openmetadata (Python-based)
pythonmcppip install git+https://github.com/pfldy2850/mcp-openmetadata - Notetaker-MCP-Server 🐍 🏠 (⭐ 2) - MCP server with tools for manipulating notes and support for Claude desktop
pythonmcpserverpip install git+https://github.com/Dr-Aniekan-Udo/Notetaker-MCP-Server - onvif-mcp 🐍 🏠 (⭐ 2) - 基于ONVIF协议的设备控制MCP (Python-based)
pythonmcppip install git+https://github.com/qianlima365/onvif-mcp - pokemon-mcp 🐍 🏠 (⭐ 2) - MCP server for pokemon information
pythonmcpserverpip install git+https://github.com/Zenith-Mind/pokemon-mcp - police-uk-api-mcp-server 📜 🏠 (⭐ 2, 🍴 2, 🐛 2) - official MCP TypeScript SDK server providing tools to access and interact with the police.uk API, offering data on crimes, police forces, neighbourhoods, and stop-and-search incidents.
javascriptclaudecrime-datafastmcpmcp-servernpm install dwain-barnes/police-uk-api-mcp-server - prometeo-mcp 🐍 🏠 📇 (⭐ 2, 🍴 3, 🐛 1) - A MCP Server for Prometeo API
pythonbetamcpmcp-serverserverpip install git+https://github.com/prometeoapi/prometeo-mcp - pymcp-sse 🐍 🏠 (⭐ 2) - Asynchronous Python library for building Model Context Protocol (MCP) servers and clients over HTTP/SSE, ideal for AI agents, tool integrations, and chatbot ecosystems.
pythonmcpserveraihttppip install git+https://github.com/rvirgilli/pymcp-sse - polarsteps-mcp 🐍 🏠 📇 (⭐ 2, 🍴 1, 🐛 1) - An unofficial Polarsteps MCP Server enabling models to interact with the Polarsteps API
pythonmcp-servermcpserverapipip install git+https://github.com/remuzel/polarsteps-mcp - python-base-mcp-server 🐍 🏠 (⭐ 2, 🍴 1) - A cookiecutter template for quickly bootstrapping a Python-based MCP server.
pythoncookiecutter-templatemcp-servermcpserverpip install git+https://github.com/tjmaynes/python-base-mcp-server - reaper-daw-mcp-server 🐍 🏠 (⭐ 2) - AI Music Co-Producer for REAPER DAW
pythonaipip install git+https://github.com/Aavishkar-Kolte/reaper-daw-mcp-server - search-engine-with-rag-and-mcp 🐍 🏠 (⭐ 2, 🍴 2, 🐛 2) - MCP Server supported search engine
pythonmcpserverpip install git+https://github.com/arkeodev/search-engine-with-rag-and-mcp - spotify-mcp 🐍 🏠 (⭐ 2, 🍴 1) - Spotify Model Context Protocol server for creating playlists
httpmlgitgithubpythonpip install git+https://github.com/belljustin/spotify-mcp - StockSense_MCP_Server 🐍 🏠 📇 (⭐ 2, 🍴 1) - A real-time stock market insights platform powered by an MCP server that aggregates news, sentiment, trends, and research from multiple sources using scraping tools and LLMs helping investors make informed, actionable decisions with a comprehensive view of stock performance and market movement.
pythonmcpserverapillmpip install git+https://github.com/danula-rathnayaka/StockSense_MCP_Server - sse-mcp-and-langchain-client-example 🐍 🏠 📇 (⭐ 2, 🍴 1) - Example project demonstrating how to expose FastAPI endpoints as Model Context Protocol (MCP) tools using
fastapi-mcp. Includes a basic LangChain agent (langchain_client.py) that connects to the local FastAPI server via HTTP/SSE usinglangchain-mcp-adaptersto discover and use the exposed tools.pythonmcpserverapiaipip install git+https://github.com/SDCalvo/sse-mcp-and-langchain-client-example - swemo-mcp 🐍 🏠 (⭐ 2, 🐛 5) - An MCP Server for Riksbank data (monetary policy, SWEA, SWESTR)
pythonmcpserverpip install git+https://github.com/aerugo/riksbank-mcp - tm1mcp 🐍 🏠 (⭐ 2) - MCP server for TM1 (Python-based)
pythonmcpserverpip install git+https://github.com/andreyea/tm1mcp - todoist-mcp-python 🐍 🏠 (⭐ 2, 🍴 5, 🐛 3) - MCP Server for Todoist in Python
pythonmcpserverpip install git+https://github.com/Johnxjp/todoist-mcp-python - tool-gating-mcp 🐍 🏠 (⭐ 2, 🍴 3) - Implements a tool gating and discovery system to preserve LLM context and focus while having access to many MCP servers
pythonmcpserverllmpip install git+https://github.com/ajbmachon/tool-gating-mcp - ton-mcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 1) - This MCP Server allows you to interact with the TON Blockchain
typescriptaiclaude-aimcpmcp-servernpm install kriuchkov/ton-mcp - twolven_mcp-server-puppeteer-py 🐍 🏠 (⭐ 2, 🍴 1) - Mirror of https://github.com/twolven/mcp-server-puppeteer-py
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/twolven_mcp-server-puppeteer-py - unifi-mcp-server 🐍 🏠 (⭐ 2, 🍴 2) - An MCP Server for interacting with Unifi networks.
pythonmcpserverpip install git+https://github.com/mikecutalo/unifi-mcp-server - upstox-mcp-server 🐍 🏠 📇 (⭐ 2, 🍴 2) - MCP Server for interacting with Upstox APIs
pythonmcpserverapipip install git+https://github.com/adibhattar95/upstox-mcp-server - yisu201506_mcp_server 🐍 🏠 (⭐ 2, 🍴 2) - Mirror of https://github.com/yisu201506/mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/yisu201506_mcp_server - safe-mcp-manager 🏠 (⭐ 2) - SafeMCP is an MCP tooling manager with simplicity and safety built in for your AI tools and Agents.
aiai-toolsclaudecursormcpgit clone https://github.com/openshieldai/safe-mcp-manager - zionfhe_mcp_server_test 🐍 🏠 (⭐ 2) - mcp server based on the new homomorphic encryption technology "ZionFHE"
pythonaifhesafetymcppip install git+https://github.com/joyecai/zionfhe_mcp_server_test - leave_manager_mcp 🐍 🏠 📇 (⭐ 2, 🍴 1) - A minimal MCP server providing a structured API for a simple leave management system.
pythonmcpserverapipip install git+https://github.com/Jay-Vala/leave_manager_mcp - mcp-openai-image-generation 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - MCP Server for openai image generation
pythonimage-generationmcpopenaiserverpip install git+https://github.com/ai-zerolab/mcp-openai-image-generation - mcp-search-analytics 🐍 🏠 (⭐ 2) - MCP server for GA and GSC data analysis
pythonmcpserverpip install git+https://github.com/dexter480/mcp-search-analytics - mcp-vulnerabilities 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - An exploration of common MCP server vulnerabilities, along with a deep dive into MCP server prompt injection (+demonstrations for each!).
pythonmcpserverpip install git+https://github.com/Tomby68/mcp-vulnerabilities - mcp-server 📜 🏠 (⭐ 2, 🍴 1) - A Proof of Concept for a MCP Server that lets LLM connect with BayernCloud Tourismus
pythonmcpserverjavascriptllmpip install git+https://github.com/SaanidhyaM/mcp-server - mcpcfc 🏠 (⭐ 2, 🍴 1) - A Remote Model Context Protocol (MCP) server for ColdFusion, enabling CFML applications to connect with Claude and other AI assistants.
coldfusioncoldfusion-mcp-ai-claude-anthropicmcpserveraigit clone https://github.com/revsmoke/mcpcfc - Model-Context-Protocol-MCP-Demo-with-langchain-MCP-ADAPTERS-Ollama 🐍 🏠 (⭐ 2) - Demo of implementation of MCP using Langchain MCP Adapters and Ollama
pythongenerative-ailangchain-pythonmcpmcp-serverpip install git+https://github.com/Ginga1402/Model-Context-Protocol-MCP-Demo-with-langchain-MCP-ADAPTERS-Ollama - MCP-Server 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - Lightweight programs that each expose specific capabilities through the standardized Model Context Protocol
pythonpip install git+https://github.com/akramsheriff5/MCP-Server - mcp-server-sample 🐍 🏠 (⭐ 2) - MCP Server Sample (Python-based)
pythonmcpserverpip install git+https://github.com/antonioscapellato/mcp-server-sample - mongodb-mcp-bridge 🐍 🏠 (⭐ 2) - A powerful Model Context Protocol (MCP) server implementation for MongoDB integration
pythonmcpservermongodbgopip install git+https://github.com/syedasad-kiwi/mongodb-mcp-bridge - notehub_mcp_server 🐍 🏠 📇 (⭐ 2) - MCP Server Implementation of the Blues Notehub API
pythonmcpserverapipip install git+https://github.com/blues/notehub_mcp_server - numpy-mcp 🐍 🏠 (⭐ 2, 🍴 2, 🐛 2) - A Model Context Protocol (MCP) server for numerical computations with NumPy
pythonaianthropicclaudemcppip install git+https://github.com/colesmcintosh/numpy-mcp - ollama-mcp-chat 🐍 🏠 (⭐ 2, 🍴 1) - Ollama MCP Chat is a desktop chatbot application that integrates Ollama's local LLM models with MCP (Model Context Protocol) servers
pythonmcpserverllmpip install git+https://github.com/godstale/ollama-mcp-chat - onesignal-mcp 🐍 🏠 📇 (⭐ 2, 🍴 3, 🐛 2) - A Model Context Protocol (MCP) server for interacting with the OneSignal API
pythonmcpserverapipip install git+https://github.com/WeirdBrains/onesignal-mcp - Saqr-MCP 🐍 🏠 (⭐ 2) - Saqr-MCP is a powerful Python application that implements the Model Context Protocol (MCP) to enable advanced AI assistant capabilities. It supports both local models through Ollama and cloud models through Groq, providing a flexible client-server architecture
pythonmcpserveraipip install git+https://github.com/ahmedhassan456/Saqr-MCP - scenext-mcp 🐍 🏠 (⭐ 2, 🍴 2, 🐛 2) - scenext官方mcp服务器 (Python-based)
pythonmcppip install git+https://github.com/typing233/scenext-mcp - sec-mcp 🐍 🏠 (⭐ 2) - A Python toolkit providing security checks for domains, URLs, IPs, and more. Integrate easily into any Python application, use via terminal CLI, or run as an MCP server to enrich LLM context with real-time threat insights.
pythonmcp-serversecurity-toolsmcpserverpip install git+https://github.com/Montimage/sec-mcp - quarkus-mcp-agentic 🏠 (⭐ 2, 🍴 2) - This project uses Quarkus and the Model Context Protocol] to implement a simple agentic app using multiple MCP servers and Quarkus + LangChain4j.
htmlmcpserveraigit clone https://github.com/jamesfalkner/quarkus-mcp-agentic - simple-mcp-sample 🐍 🏠 (⭐ 2, 🍴 1) - This repository demonstrates how to set up and implement basic MCP server that integrates with Claude Desktop.
pythonmcpserverpip install git+https://github.com/edom18/simple-mcp-sample - Simple-MCP-Server 🐍 🏠 (⭐ 2) - A simple MCP server that can be tested with a client
pythonmcpserverpip install git+https://github.com/marlinspike/Simple-MCP-Server - tracxn-mcp 🐍 🏠 📇 (⭐ 2, 🍴 1) - A Model Control Protocol (MCP) server implementation for interacting with the Tracxn API
pythonmcpserverapipip install git+https://github.com/vatsal191201/tracxn-mcp - universal-public-data-mcp-server 🐍 🏠 📇 (⭐ 2, 🍴 1) - Universal Public Data MCP Server with real API integrations for financial, government, scientific, news, geographic, and technology data
pythonmcpserverapigopip install git+https://github.com/inamdarmihir/universal-public-data-mcp-server - watsonx-mcp-server 🐍 🏠 (⭐ 2, 🍴 1) - How to create a professional, production‑ready chatbot server powered by IBM Watsonx.ai and exposed via the Model Context Protocol (MCP) Python SDK.
pythonmcpserveraipip install git+https://github.com/ruslanmv/watsonx-mcp-server - Yevanchen_difyapp_as_mcp_server 🐍 🏠 (⭐ 2, 🍴 2) - Mirror of https://github.com/Yevanchen/difyapp_as_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Yevanchen_difyapp_as_mcp_server - yt-mcp-server 🐍 🏠 (⭐ 2) - MCP server with various utility functions for dealing with youtube data
pythonmcpserverpip install git+https://github.com/kdr/yt-mcp-server - z3_mcp 🐍 🏠 (⭐ 2) - An MCP server for the z3 theorem prover
pythonmcpserverpip install git+https://github.com/javergar/z3_mcp - aliyun-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - This MCP server provides tools for interacting with Aliyun (Alibaba Cloud) services.
javascriptaliyun-sdkllmmcpmcp-servernpm install nailuoGG/aliyun-mcp-server - CbetaMCP 🐍 🏠 (⭐ 2) - CbetaMCP (Python-based)
pythonmcppip install git+https://github.com/tendayspace/cbetamcp - cloudera-ai-agent-studio-mcp 🐍 🏠 (⭐ 2, 🍴 1) - MCP Server for driving Cloudera AI's Agent Studio
pythonmcpserveraipip install git+https://github.com/jasonmeverett/cloudera-ai-agent-studio-mcp - cursor-mcp-guide 🏠 (⭐ 2) - A comprehensive guide to setting up and using MCP server with Cursor IDE, including GitHub integration and AI agent configuration.
mcpserveraigit clone https://github.com/md-anbari/cursor-mcp-guide - DingTalkMCPServer 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - Provide MCP Server private skills for DingTalk AI Agent
pythonmcpserveraipip install git+https://github.com/MiechalZhao/DingTalkMCPServer - easy-mcp 🐍 🏠 (⭐ 2) - Use MCP servers with OpenAI Agents
pythonmcpserveraipip install git+https://github.com/WillChangeThisLater/easy-mcp - gmail-sender-mcp 🐍 🏠 (⭐ 2, 🍴 1, 🐛 2) - An MCP server for sending Gmail emails via Claude or other AI assistants
pythonmcpserveraipip install git+https://github.com/abhishekloiwal/gmail-sender-mcp - eget_mcp 🐍 🏠 📇 (⭐ 2) - A simple MCP server that integrates eGet web scraper with Claude for Desktop. This connector allows Claude to scrape web content through your local eGet API, enabling search, summarization, and analysis of websites directly in conversations.
pythonmcpserverapiwebpip install git+https://github.com/vishwajeetdabholkar/eget_mcp - file-edit-check-server 🏠 (⭐ 2, 🍴 1) - MCP server that enforces pre-read checks and detailed commit documentation
mcpserveraidocumentationgit clone https://github.com/punkpeye/file-edit-check-server - jgrants-mcp-server 🐍 🏠 📇 (⭐ 2, 🍴 1) - Jグランツ(デジタル庁が運営する国や自治体の補助金電子申請システム)の公開APIを利用した MCP Server
pythonmcpserverapipip install git+https://github.com/rtoki/jgrants-mcp-server - loonghao_wecom-bot-mcp-server 🐍 🏠 (⭐ 2, 🍴 2) - Mirror of https://github.com/loonghao/wecom-bot-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/loonghao_wecom-bot-mcp-server - malloy-mcp-server 🐍 🏠 (⭐ 2) - An MCP Server for interacting with Malloy data models through the Malloy Publisher
pythonmcpserverpip install git+https://github.com/namabile/malloy-mcp-server - mcp_demo 🐍 🏠 (⭐ 2) - Demo: mcp protocol with simple client and server file
pythonmcpserverpip install git+https://github.com/josx/mcp_demo - mcp_weather 🐍 🏠 📇 (⭐ 2, 🍴 3) - MCP Server 和风天气API例子。
pythonmcpserverapipip install git+https://github.com/xuezhijian/mcp_weather - mcp-local-spec 🏠 (⭐ 2) - MCP Servers discovery spec
anthropicmcpmcp-serveropenaispecgit clone https://github.com/jonnyzzz/mcp-local-spec - mcp-agentis 🐍 🏠 (⭐ 2, 🍴 1) - Python framework for creating AI agents that use MCP servers as tools. Compatible with any MCP server and model provider.
pythonmcpserveraipip install git+https://github.com/AgentisLabs/mcp-agentis - mcp-azresource 🐍 🏠 (⭐ 2, 🍴 1, 🐛 2) - Python-based
pythonpip install git+https://github.com/tim10002/mcp-azresource - mcp-chat-system 🐍 🏠 (⭐ 2) - AI-powered Chat System with multiple MCP servers.
pythonmcpserveraipip install git+https://github.com/kira1228/MCP-RAG- - MCP-Email-Verify 🐍 🏠 📇 (⭐ 2, 🍴 3, 🐛 4) - A lightweight Model Context Protocol (MCP) server that enables your LLM to validate email addresses. This tool checks email format, domain validity, and deliverability using the AbstractAPI Email Validation API. Perfect for integrating email validation into AI applications like Claude Desktop.
pythonmcpserverapiaipip install git+https://github.com/Abhi5h3k/MCP-Email-Verify - mcp-ephemeral-k8s 🐍 🏠 📇 (⭐ 2, 🐛 4) - Python implementation to spawn ephemeral Model Context Protocol (MCP) servers using the kubernetes API.
pythonmcpserverapikubernetespip install git+https://github.com/BobMerkus/mcp-ephemeral-k8s - mcp-crontab-server 🐍 🏠 (⭐ 2) - A MCP Server exposing tools for fetching entries and viewing logs
pythonmcpserverpip install git+https://github.com/jasona7/mcp-crontab-server - mcp-server-example-v2 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - A simple example of a Model Context Protocol Server implementation
pythonserverpip install git+https://github.com/dabouelhassan/mcp-server-example-v2 - mcp-server-software 🐍 🏠 (⭐ 2, 🍴 3) - A Model Context Protocol server that provides software management capabilities for your computer.
pythonserverpip install git+https://github.com/DumoeDss/mcp-server-software - nnquant_qmt-mcp-server 🐍 🏠 (⭐ 2) - Mirror of https://github.com/nnquant/qmt-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/nnquant_qmt-mcp-server - Woo-mcp-server 🐍 🏠 (⭐ 2, 🍴 2) - wocommarce mcp server
pythonmcpserverpip install git+https://github.com/Slava12233/Woo-mcp-server - dicom-mcp-server 🐍 🏠 (⭐ 2, 🍴 2, 🐛 1) - A server for managing contextual data in DICOM tools, supporting medical imaging and machine learning workflows.
pythonserverpip install git+https://github.com/fluxinc/dicom-mcp-server - mcp-hitchcode 🐍 🏠 (⭐ 2, 🍴 3, 🐛 2) - Python-based
pythonpip install git+https://github.com/jankowtf/mcp-hitchcode - neodb-mcp 🐍 🏠 (⭐ 2, 🍴 6, 🐛 3) - A Message Control Protocol (MCP) server implementation for interacting with NeoDB
pythonmcpserverhttppip install git+https://github.com/xytangme/neodb-mcp - python-run-mcp 🐍 🏠 (⭐ 2, 🍴 2) - MCP server implementation for handling run_python requests
pythonmcpserverpip install git+https://github.com/topherbc/python-run-mcp - wayne-mcp-servers 🐍 🏠 (⭐ 2, 🍴 1) - My custom MCP (Model Context Protocol) servers.
pythonmcpserverpip install git+https://github.com/wangyendt/wayne-mcp-servers - apstra-mcp-server 🐍 🏠 📇 (⭐ 1, 🍴 2) - Python script to test Model Context Protocol (MCP) server for Juniper's Apstra Fabric manager's APIs.
pythonmcpserverapipip install git+https://github.com/vignitin/apstra-mcp-server - artemis-mcp 🐍 🏠 (⭐ 1, 🍴 6, 🐛 5) - Artemis MCP Server Repo
pythonmcpserverpip install git+https://github.com/Artemis-xyz/artemis-mcp - barnsworthburning-mcp 📘 🏠 (⭐ 1, 🍴 5, 🐛 2) - A Model Context Protocol (MCP) server for searching barnsworthburning.net.
typescriptaillmsmcpmcp-servernpm install Aias/barnsworthburning-mcp - binoculo-mcp 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - Banner grabbing with LLM (MCP Server)
pythonbugbountyclaude-aillmmcp-serverpip install git+https://github.com/girorme/binoculo-mcp - blockchain-payment-mcp 🐍 🏠 (⭐ 1) - 区块链支付MCP服务器 - 支持多链操作包括以太坊、Base、BSC、Polygon、Avalanche和Solana
pythonmcpgopip install git+https://github.com/logos-42/blockchain-payment-mcp - homebrew-age-mcp-server 🐍 🏠 (⭐ 1, 🍴 3, 🐛 3) - Apache AGE MCP Server
pythonmcpserverpip install git+https://github.com/rioriost/homebrew-age-mcp-server - ckanext-mcp 🐍 🏠 (⭐ 1, 🍴 1) - An MCP server to answer questions about data
pythonmcpserverpip install git+https://github.com/unckan/ckanext-mcp - claude-client-gmail-mcp 🐍 🏠 (⭐ 1) - Acceso de asistentes de IA a Gmail mediante Model Context Protocol (MCP)
pythonmcpaipip install git+https://github.com/FranciscoYuster/gmail-client-mcp-server - JexinSam_mssql_mcp_server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/JexinSam/mssql_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/JexinSam_mssql_mcp_server - mcp_server_project 🐍 🏠 (⭐ 1, 🐛 11) - Model Context Protocol server
pythonserverpip install git+https://github.com/donohue76/mcp_server_project - agentcraft-mcp 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - AgentCraft MCP Server
pythonmcpserverpip install git+https://github.com/seyhunak/agentcraft-mcp - ajbr0wn_gmail-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/ajbr0wn/gmail-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/ajbr0wn_gmail-mcp-server - aks-mcp-server 🐍 🏠 (⭐ 1) - playing around with mcp servers and aks
pythonmcpserverpip install git+https://github.com/chokevin/aks-mcp-server - arxiv-semantic-search-mcp 🐍 🏠 (⭐ 1) - Python-based
pythonpip install git+https://github.com/icyclv/arxiv-semantic-search-mcp - itinerary-mcp-server 🐍 🏠 📇 (⭐ 1) - FastAPI-based travel itinerary system with MCP integration for AI-powered discovery, filtering, and creation of travel plans via natural language.
pythonmcpapiaipip install git+https://github.com/aryanranderiya/itinerary-mcp-server - Machine-To-Machine_m2m-mcp-server-ssh-client 🐍 🏠 (⭐ 1) - Mirror of https://github.com/Machine-To-Machine/m2m-mcp-server-ssh-client
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Machine-To-Machine_m2m-mcp-server-ssh-client - mcp-baserow 📘 🏠 (⭐ 1, 🍴 4, 🐛 1) - MCP server for Baserow API integration - Enable AI assistants to interact with Baserow databases
typescriptaiapi-clientautomationbaserownpm install ayyazzafar/mcp-baserow - MCP-Launchpad 🐍 🏠 (⭐ 1) - 🚀 MCP-Launchpad: Your one-stop hub for easily deployable MCP servers! 🐳 Dockerized & (A2A) AI-agent ready. Launch powerful tools for your AI in minutes. ✨
pythonmcpserveraidockerpip install git+https://github.com/LNDMN/MCP-Launchpad - apm-mcp-server 🐍 🏠 (⭐ 1) - アジャイルプラクティスマップのナレッジと対話するためのMCPサーバーです。
pythonmcppip install git+https://github.com/HappymanOkajima/apm-mcp-server - ariadng_metatrader-mcp-server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/ariadng/metatrader-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ariadng_metatrader-mcp-server - cloudbrain-mcp 🐍 🏠 (⭐ 1, 🍴 1) - This repository will contain code specific to MCP servers associated with various DevOps tools and technologies.
pythonmcpserveraipip install git+https://github.com/structbinary/cloudbrain-mcp - coingecko-mcp 🐍 🏠 (⭐ 1) - CoinGecko MCP Server - Enabling AI Agent to Autonomously Fetch Data.
pythonmcpserveraipip install git+https://github.com/Blockchain-MCPs/coingecko-mcp - ezib-mcp 🐍 🏠 (⭐ 1) - MCP server built on ezib_async that exposes Interactive Brokers' trading and market data functionality.
pythonmcpserverpip install git+https://github.com/kelvingao/ezib-mcp - filemaker_mcp_local 🐍 🏠 (⭐ 1, 🍴 1) - Local dynamic mcp server for FileMaker databases
pythonmcpserverdatabasepip install git+https://github.com/mw777eds/filemaker_mcp_local - gCalendar-mcp-python 🐍 🏠 (⭐ 1) - MCP Google Calendar Server with python
pythonmcpservergopip install git+https://github.com/tobedoit/gCalendar-mcp-python - git-prompts-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - An MCP server that offers several commands to generate prompts based on the Git repository's content
pythonmcpserverpip install git+https://github.com/ceshine/git-prompts-mcp-server - mcp-server-minecraft-mod-devdoc 🐍 🏠 (⭐ 1, 🍴 1) - Model Context Protocol (MCP) Server for Minecraft Modding Documentation
pythonmcpserverdocumentationpip install git+https://github.com/Zhou-Shilin/mcp-server-minecraft-mod-devdoc - mcp-server-wuye-ai 🏠 (⭐ 1, 🍴 2, 🐛 1) - CRIC物业AI MCP Server
agentaimcpmcp-serverproperty-managementgit clone https://github.com/wuye-ai/mcp-server-wuye-ai - openweather-mcp 🐍 🏠 (⭐ 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/frostming/openweather-mcp - pagos-mcp 🐍 🏠 📇 (⭐ 1, 🍴 2) - Pagos Official MCP Server
pythonmcpservergoapipip install git+https://github.com/pagos-ai/pagos-mcp - colpali_mcp_server 🐍 🏠 (⭐ 1, 🍴 1) - mcp server for Colpali (text-rich images) retrieval
pythonmcpserverpip install git+https://github.com/camillebrl/colpali_mcp_server - devnagriai-translate-mcp 📜 🏠 (⭐ 1, 🐛 2) - MCP server for translation services with focus on Indic languages, Powered by Devnagri AI
javascriptaidevnagridevnagri-aiindic-languagesnpm install DevnagriAI/devnagriai-translate-mcp - connect-server 🐍 🏠 (⭐ 1) - MCP server to connect users
pythonmcpserverpip install git+https://github.com/Danejw/connect-server - crossplane-mcp-server 🐍 🏠 (⭐ 1) - mcp server for Crossplane
pythonmcpserverpip install git+https://github.com/cychiang/crossplane-mcp-server - docker-mcp 🐹 🏠 (⭐ 1, 🍴 1) - Docker MCP: A Model Context Protocol implementation for Docker operations, enabling AI assistants to seamlessly manage containers, images, and networks via standardized JSON-RPC interface.
goai-toolsanthropicclinecontainersgo install coolbit-in/docker-mcp@latest - DROMA_MCP 🐍 🏠 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server for DROMA (Drug Response Omics association MAp) - enabling natural language interactions with drug-omics association analysis.
pythonmcpserverpip install git+https://github.com/mugpeng/DROMA_MCP - end2end-mcp 🐍 🏠 (⭐ 1) - End-to-end MCP workflow
pythonmcppip install git+https://github.com/AbnerTeng/shioaji-mcp - enkryptai_enkryptai-mcp-server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/enkryptai/enkryptai-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/enkryptai_enkryptai-mcp-server - fdp-mcp-server 🐍 🏠 (⭐ 1, 🐛 1) - QAX XLab fdp mcp server
pythonmcpserverpip install git+https://github.com/qax-xlab/fdp-mcp-server - file-system-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - A comprehensive MCP (Model Context Protocol) server for file system operations, providing Claude and other AI assistants with access to local files and directories.
pythonmcpserveraipip install git+https://github.com/calebmwelsh/file-system-mcp-server - fm-mcp-comfyui-bridge 🐍 🏠 (⭐ 1, 🍴 1) - LLM MCP server for image generation with ComfyUI
pythonmcpserverllmpip install git+https://github.com/rerofumi/fm-mcp-comfyui-bridge - google-places-mcp 📘 🏠 📇 (⭐ 1, 🍴 1) - MCP server for google places API
typescriptaigoogle-maps-apimcp-servermcpnpm install manavsiddharthgupta/google-places-mcp - groq-mcp-client 🐍 🏠 (⭐ 1) - A free MCP client server that leverages GroqCloud's high-performance inference capabilities and connects to both local and remote MCP servers.
pythoncli-appfreegroqgroqcloudpip install git+https://github.com/YeshwanthSadum/groq-mcp-client - abhiemj_manim-mcp-server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/abhiemj/manim-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/abhiemj_manim-mcp-server - axisdirect-rapidapi-mcp 🐍 🏠 📇 (⭐ 1) - This MCP (Model Context Protocol) server wraps the AxisDirect API via RapidAPI, exposing Get Profile, Get Order Book, Order History, etc.,
pythonmcpserverapipip install git+https://github.com/abhaybraja/axisdirect-rapidapi-mcp - azure-community-mcp-servers 🏠 (⭐ 1, 🍴 2) - This directory showcases various Model Context Protocol (MCP) servers. These servers enable Large Language Models (LLMs) to securely access tools and data sources from Microsoft Azure.
aiazurecontainersllmmcpgit clone https://github.com/manekinekko/azure-mcp-servers - checkpoint-security-mcp-servers 🐍 🏠 (⭐ 1) - Anthropic MCP servers to enable AI agent integration and autonomous defense for Check Point firewalls, endpoint, and more.
pythonmcpserveraipip install git+https://github.com/ngardiner/checkpoint-security-mcp-servers - Claude-MCP-tools 🐍 🏠 (⭐ 1, 🍴 1) - Repo of Claude Desktop MCP tools
pythonmcppip install git+https://github.com/GrimFandango42/Claude-MCP-tools - HuggingAGI_mcp-baostock-server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/HuggingAGI/mcp-baostock-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/HuggingAGI_mcp-baostock-server - kachaka-mcp 🐍 🏠 (⭐ 1, 🐛 1) - Kachaka MCP Server - Model Context Protocol server for Kachaka robot
pythonmcpserverpip install git+https://github.com/comoc/kachaka-mcp - ILHealth-mcp 🐍 🏠 📇 (⭐ 1, 🍴 2) - MCP server providing access to Israeli Ministry of Health data dashboard APIs.
pythonmcpserverapipip install git+https://github.com/david-aftergut/ILHealth-mcp - kanvas_mcp 🐍 🏠 (⭐ 1, 🐛 1) - Kanvas MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/bakaphp/kanvas_mcp - kenliao94_mcp-server-rabbitmq 🐍 🏠 (⭐ 1) - Mirror of https://github.com/kenliao94/mcp-server-rabbitmq
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/kenliao94_mcp-server-rabbitmq - kickstart-mcp 🐍 🏠 (⭐ 1, 🐛 1) - 🚀 Kickstart-mcp is tutorial for using mcp, making your own mcp server/client. We'll guide you through every step of your MCP journey
pythonmcpmcp-clientmcp-servermodel-context-protocolpip install git+https://github.com/nolleh/kickstart-mcp - liana-mcp 🐍 🏠 (⭐ 1) - Natural language interface for scRNA-Seq analysis with Liana through MCP
pythonmcppip install git+https://github.com/scmcphub/liana-mcp - llm-mcp 🐍 🏠 (⭐ 1, 🍴 1) - llm plugin of MCP for clients and servers.
pythonmcpserverllmpip install git+https://github.com/genomoncology/llm-mcp - mcp_agribalyse 🐍 🏠 📇 (⭐ 1) - MCP Server of Agribalyse API
pythonmcpserverapipip install git+https://github.com/tracy040401/mcp_agribalyse - mcp_interactive_terminal 🐍 🏠 (⭐ 1) - MCP server for interacting with a terminal or process based command over stdio.
pythonmcpserverpip install git+https://github.com/danielp370-msft/mcp_interactive_terminal - mcp_playground 🐍 🏠 (⭐ 1) - MCP Server 示例 (Python-based)
pythonmcpserverpip install git+https://github.com/AndyM129/mcp_playground - mcp_python_server 🐍 🏠 (⭐ 1, 🐛 12) - Ansible MCP Server for intelligent infrastructure management
pythonmcpserverpip install git+https://github.com/washyu/mcp_python_server - mcp-linker-api 🐍 🏠 📇 (⭐ 1, 🍴 1) - MCP-Linker Backend API with Supabase Authentication integration.
pythonmcpapiauthpip install git+https://github.com/milisp/mcp-linker-api - mcp-ncbi-fetcher 🐍 🏠 (⭐ 1) - docker-based mcp server that enables Claude to fetch biological sequence data from NCBI
pythonmcpserverdockerpip install git+https://github.com/actual-awg/mcp-ncbi-fetcher - MCP_Servers 🐍 🏠 (⭐ 1) - Tutorial on MCP Servers - Personalized Finance Assistant
pythonmcpserverpip install git+https://github.com/papihaj/MCP_Servers - MCP_WOW 🏠 (⭐ 1) - MCP SERVER IMPLEMENTATION
htmlmcpservergit clone https://github.com/Tech8Tales/MCP_WOW - mcp-cobot-server 🐍 🏠 (⭐ 1) - Model Context Protocol for MyCobot280
pythonpip install git+https://github.com/cluesang/mcp-cobot-server - jmh108_MCP-server-readability-python 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/jmh108/MCP-server-readability-python
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jmh108_MCP-server-readability-python - langchain-mcp 🐍 🏠 (⭐ 1) - LangChain Agent with MCP Servers: Using LangChain MCP Adapters for tool integration.
pythonmcpserveraipip install git+https://github.com/esakrissa/langchain-mcp - make-a-simple-mcp-server 🐍 🏠 (⭐ 1) - 本项目旨在构建一个本地智能舆情分析系统,通过自然语言处理与多工具写作,实现用户查询意图的自动理解、新闻检索、情绪分析、结构化输出与邮件推送。
pythonpip install git+https://github.com/JLQusername/make-a-simple-mcp-server - mcp-coverity 🐍 🏠 (⭐ 1) - Make AI agent support coverity issue fix
pythonaipip install git+https://github.com/louisfghbvc/mcp-servers - mcp-doc 🐍 🏠 (⭐ 1, 🍴 2, 🐛 2) - Model Context Protocol documentation server for LangGraph and MCP.
pythonmcpserverdocumentationpip install git+https://github.com/esakrissa/mcp-doc - MCP-Docker 🐍 🏠 (⭐ 1) - Dockerized MCP server environments for seamless agent-tool integration.
pythonmcpservermldockerpip install git+https://github.com/ysys143/MCP-Docker - mcp-local 🐍 🏠 (⭐ 1) - Simulating Multiple Context Protocol
pythonllmsmcp-servermemorysimulationpip install git+https://github.com/mc095/mcp-local - mcp-odbc 🐍 🏠 (⭐ 1, 🍴 2, 🐛 1) - MCP server for connecting clients like Claude Desktop to ODBC data sources
pythonmcpserverpip install git+https://github.com/tylerstoltz/mcp-odbc - mcp-openGauss 🐍 🏠 (⭐ 1, 🐛 1) - MCP Server for openGauss database and its tools
pythonmcpserverdatabasepip install git+https://github.com/vincentsunx/mcp-openGauss - pavanjava_kafka_mcp_server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/pavanjava/kafka_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/pavanjava_kafka_mcp_server - phalcon-mcp 🐍 🏠 (⭐ 1, 🍴 1, 🐛 2) - 一个用于执行 Phalcon 5.0.x 框架命令的 Model Context Protocol (MCP) 服务器
pythonmcppip install git+https://github.com/xindong888999/phalcon-mcp - ProcmonMCP 🐍 🏠 (⭐ 1) - An MCP server for procmon files
pythonmcpserverpip install git+https://github.com/JameZUK/ProcmonMCP - PyMCP-FS 🐍 🏠 (⭐ 1, 🍴 1, 🐛 2) - This is a robust Python-based MCP Filesystem Server. It enables AI models and applications to securely interact with the host system's file directories through a defined set of tools, allowing for operations like reading, writing, moving, and listing files and directories.
pythonmcpserveraipip install git+https://github.com/hypercat/PyMCP-FS - python-mcp-server-template 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - A template repository for Python MCP Servers
pythonaillmmcpmcp-serverpip install git+https://github.com/FidelusAleksander/python-mcp-server-template - resume-mcp 🐍 🏠 (⭐ 1) - An MCP server for assistance during job search.
pythonmcpserverpip install git+https://github.com/aarangop/resume-mcp - Salesforce-MCP 🐍 🏠 (⭐ 1, 🍴 1) - MCP Server for Salesforce Operations
pythonclaude-aigithub-copilotmcpmcp-serverpip install git+https://github.com/suraj20028/Salesforce-MCP - sample-mcp-server-tos 🐍 🏠 (⭐ 1, 🍴 5, 🐛 3) - Python-based
pythonhttpgitgithubpip install git+https://github.com/dinghuazhou/sample-mcp-server-tos - skysql-mcp 🐍 🏠 (⭐ 1, 🍴 3, 🐛 1) - SkySQL MCP server and client repository.
pythonmcpserverhttpaipip install git+https://github.com/skysqlinc/skysql-mcp - ssh-connect-mcp-server 🐍 🏠 (⭐ 1, 🍴 2) - An MCP server for SSH connections and file operations.
pythonmcpserverpip install git+https://github.com/t-suganuma/ssh-connect-mcp-server - StepFunMCP 🐍 🏠 📇 (⭐ 1, 🍴 1) - 基于阶跃星辰API的MCP server
pythonmcpserverapipip install git+https://github.com/weidafeng/StepFunMCP - upbit-mcp-sse 🐍 🏠 (⭐ 1, 🍴 1) - mcp sse 를 지원하는 upbit server
pythonmcpserverpip install git+https://github.com/restful3/upbit-mcp-sse - wuwa-mcp-server 🐍 🏠 (⭐ 1, 🍴 2, 🐛 1) - A MCP server providing character info query for wuthering waves
pythonmcpserverpip install git+https://github.com/jacksmith3888/wuwa-mcp-server - MCP-Reasoner 📘 🏠 (⭐ 1) - Model Context Protocol (MCP) server implementation using Google OR-Tools for constraint solving
httpaigitgithubtypescriptnpm install MCP-Reasoner/MCP-Reasoner - mcp-reddit-digest 🐍 🏠 📇 (⭐ 1) - A FastAPI-based MCP server tool that fetches and summarizes top Reddit posts using Azure OpenAI. It generates a daily PDF digest and uploads it to Slack, with support for topic-based subreddits and scheduled jobs.
pythonmcpserverapiaipip install git+https://github.com/omendra02/mcp-reddit-digest - mcp-server 🐍 🏠 (⭐ 1, 🍴 4) - Python-based
pythonpip install git+https://github.com/aekanun2020/mcp-server - mcp-server-baige 🐍 🏠 (⭐ 1) - 一个 MCP 服务器,提供基于百鸽查游戏王卡的工具
pythonmcppip install git+https://github.com/liggest/mcp-server-baige - mcp-server-claude 🐍 🏠 📇 (⭐ 1) - setting up a mcp server tool to search the latest documents via Serper API
pythonmcpserverapipip install git+https://github.com/tzujohsu/mcp-server-claude - mcp-server-eks 🐍 🏠 (⭐ 1) - Demo eks mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/jbrcoleman/mcp-server-eks - mcp-server-example 🐍 🏠 (⭐ 1) - Example MCP server implementation for weather data with testing and pre-commit setup
pythonmcpservertestingpip install git+https://github.com/mindsightventures/mcp-server-example - mcp-server-isitdown 🐍 🏠 (⭐ 1, 🍴 5, 🐛 1) - An MCP server that checks if a website is currently down by querying the website https://www.isitdownrightnow.com
pythonisitdownmcpmcp-serverserverpip install git+https://github.com/hesreallyhim/mcp-server-isitdown - mcp-server-musicxml 🏠 (⭐ 1) - MCP server for MusicXML references.
mcpservermlgit clone https://github.com/Ossamoon/mcp-server-musicxml - mcp-todo 📘 🏠 📇 (⭐ 1) - API de gerenciamento de tarefas via WebSocket com execução modular de comandos e suporte a ferramentas, desenvolvida em TypeScript com banco SQLite. Projetada para integração com agentes de inteligência artificial.
typescriptagentagentic-aiaiajvnpm install br-silvano/mcp-todo - muckrock-mcp 🐍 🏠 (⭐ 1, 🍴 1) - Highly experimental, insecure, and unstable MuckRock FOIA MCP Server with 20+ tools for filing, tracking, and managing Freedom of Information Act requests
pythonmcpserverpip install git+https://github.com/morisy/muckrock-mcp - mcp-server-kusto 🐍 🏠 (⭐ 1, 🍴 3, 🐛 2) - A mcp server that uses azure data explorer as a backend
pythonmcpserverazurepip install git+https://github.com/ZZZHDW/mcp-server-kusto - mcp-ssh-server 🐍 🏠 (⭐ 1) - MCP SSH server for Windsurf integration
pythonmcpserverpip install git+https://github.com/yoi-hibino/mcp-ssh-server - mcp-tutorial 🐍 🏠 (⭐ 1, 🍴 1) - A practical demonstration of the Model Context Protocol (MCP)
pythonmcppip install git+https://github.com/agenteer/mcp-tutorial - MCPLite 🐍 🏠 (⭐ 1) - MCP client/server framework from scratch
pythonmcpserverpip install git+https://github.com/acesanderson/MCPLite - mealserver 🐍 🏠 (⭐ 1) - A server that provides meal-related information through MCP tools
pythonmcpserverpip install git+https://github.com/D-C2211/mealserver - megacloud-mcp 🐍 🏠 (⭐ 1) - Model Context Protocol (MCP) Server for MegaCloud.
pythonmcpserverpip install git+https://github.com/megaease/megacloud-mcp - mlb_mcp 🐍 🏠 (⭐ 1, 🍴 1) - MCP server to fetch basic (and complex!) baseball-related stats.
pythonbaseballmcpserverpip install git+https://github.com/jweingardt12/mlb_mcp - MSPaint-MCP-Server 🐍 🏠 (⭐ 1) - A simple Model Context Protocol (MCP) server client code to solve math problems and show the solution in MSPaint application
pythonmcpserveraipip install git+https://github.com/shettysaish20/MSPaint-MCP-Server - multi-mcp 🐍 🏠 (⭐ 1) - An MCP server that proxies multiple MCP servers.
pythonmcpmcp-serverserverpip install git+https://github.com/One-MCP/multi-mcp - multiplexermcp 🐍 🏠 (⭐ 1) - demo multiplexing mcp servers
pythonmcpserverpip install git+https://github.com/promptmesh/multiplexermcp - my-mcp-servers 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - this is mcp servers in local
pythonmcpserverpip install git+https://github.com/yuki-koma2/my-mcp-servers - MyDevMCP 🐍 🏠 (⭐ 1, 🍴 1, 🐛 2) - A collection of Model Context Protocol (MCP) servers providing various integrations and capabilities for MCP-compatible clients like Claude Desktop, VS Code, and other AI applications.
pythonclaude-desktopmcp-servermodel-context-protocolvscodepip install git+https://github.com/AnalyticAce/MyMCP - nsaf-mcp-server 🐍 🏠 (⭐ 1, 🍴 2, 🐛 3) - The Neuro-Symbolic Autonomy Framework integrates neural, symbolic, and autonomous learning methods into a single, continuously evolving AI agent-building system. This prototype demonstrates the SCMA component, which enables AI agents to self-design new AI agents using Generative Architecture Models.
pythonagentaibndagentsneural-networkpip install git+https://github.com/ariunbolor/nsaf-mcp-server - pco-mcp 🐍 🏠 (⭐ 1) - Planning Center Online MCP Server
pythonmcpserverpip install git+https://github.com/jake-ccnh/pco-mcp - openreplay-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server for analyzing OpenReplay session recordings and user behavior patterns
pythonmcpserverpip install git+https://github.com/rsp2k/openreplay-mcp-server - opensearch-mcp-integration 🏠 (⭐ 1) - Step by step guide for integrating LLMs with OpenSearch MCP servers
yamlmcpserverllmgit clone https://github.com/madhankb/opensearch-mcp-integration - openshift-backplane-mcp-server 🐍 🏠 (⭐ 1) - MCP server providing Managed OpenShift infra access via Backplane
pythonmcpserverpip install git+https://github.com/mmazur/openshift-backplane-mcp-server - orkl_mcp_server 🐍 🏠 (⭐ 1, 🐛 1) - MCP server for ORKL Threat Intelligence Library
pythonmcpserverpip install git+https://github.com/heiths/orkl_mcp_server - PeMCP 🐍 🏠 (⭐ 1) - An comprehensive MCP Server for PE File Analysis
pythonmcpserverpip install git+https://github.com/JameZUK/PeMCP - plex-mcp 🐍 🏠 (⭐ 1, 🍴 3, 🐛 2) - Plex MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/djbriane/plex-mcp - Postgres_MCP_Server 🐍 🏠 (⭐ 1) - FastMCP Based MCP Server to Control Postgres
pythonmcpserverpostgrespip install git+https://github.com/VivekMalipatel/Postgres_MCP_Server - postgreSQL-analyzer-mcp 🐍 🏠 (⭐ 1, 🍴 3, 🐛 1) - PostgreSQL performance analysis and optimization MCP server
pythonmcpserverpostgrespip install git+https://github.com/rameshv29/postgres-performance-mcp - pure-model-context-protocol 🐍 🏠 (⭐ 1, 🍴 4) - A simple MCP server to interact with Pure storage arrays
pythonmcpservergit clone https://github.com/jboothomas/pure-model-context-protocol - pydantic-ai-mcp-experiment 🐍 🏠 (⭐ 1, 🍴 1) - Minimalist examples to provide your own MCP servers to your local llm models.
pythonmcpserverllmpip install git+https://github.com/eschmidt42/pydantic-ai-mcp-experiment - pp_mcp_adk 🐍 🏠 (⭐ 1) - The commerce-centric demo shown live at Paypal Dev Days 2025 on 4/29. Featuring Paypal Agent Toolkit & MCP server with Google's Agent Development Kit (ADK)
pythonadkmcppaypalserverpip install git+https://github.com/gkcng/pp_mcp_adk - qanon-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Model Context Protocol server for sociological research into QAnon
pythonserverpip install git+https://github.com/jkingsman/qanon-mcp-server - serial-mcp 🐍 🏠 (⭐ 1, 🍴 1) - MCP server allowing Agents to talk to devices connected to serial port of the computer. Tested only with MAC atm.
pythonmcpserverpip install git+https://github.com/PaDev1/serial-mcp - SwarmUI_MCP_Agent 🐍 🏠 (⭐ 1, 🍴 1) - A simple prototype SwarmUI MCP server with accompanying local LangChain Ollama agent
pythonmcpserveraipip install git+https://github.com/MathewTomberlin/SwarmUI_MCP_Agent - tavily-mcp-sse 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - Basic remote SSE MCP server for Tavily Search.
pythonagentic-aiai-agentsmcpmcp-serverpip install git+https://github.com/NoeSamaille/tavily-mcp-sse - topoteretes_cognee-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/topoteretes/cognee-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/topoteretes_cognee-mcp-server - xai-mcp 🐍 🏠 (⭐ 1, 🍴 1) - A Xircuits component library for defining MCP servers.
pythonmcpserverpip install git+https://github.com/XpressAI/xai-mcp - YuChenSSR_mindmap-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/YuChenSSR/mindmap-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/YuChenSSR_mindmap-mcp-server - mcp-browser-use-tools 🐍 🏠 (⭐ 1, 🍴 1) - This package vendors a subset of browser-use with minimal dependencies exposed as an mcp-server.
pythonmcpserverhttppip install git+https://github.com/phact/mcp-browser-use-tools - mcp-cases 🏠 (⭐ 1, 🍴 1) - MCP Cases is a format that allows to specify how your MCP Server behaves for various automations
htmlmcpservergit clone https://github.com/strowk/mcp-cases - mcp-label-studio 🐍 🏠 (⭐ 1, 🍴 1) - mcp server for label studio
pythonmcpserverpip install git+https://github.com/lxkaka/mcp-label-studio - 611711Dark_mcp_calculate_server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/611711Dark/mcp_calculate_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/611711Dark_mcp_calculate_server - agenticMCP_rag 🐍 🏠 (⭐ 1) - Rag with MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/rajagopal17/agenticMCP_rag - Arxivloader-MCP-Server-and-Client 🐍 🏠 (⭐ 1) - This project provides an MCP (Microservice Communication Protocol) server and client setup for fetching research papers from the arXiv. The MCP server processes queries and fetches relevant research papers, while the client communicates with the server using the MCP protocol.
pythonmcpserverpip install git+https://github.com/alihassanml/Arxivloader-MCP-Server-and-Client - azure-native-isv-mcp 🏠 (⭐ 1, 🍴 2, 🐛 2) - This repository contains a Remote Model Context Protocol (MCP) Server implemented using Azure Functions, built for enabling tooling support across Azure Native ISV Integrations. It includes MCP tools for Azure-integrated partner services listed under Azure Partner Solutions
mcpserveraiazuregit clone https://github.com/Azure/azure-native-isv-mcp - AzureDevOpsAPI/Azure-DevOps 📘 🏠 📇 (⭐ 1, 🐛 2) - Facilitates AI-driven interactions with Azure DevOps APIs, enabling seamless project management and DevOps workflows through natural language commands.
apihttpazureaiml - awesome-ads-mcp-servers 🏠 📇 (⭐ 1) - Awesome AdsMCP servers – standardizing ad APIs via Anthropic’s Model Context Protocol.
mcpserverapigit clone https://github.com/AdsMCP/awesome-ads-mcp-servers - aws-common-mcp-servers 🐍 🏠 📇 (⭐ 1) - Deployable MCP Servers for common AWS services (Location, S3, Aurora PG Data API) using AWS CDK.
pythonmcpserverapiawspip install git+https://github.com/vAirpower/aws-common-mcp-servers - brewfather-mcp 🐍 🏠 (⭐ 1, 🍴 2, 🐛 2) - MCP server to access Brewfather
pythonmcpserverpip install git+https://github.com/renanvieira/brewfather-mcp - cloudflare-ai-mcp 🐍 🏠 📇 (⭐ 1) - A Model Context Protocol (MCP) server for Cloudflare's AI API that enables advanced image generation capabilities. \ This package provides a robust interface for generating images using multiple Stable Diffusion models simultaneously, \ with features including AI-powered prompt generation, batch operations, and comprehensive error handling.
pythonmcpserverapiaipip install git+https://github.com/topmcp/cloudflare-ai-mcp - cnosdb-mcp-server 🐍 🏠 (⭐ 1, 🍴 2, 🐛 3) - An MCP server for CnosDB.
pythonmcpserverpip install git+https://github.com/cnosdb/cnosdb-mcp-server - designcomputer_mysql_mcp_server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/designcomputer/mysql_mcp_server
pythonmcpserverhttpmysqlpip install git+https://github.com/MCP-Mirror/designcomputer_mysql_mcp_server - disler_aider-mcp-server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/disler/aider-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/disler_aider-mcp-server - dockerized-mcp-server-template 🐍 🏠 (⭐ 1, 🍴 4) - A reusable Dockerized Python server template implementing the Model Context Protocol (MCP) with Streamable HTTP transport, built using the official MCP Python SDK (v1.8.0+) for easy integration with Large Language Models (LLMs).
pythonmcpserverllmhttppip install git+https://github.com/zantis/dockerized-mcp-server-template - eventbrite-mcp-server 📜 🏠 📇 (⭐ 1) - Model Context Protocol server for Eventbrite API integration. Create and manage events using natural language through AI agents like Claude Desktop and Cursor IDE.
javascriptaiapiclaudecursornpm install joshuachestang/eventbrite-mcp-server - didlogic_mcp 🐍 🏠 (⭐ 1, 🍴 5, 🐛 3) - Python-based
pythonhttpgitgithubpip install git+https://github.com/UserAd/didlogic_mcp - docret-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server
pythonmcpserverpip install git+https://github.com/Sreedeep-SS/docret-mcp-server - Duckduckgo-with-MCP 🐍 🏠 (⭐ 1) - This project demonstrates how to use DuckDuckGo MCP Server with a LangChain Groq LLM agent to perform intelligent search tasks via MCP (Micro Component Protocol).
pythonduckduckgomcp-servermcpserverpip install git+https://github.com/alihassanml/Duckduckgo-with-MCP - ExcelMCP 🏠 (⭐ 1) - An MCP server for AI to control Microsoft excel application.
mcpserveraigit clone https://github.com/OfficeMCP/ExcelMCP - farzad528_mcp-server-azure-ai-agents 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/farzad528/mcp-server-azure-ai-agents
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/farzad528_mcp-server-azure-ai-agents - FastMCP-Proper 🐍 🏠 (⭐ 1) - Python MCP server with CI/CD tooling and testability built-in
pythonmcpserverhttpgitpip install git+https://github.com/Acid-base/FastMCP-Proper - bright8192_esxi-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/bright8192/esxi-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/bright8192_esxi-mcp-server - cheerlights-mcp 🐍 🏠 📇 (⭐ 1, 🍴 2, 🐛 2) - MCP server that allows AI tools to interact with the CheerLights API.
pythonaicheerlightsclaude-aimcppip install git+https://github.com/cheerlights/cheerlights-mcp - ckreiling_mcp-server-docker 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/ckreiling/mcp-server-docker
pythonmcpserverhttpdockerpip install git+https://github.com/MCP-Mirror/ckreiling_mcp-server-docker - hello-mcp 🐍 🏠 (⭐ 1) - A Simple MCP Demo With Client & Server
pythonmcpserverpip install git+https://github.com/Cookie-HOO/hello-mcp - claude-mcp-mouse-controle 🐍 🏠 (⭐ 1) - Python-based
pythonpip install git+https://github.com/DamienMarill/claude-mcp-mouse-controle - feishu-bot-mcp-server 🐍 🏠 (⭐ 1, 🍴 1, 🐛 5) - A Python server implementation for Feishu (Lark) bot that follows the Model Context Protocol (MCP). This server provides a standardized interface for handling automated messaging and context-aware interactions within enterprise Feishu environments.
pythonmcpserverpip install git+https://github.com/loonghao/feishu-bot-mcp-server - hjlarry_dify-plugin-mcp_server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/hjlarry/dify-plugin-mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/hjlarry_dify-plugin-mcp_server - hostbridge-mcp 🐍 🏠 (⭐ 1, 🍴 2, 🐛 3) - MCP server for simplified framework deployments on shared hosting environments
pythonmcpserverpip install git+https://github.com/elblanco2/hostbridge-mcp - irtoolshed-mcp-server 🐍 🏠 (⭐ 1) - an MCP server providing tools for network incident response folks
pythonmcpserverpip install git+https://github.com/rossja/irtoolshed-mcp-server - langchain-mcp-chat-platform 🐍 🏠 (⭐ 1) - A versatile chat platform that integrates LangChain, custom MCP servers, and various AI models for enhanced chat capabilities.
pythonmcpserveraipip install git+https://github.com/BilalAltundag/langchain-mcp-chat-platform - lenwood_cfbd-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/lenwood/cfbd-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/lenwood_cfbd-mcp-server - maccam912_searxng-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/maccam912/searxng-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/maccam912_searxng-mcp-server - MCP_Hackathon_docs 🏠 (⭐ 1) - Read the docs Documentation for the MIT decentralized AI, MCP hackathon
htmlaidecentralizedhackathonmcpgit clone https://github.com/aidecentralized/MCP_Hackathon_docs - MCP_Servers 🐍 🏠 (⭐ 1) - This repository offers MCP servers for different purposes, aiming to support developers who want to build similar systems.
pythonmcpserveraipip install git+https://github.com/DannyyLC/MCP_Servers - mcp-clamav 🐍 🏠 (⭐ 1, 🍴 1) - ClamAV MCP Server to scan files for viruses
pythonmcpserverpip install git+https://github.com/a2amarket/mcp-clamav - mcp-core 🐍 🏠 (⭐ 1) - Foundational backend for MCP infrastructure.
pythonaiartificial-intelligencedockermcppip install git+https://github.com/brunosantoslab/mcp-core - mcp-msgraph 🐍 🏠 (⭐ 1, 🍴 1) - A prototype MCP server which reads a user profile from Microsoft Graph.
pythonmcpserverpip install git+https://github.com/kevinbellinger/mcp-msgraph - mcp-demo 🐍 🏠 (⭐ 1) - A simplest MCP system implemented in Python, including a client and several servers.
pythonmcpserverpip install git+https://github.com/heureux831/mcp-demo - MCP-Demo 🐍 🏠 (⭐ 1) - This project is a simple vibe coded example of how an MCP Server could return a tool to the requesting client.
pythonmcpserverpip install git+https://github.com/srivatssan/MCP-Demo - mcp-devps-hub 🐍 🏠 (⭐ 1) - MCP server for end-to-end development visibility (Jira, GitHub, CI/CD, etc.)
pythonmcpserverhttpgitpip install git+https://github.com/SBDI/mcp-devps-hub - mcp-terraform-assistant 🐍 🏠 (⭐ 1, 🍴 2) - An MCP server for managing infrastructure as code using Terraform
pythonmcpserverhttpgitpip install git+https://github.com/guilhermeyoshida/mcp-terraform-assistant - mcp-terraform-aws-provider-docs 📘 🏠 (⭐ 1) - Deno/TypeScript MCP Server providing context related to the AWS provider for Terragrunt documentation.
httpawsaigitgithubnpm install Excoriate/mcp-terraform-aws-provider-docs - mcp-terraform-python 🐍 🏠 (⭐ 1) - MCP server to run terraform operations locally
pythonmcpserverlocalhttppip install git+https://github.com/westonplatter/mcp-terraform-python - mcp-weather-alert-tool 🐍 🏠 📇 (⭐ 1) - A Python MCP (Model Context Protocol) server that fetches real-time weather alerts by U.S. state using api.weather.gov, built with FastMCP and integrated into Claude Desktop.
pythonmcpserverapigopip install git+https://github.com/nahilahmed/mcp-weather-alert-tool - mcpRAG 🐍 🏠 (⭐ 1) - rag using Ollama as emebddings, gemini as LLM and MCP server for agentic use
pythonmcpserverllmpip install git+https://github.com/rajagopal17/mcpRAG - MCPs-and-ADKs 🐍 🏠 (⭐ 1) - MCP server and AI agents
pythonmcpserveraipip install git+https://github.com/thidaskaveesha/MCPs-and-ADKs - MSPaint-MCP-Server-V2 🐍 🏠 (⭐ 1) - Using Advanced AI Prompting to enhance LLM planning to solve complex math problems and draw the answer on MSPaint Canvas
pythonaillmpip install git+https://github.com/shettysaish20/MSPaint-MCP-Server-V2 - n8n-node-mcp-server 📜 🏠 (⭐ 1) - MCP server for accessing N8N node information through Claude Desktop
javascriptai-toolsautomationclaudemcpnpm install ari-json/n8n-node-mcp-server - mcp-remote-call-ping-pong 🏠 (⭐ 1, 🍴 2, 🐛 1) - 🏓 An experimental and educational script for Ping-pong server demonstrating remote MCP (Model Context Protocol) calls
htmlfastapifastmcpmcpmcp-clientgit clone https://github.com/kimtth/mcp-fastapi-ping-pong - mcp-scraper-engine 🐍 🏠 📇 (⭐ 1) - Basic MCP Server for Web Scraping
pythonmcpserverapiwebpip install git+https://github.com/un4ckn0wl3z/mcp-scraper-engine - MCP-server 🐍 🏠 (⭐ 1, 🍴 1) - My attempt at an MCP server for dbSNP.
pythonmcpserverpip install git+https://github.com/mattshu0410/MCP-server - Mcp-Server_OpenAI-Chat 📘 🏠 📇 (⭐ 1, 🍴 1) - AI-powered todo assistant with Google Calendar integration using OpenAI's API and Model Context Protocol (MCP) support for natural language task management.
typescriptaillmmcpapinpm install mertadali/Mcp-Server_OpenAI-Chat - mcp-server-aws 🐍 🏠 (⭐ 1) - POC : MCP server with openAI agents SDK
pythonmcpserveraipip install git+https://github.com/anirban1592/mcp-server-aws - mcp-server-count-r- 🐍 🏠 (⭐ 1) - Simple MCP Server to count char "r"
pythonmcpserverpip install git+https://github.com/ma3u/mcp-server-count-r- - mcp-server-hcp-terraform 🐍 🏠 (⭐ 1, 🍴 1) - MCP server for working with HCP Terraform
pythonmcpserverhttpaipip install git+https://github.com/dulltz/mcp-server-hcp-terraform - mcp-server-weather-forecast 🐍 🏠 (⭐ 1) - Get weather forecasts using an AI agent and an MCP server.
pythonmcpserveraipip install git+https://github.com/hitechdk/mcp-server-weather-forecast - mcp-server-youtube 🐍 🏠 (⭐ 1) - A Model Context Protocol (MCP) server enabling interaction with YouTube (search, video details) from compatible host applications like Claude for Desktop, Cursor, Windurf.
pythonmcpserveraipip install git+https://github.com/davo20019/mcp-server-youtube - mcp-servers 🏠 (⭐ 1) - Curated lists of mcp servers to use with ai agents or claude desktop
mcpserveraigit clone https://github.com/Abdssamie/mcp-servers - mcp-qa-example 🐍 🏠 (⭐ 1) - Model Context Protocol (MCP) 開發的範例,用於與 Langflow 文檔問答系統進行交互。它允許您直接在 Claude 中查詢 Langflow 應用,並獲取回應。
pythonmcppip install git+https://github.com/jell0720/mcp-qa-example - mcp-server-weather-python 🐍 🏠 (⭐ 1, 🍴 2) - a mcp server for get weather.use python
pythonmcpserverpip install git+https://github.com/yestarz/mcp-server-weather-python - mcp-solana-internet 🐍 🏠 📇 (⭐ 1) - Solana-based micropayment server using MCP. 💰 Facilitates direct SOL transfers for resource access control via a Flask API. 🔑 Returns solana-action: URIs for unsigned transactions, validated on-chain. ✅ Includes robust transaction checks, resource pricing, and basic access management. 🧪
pythonmcpserverapiaipip install git+https://github.com/waifuai/mcp-solana-internet - mysql_mcpserver_stdio_sse 🐍 🏠 (⭐ 1) - 批量生成基于mysql数据库的mcpserver,支持stdio传输。Generate MCP servers in batch based on MySQL database, supporting stdio transmission.
pythonmcpserverdatabasemysqlpip install git+https://github.com/lanjunfei/mysql_mcpserver_stdio - mysql-mcp-server-sse 🐍 🏠 (⭐ 1, 🍴 1) - Servidor de Consultas MySQL baseado em MCP com suporte a SSE e segurança avançada
pythonmcpmysqlpip install git+https://github.com/fersoftware/mysql-mcp-server-sse - neosapience_typecast-api-mcp-server-sample 🐍 🏠 📇 (⭐ 1) - Mirror of https://github.com/neosapience/typecast-api-mcp-server-sample
pythonmcpserverapihttppip install git+https://github.com/MCP-Mirror/neosapience_typecast-api-mcp-server-sample - notebook_mcp 🐍 🏠 (⭐ 1) - mcp server for your personal notes
pythonmcpserverpip install git+https://github.com/redthing1/notebook_mcp - nps-explorer-mcp-server 📘 🏠 📇 (⭐ 1, 🍴 1, 🐛 2) - A Model Context Protocol (MCP) server on Cloudflare Workers, letting you query APIs for park overviews, trails, alerts, events, weather forecasts, and more via simple tool calls from your LLM of choice.
typescriptaimcp-servermodelcontextprotocolmcpnpm install Kyle-Ski/nps-explorer-mcp-server - openapi-integrator-mcp 📜 🏠 📇 (⭐ 1) - Node.js-based
apihttpaiopenaigitnpm install slot181/openapi-integrator-mcp - mcp-vercel-server 🐍 🏠 (⭐ 1) - An MCP Compliant Server that defines 9 tools for working with Vercel deployment data.
pythonmcpserverpip install git+https://github.com/jasona7/mcp-vercel-server - mcp-voice 🏠 (⭐ 1) - MCP-Server for Voice AI with OpenAI
mcpserveraigit clone https://github.com/mario-andreschak/mcp-voice - mcp-wait 🐍 🏠 (⭐ 1, 🍴 1) - Test MCP Server for Waiting
pythonmcpserveraipip install git+https://github.com/7shi/mcp-wait - mcp-wikipedia 🐍 🏠 (⭐ 1) - A simple MCP Server in Python for working with Wikipedia topic content in a GenAI context
pythongenerative-aillmmcpmcp-serverpip install git+https://github.com/danbunnell/mcp-wikipedia - OpenTorah-ai_mcp-sefaria-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/OpenTorah-ai/mcp-sefaria-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/OpenTorah-ai_mcp-sefaria-server - oras-mcp 📘 🏠 (⭐ 1, 🍴 3, 🐛 2) - ORAS MCP Server (TypeScript-based)
typescriptaiartifactmcpocinpm install shizhMSFT/oras-mcp - prometheus-mcp 🐍 🏠 📇 (⭐ 1, 🍴 3, 🐛 2) - MCP server to connect LLMs with Prometheus HTTP API
pythonmcpserverapillmpip install git+https://github.com/etruong42/prometheus-mcp - pox-mcp-server 🐍 🏠 (⭐ 1, 🍴 6, 🐛 4) - A Model Context Protocol (MCP) server for the POX SDN controller
pythonmcpserverhttpgitpip install git+https://github.com/davidlin2k/pox-mcp-server - qhdrl12_mcp-server-gemini-image-generator 🐍 🏠 (⭐ 1) - Mirror of https://github.com/qhdrl12/mcp-server-gemini-image-generator
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/qhdrl12_mcp-server-gemini-image-generator - quran_cloud_mcp_server 🐍 🏠 📇 (⭐ 1, 🍴 2, 🐛 1) - MCP server to help LLMs to get access to Quran API (https://alquran.cloud/api).
pythonmcpserverapillmpip install git+https://github.com/marwanWaly/quran_cloud_mcp_server - ragflow_mcp_server 🐍 🏠 (⭐ 1, 🐛 1) - A mcp server to retrieve documents from ragflow
pythonmcpserverpip install git+https://github.com/xiangmy21/ragflow_mcp_server - simple-mcp-ollama-bridge 🐍 🏠 (⭐ 1, 🍴 1) - A Simple bridge from Ollama to a fetch url mcp server
pythonmcpserverpip install git+https://github.com/virajsharma2000/simple-mcp-ollama-bridge - sdkman-mcp 🐍 🏠 (⭐ 1) - A Model Context Protocol (MCP) server for SDKMAN. Can help you execute the SDK from any command line.
pythonmcpserverpip install git+https://github.com/ocean-zhc/sdkman-mcp - rednote_mcp 🐍 🏠 (⭐ 1, 🍴 1) - MCP Server for the Rednote(xiaohongshu), supporting various operations.
pythonmcpserverpip install git+https://github.com/wuzufeng/rednote_mcp - scaflog-zoho-mcp-server 🐍 🏠 (⭐ 1, 🍴 4, 🐛 4) - MCP Server for Scaflog Zoho Creator App
pythonmcpserverpip install git+https://github.com/mastercode-io/scaflog-zoho-mcp-server - simple_mcp_server_with_langgraph 🐍 🏠 (⭐ 1, 🍴 1) - Simple MCP server with Langgraph.
pythonmcpserverpip install git+https://github.com/EunsuGoh/simple_mcp_server_with_langgraph - simple-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 2) - A simple TypeScript library for creating MCP servers.
typescriptaimcpmodel-context-protocolservernpm install ribeirogab/simple-mcp - Sivan22_mcp-sefaria-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/Sivan22/mcp-sefaria-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Sivan22_mcp-sefaria-server - SMMS_Semantic-Map-MCP-Server 🐍 🏠 (⭐ 1) - The repository SMMS creates an MCP server for instance-level semantic maps and provides a series of functional modules for 3D instance objects in semantic maps.
pythonmcpserverpip install git+https://github.com/yongzhouwangbowen/SMMS_Semantic-Map-MCP-Server - spotify_mcp 🐍 🏠 (⭐ 1, 🐛 1) - Python-based
pythonpip install git+https://github.com/Naunau75/spotify_mcp - spotify-mcp 🐍 🏠 (⭐ 1) - A simple python spotify mcp server
pythonmcpservergotypescriptpip install git+https://github.com/254binaryninja/spotify-mcp - stela-mcp 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - MCP server for local system operations
pythonmcpserverpip install git+https://github.com/Sachin-Bhat/stela-mcp - SuperMapMCP 🐍 🏠 (⭐ 1) - MCP Client和Server, 实现shapefile导入到数据库。
pythonmcpserverpip install git+https://github.com/liyq0307/SuperMapMCP - tamagotchi-mcp-server 🐍 🏠 (⭐ 1) - 實作簡易的 Tamagotchi MCP Server,模擬電子雞遊戲
pythonmcpservergopip install git+https://github.com/wai-imyen/tamagotchi-mcp-server - template-mcp-server 🐍 🏠 (⭐ 1) - PDM template for developing an MCP server
pythonmcpserverpip install git+https://github.com/pdm-project/template-mcp-server - toio-mcp 🐍 🏠 (⭐ 1, 🐛 2) - toio-mcp is a MCP server for toio™
pythonmcpserverpip install git+https://github.com/comoc/toio-mcp - weather-my-mcp 🐍 🏠 📇 (⭐ 1, 🍴 3) - Model Context Protocol (MCP) server that provides weather information from Malaysia Government's Open API
pythonagentmcpweatherserverpip install git+https://github.com/yting27/weather-my-mcp - whoami-mcp 🐍 🏠 (⭐ 1, 🍴 3, 🐛 2) - A lightweight MCP server that tells you exactly who you are.
pythonmcpserverpip install git+https://github.com/kukapay/whoami-mcp - wifi-mcp-server 🐍 🏠 (⭐ 1) - MCP server demo for Wi-Fi queries on Linux distros
pythonmcpserverpip install git+https://github.com/krish2718/wifi-mcp-server - mcp0 🔷 🏠 (⭐ 1, 🍴 1) - Secure MCP (Model Context Protocol) servers configurator/inspector/proxy with hot reload support. Configure once, reuse with any MCP client.
c#aihot-reloadllmmcpgit clone https://github.com/ins0mniaque/mcp0 - timetagger-mcp 🐍 🏠 (⭐ 1, 🐛 2) - A MCP server for the timetagger tool, allowing you to start, stop timers and get reports directly from your MCP Client
pythonmcpserverpip install git+https://github.com/regismesquita/timetagger-mcp - tpc-server 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - Thoughts Plans Changelog is an MCP compliant server for coding with AI agents
pythonmcpserveraipip install git+https://github.com/suttonwilliamd/tpc-server - yunqiqiliang_mcp-clickzetta-server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/yunqiqiliang/mcp-clickzetta-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/yunqiqiliang_mcp-clickzetta-server - MCP-for-VuFind 🐍 🏠 (⭐ 1) - a simple MCP Server for VuFind
pythonmcpserverpip install git+https://github.com/jaohbib/MCP-for-VuFind - mcp-config-manager 🐍 🏠 (⭐ 1, 🍴 1) - This package provides functionality to manage MCP server configurations for different clients like Cline and Claude Desktop.
pythonmcpserverpip install git+https://github.com/easytocloud/mcp-config-manager - mcp-dice 🐍 🏠 (⭐ 1, 🍴 6, 🐛 2) - A MCP server enabling LLMs to roll dice
pythonmcpserverllmpip install git+https://github.com/yamaton/mcp-dice - mcp-example 🐍 🏠 (⭐ 1) - Model Context Protocol Example (Server & Client)
pythonserverpip install git+https://github.com/buraketmen/mcp-example - mcp-gnews 🐍 🏠 (⭐ 1, 🍴 3) - MCP server to give client the ability to searching related news on the internet
pythonmcpserverpip install git+https://github.com/algonacci/mcp-gnews - mcp-histfile 🐍 🏠 (⭐ 1, 🍴 2, 🐛 2) - An MCP(Model Context Protocol) Server for retrieving and sharing your bash/zsh history with MCP Client (Cursor, Claude etc.)
pythonmcpserverpip install git+https://github.com/rajpdus/mcp-histfile - mcp-llm-sandbox 📘 🏠 (⭐ 1) - Complete sandbox for augmenting LLM inference (local or cloud) with MCP Client-Server. Low friction testbed for MCP Server validation and agentic evaluation.
typescriptllmmcpmcp-clientmcp-servernpm install tmcarmichael/mcp-scaffold - mcp2brave 🐍 🏠 📇 (⭐ 1, 🍴 5, 🐛 3) - 一个MCP服务器,基于Brave API让你的Claude Cline以及Langchain实现网络搜索功能。An MCP server that use Brave API allows your Claude Cline and Langchain to implement network search functions.
pythonmcpserverapiaipip install git+https://github.com/mcp2everything/mcp2brave - nrepl-mcp 🐍 🏠 (⭐ 1, 🍴 2) - simple MCP server for nREPL
pythonmcpserverpip install git+https://github.com/cat-state/nrepl-mcp - X3r0K_BurpSuite-MCP-Server 🐍 🏠 (⭐ 1) - Mirror of https://github.com/X3r0K/BurpSuite-MCP-Server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/X3r0K_BurpSuite-MCP-Server - lalanikarim_comfy-mcp-server 🐍 🏠 (⭐ 1, 🍴 2) - Mirror of https://github.com/lalanikarim/comfy-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/lalanikarim_comfy-mcp-server - mcp-translation-server 🐍 🏠 (⭐ 1, 🍴 2, 🐛 1) - High-performance Manchu-Chinese translation server implementing the Model Context Protocol (MCP)
pythonmcpserverpip install git+https://github.com/KYBvWHxW/mcp-translation-server - tik-tak-toe-mcp 🐍 🏠 (⭐ 1) - Python-based
pythonpip install git+https://github.com/Kvadratni/tik-tak-toe-mcp - youtube-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - MCP server to fetch and extract transcripts from YouTube videos. Enable AI/LLMs to have access to transcripts for further actions like summarize, write blog..
pythonclaudemcpmcp-servermodel-context-protocolpip install git+https://github.com/PrajwalPrashanth/youtube-mcp-server - evangstav_python-memory-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/evangstav/python-memory-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/evangstav_python-memory-mcp-server - mcpd 🐍 🏠 (⭐ 1, 🍴 1, 🐛 2) - Model Context Protocol Daemon - a tool for installing, running and managing MCP servers
pythonmcpmcpdmodel-context-protocolserverpip install git+https://github.com/Pixeladed/mcpd - -Creating-a-MCP-Server-for-Claude-AI-Assistant-to-interact-with-GitHub-and-demonstrate-its-Use- 🏠 - " Creating a MCP Server for Claude AI Assistant to interact with GitHub and demonstrate its Use "
mcpserveraigit clone https://github.com/Preeti75/-Creating-a-MCP-Server-for-Claude-AI-Assistant-to-interact-with-GitHub-and-demonstrate-its-Use- - Bagel 🏠 - ChatGPT for physical data. Troubleshoot your robots and drones with natural language. No fuss.
httpaigitgithub - Agentset AI 🏠 - RAG on your data using MCP protocol
httpaigitgithub - 100-training-of-mcp-servers 🏠 - MCPサーバーを100個作ってみるトレーニング
mcpgit clone https://github.com/Ossamoon/100-training-of-mcp-servers - aind-metadata-mcp 🐍 🏠 - MCP server for AIND metadata
pythonmcpserveraipip install git+https://github.com/AllenNeuralDynamics/aind-metadata-mcp - alibabacloud-dms-mcp-server 🐍 🏠 - A universal multi-cloud data MCP Server supporting over 30 types of data source connections, providing secure, cross-source data access in a single platform.
Supports full range of Alibaba Cloud services and Mainstream databases/data warehouses.
pythonaianalyticsdbclaudeclickhousepip install git+https://github.com/shawaizshabbir/alibabacloud-dms-mcp-server - aiowhitebit-mcp 🐍 🏠 📇 - Message Control Protocol (MCP) server and client implementation for WhiteBit cryptocurrency exchange API. Built on top of aiowhitebit library.
pythonpypi-packagemcpserverapipip install git+https://github.com/doubledare704/aiowhitebit-mcp - alpha-ess-mcp-server 🐍 🏠 - MCP server for your AlphaESS system
pythonmcpserverpip install git+https://github.com/michaelkrasa/alpha-ess-mcp-server - astro_mcp 🐍 🏠 - mcp server for desi and other surveys
pythonmcpserverpip install git+https://github.com/SandyYuan/astro_mcp - analog_circuit_simulate_mcp_server 🐍 🏠 - the mcp server to run circuit simulation with ngspice
pythonmcpserverpip install git+https://github.com/abelzhao/analog_circuit_simulate_mcp_server - aviation_stack_mcp 🐍 🏠 - Python-based
pythonpip install git+https://github.com/mohitatust/aviation_stack_mcp - aws-boto3-mcp-private 🐍 🏠 - AWS Boto3 (Pyton) MCP Server
pythonmcpserverawspip install git+https://github.com/didier-durand/aws-boto3-mcp-private - abhijeetka_mcp-k8s-server 🐍 🏠 - Mirror of https://github.com/abhijeetka/mcp-k8s-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/abhijeetka_mcp-k8s-server - abhishekbhakat_airflow-mcp-server 🐍 🏠 - Mirror of https://github.com/abhishekbhakat/airflow-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/abhishekbhakat_airflow-mcp-server - aider-mcp 📘 🏠 - WebSocket server that exposes Aider's AI coding capabilities through the Model Context Protocol (MCP) for programmatic access
typescriptai-codingaidermcp-servermodel-context-protocolnpm install larock22/aider-mcp - Alertium 🐍 🏠 - Modular server for handling MCP protocol
pythonmcpservergit clone https://github.com/Javoo-bot/mcp_server - HOA-mcp-server 🐍 🏠 - MCP Server to retrieve relevant information from HOA documents
pythonmcpserverpip install git+https://github.com/bloobglob/HOA-mcp-server - aarora79_aws-cost-explorer-mcp-server 🐍 🏠 - Mirror of https://github.com/aarora79/aws-cost-explorer-mcp-server
pythonmcpserverhttpawspip install git+https://github.com/MCP-Mirror/aarora79_aws-cost-explorer-mcp-server - abel9851_mcp-server-mariadb 🐍 🏠 - Mirror of https://github.com/abel9851/mcp-server-mariadb
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/abel9851_mcp-server-mariadb - AdamPippert_multi-service-mcp-server 🐍 🏠 - Mirror of https://github.com/AdamPippert/multi-service-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/AdamPippert_multi-service-mcp-server - Agent-MCP-Math-Draw 🐍 🏠 - Agentic MCP Client Server that solves a math task and draws output in rectangle in a drawing app.
pythonmcpserverawspip install git+https://github.com/movva09/Agent-MCP-Math-Draw - Agent-MCP-Math-Email 🐍 🏠 - Agent with MCP server solves math task and emails the output
pythonmcpserveraipip install git+https://github.com/movva09/Agent-MCP-Math-Email - agently-mcp-hellogoodbye 🐍 🏠 - A simple example MCP server that demonstrates basic tool implementation with hello and goodbye functionality
pythonmcpservergopip install git+https://github.com/onwardplatforms/agently-mcp-hellogoodbye - aip-mcp-server 🐍 🏠 - Secure agentic tool repo with execution environment
pythonpip install git+https://github.com/aipracticegovsg/aip-mcp-server - ai-zerolab_mcp-email-server 🐍 🏠 - Mirror of https://github.com/ai-zerolab/mcp-email-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/ai-zerolab_mcp-email-server - Airbnb-mcp 🐍 🏠 - integrating Airbnb MCP servers with LangChain and Groq using a browser-based interface
pythonmcpserveraipip install git+https://github.com/suvraadeep/Airbnb-mcp - AlekseyKapustyanenko/NihFix.Postgres.Mcp 🔷 🏠 - Facilitates real-time AI agent interactions with PostgreSQL databases using SSE and STDIO protocols.
databasehttppostgresaigit - aliyun_alibabacloud-adb-mysql-mcp-server 🐍 🏠 - Mirror of https://github.com/aliyun/alibabacloud-adb-mysql-mcp-server
pythonmcpserverhttpmysqlpip install git+https://github.com/MCP-Mirror/aliyun_alibabacloud-adb-mysql-mcp-server - aliyun_alibabacloud-hologres-mcp-server 🐍 🏠 - Mirror of https://github.com/aliyun/alibabacloud-hologres-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/aliyun_alibabacloud-hologres-mcp-server - alpaca-mcp 🐍 🏠 📇 - MCP Server for Alpaca Crypto API
pythonmcpserverapipip install git+https://github.com/berlinbra/alpaca-mcp - andi-mcp 🐍 🏠 - My personal MCP server.
pythonmcpserverpip install git+https://github.com/ajerni/andi-mcp - anki-mcp 🐍 🏠 - Anki MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/johwiebe/anki-mcp - aws-athena-mcp-server 🐍 🏠 - AWS Athena MCP Server
pythonmcpserverawspip install git+https://github.com/vipink1203/aws-athena-mcp-server - asr_mcp_server 🐍 🏠 - A Model Context Protocol (MCP) server that provides ASR(Automatic Speech Recognition) capabilities using the whisper engine. This server exposes TTS functionality through MCP tools, making it easy to integrate speech synthesis into your applications.
pythonmcpserverpip install git+https://github.com/vidau-ai/asr_mcp_server - aws-cost-mcp 🐍 🏠 - Python-based
pythonpip install git+https://github.com/CRED-CLUB/aws-cost-mcp - aws-mcp-infra-helper 🐍 🏠 - This creates an MCP server enabling Claude to run security scans on Terraform code, create architecture diagrams of your AWS cloud architectures and execute terraform commands to deploy or modify resources
pythonmcpserverawspip install git+https://github.com/madhurprash/aws-mcp-infra-helper - aws-sample-gen-ai-mcp-server 🐍 🏠 - sample code using gen-ai(bedrock) with mcp-server
pythonmcpserveraipip install git+https://github.com/jikang-jeong/aws-sample-gen-ai-mcp-server - AlphavantageMCPServer 🐍 🏠 - Alphavantage MCP Server
pythonmcpserverpip install git+https://github.com/DonMorr/AlphavantageMCPServer - amidabuddha_unichat-mcp-server 🐍 🏠 - Mirror of https://github.com/amidabuddha/unichat-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/amidabuddha_unichat-mcp-server - anjor_coinmarket-mcp-server 🐍 🏠 - Mirror of https://github.com/anjor/coinmarket-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/anjor_coinmarket-mcp-server - Ankit2533/multi-agenticdeepresearch 🏠 - A multi-agent deep researcher leveraging MCP to orchestrate AI agents for collaborative deep web searches and knowledge synthesis.
webhttpaigitgithub - Ankit2533/research 🏠 - A multi-agent deep researcher leveraging MCP to perform comprehensive web searches with Linkup and CrewAI orchestration.
webhttpaigitgithub - azsap-mcp 🐍 🏠 - Model Context Protocol Server for SAP on Azure Solutions
pythonserverazurepip install git+https://github.com/ArchitectRavi/azsap-mcp - azure-cli-mcp-using-python 🏠 - MCP server to access Azure using az commands.
mcpserverazuregit clone https://github.com/devanshjainms/azure-cli-mcp-using-python - bilka_mcp 🐍 🏠 - MCP Server for BilkaToGo
pythonmcpservergopip install git+https://github.com/KristianSchmidt/bilka_mcp - anshumax_world_bank_mcp_server 🐍 🏠 - Mirror of https://github.com/anshumax/world_bank_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/anshumax_world_bank_mcp_server - bigquery-mcp-server 🐍 🏠 - bigquery mcp server (read only)
pythonmcpserverpip install git+https://github.com/osushinekotan/mcp-servers - bci-mcp 🐍 🏠 - Brain-Computer Interface (BCI) implementation with Model Context Protocol (MCP) for advanced neural signal processing and AI integration
pythonmcpaipip install git+https://github.com/enkhbold470/bci-mcp - bilibili-mcp-server 🐍 🏠 - mcp-server学习 (Python-based)
pythonmcpserverpip install git+https://github.com/LittleSix1/bilibili-mcp-server - HatriGt_hana-mcp-server 🐍 🏠 - Mirror of https://github.com/HatriGt/hana-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/HatriGt_hana-mcp-server - hellokaton_unsplash-mcp-server 🐍 🏠 - Mirror of https://github.com/hellokaton/unsplash-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/hellokaton_unsplash-mcp-server - hellomcp 🐍 🏠 - The minimal Python MCP server implementation with MCP Python SDK.
pythonmcpserverpip install git+https://github.com/bioerrorlog/hellomcp - hot-update-MCP-Server 🐍 🏠 - A hot-update MCP Server demo
pythonmcpserverpip install git+https://github.com/whitejoce/hot-update-MCP-Server - heurist-network_heurist-mesh-mcp-server 🐍 🏠 - Mirror of https://github.com/heurist-network/heurist-mesh-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/heurist-network_heurist-mesh-mcp-server - HarshJ23_deepseek-claude-MCP-server 🐍 🏠 - Mirror of https://github.com/HarshJ23/deepseek-claude-MCP-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/HarshJ23_deepseek-claude-MCP-server - Hawstein_mcp-server-reddit 🐍 🏠 - Mirror of https://github.com/Hawstein/mcp-server-reddit
pythonmcpserverhttpawspip install git+https://github.com/MCP-Mirror/Hawstein_mcp-server-reddit - HelloMCP 🐍 🏠 - A repository for MCP (Model Context Protocol) examples and demos
pythonmcppip install git+https://github.com/hubgetter/HelloMCP - home-assistant-mcp-color 🐍 🏠 - A Model Context Protocol (MCP) integration that enables AI assistants to search for and control Home Assistant devices through natural language commands in Cursor.
pythonmcpaipip install git+https://github.com/tedostrem/home-assistant-mcp-color - hannesrudolph_sqlite-explorer-fastmcp-mcp-server 🐍 🏠 - Mirror of https://github.com/hannesrudolph/sqlite-explorer-fastmcp-mcp-server
pythonmcpserverhttpsqlitepip install git+https://github.com/MCP-Mirror/hannesrudolph_sqlite-explorer-fastmcp-mcp-server - how-to-create-a-MCP-server 🏠 - A guide on creating Model Context Protocol (MCP) servers - explaining the architecture, implementation, and best practices.
mcpserveraigit clone https://github.com/chevonai/how-to-create-a-MCP-server - insights-mcp-server 🐍 🏠 - Red Hat Insights MCP Server POC
pythonmcpserverpip install git+https://github.com/psegedy/insights-mcp-server - InternetSearch-mcp-server 🐍 🏠 - 一个用于联网搜索的MCP服务器 (Python-based)
pythonmcppip install git+https://github.com/mingdedi/Internetsearch-mcp-server - ibrooksSDX_mcp-server-opensearch 🐍 🏠 - Mirror of https://github.com/ibrooksSDX/mcp-server-opensearch
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ibrooksSDX_mcp-server-opensearch - ireland_mcp_server 🐍 🏠 - MCP for Comic Book Database
pythonmcpdatabasepip install git+https://github.com/jeromewoody/ireland_mcp_server - http-sse-mcp-starter 🐍 🏠 - A lightweight implementation of the Model Context Protocol (MCP) server using Server-Sent Events. Features a Wikipedia article parser that converts content to Markdown format. Demonstrates client-server MCP communication over HTTP.
pythonmcpserverhttppip install git+https://github.com/codingaslu/http-sse-mcp-starter - j-archive-mcp 🏠 - A J-Archive MCP server for GitHub Copilot & other AI assistants
htmlmcpserveraigit clone https://github.com/abdyer/j-archive-mcp - hydra-mcp 🐍 🏠 - Just a test project for an intermediate server between endpoints and Claude's MCP
pythonaiclaudemcpserverpip install git+https://github.com/keyboardsmoke/hydra-mcp - hyperscale-mcp 🐍 🏠 - An MCP server for Hyperscale
pythonmcpserverpip install git+https://github.com/adalundhe/hyperscale-mcp - hyperskill-mcp-server 🐍 🏠 - MCP Server to search and access Hyperskill educational content
pythonmcpserverpip install git+https://github.com/vyahhi/hyperskill-mcp-server - image-builder-mcp 🏠 - An MCP server to connect image-builder to an AI/LLM
mcpserveraillmgit clone https://github.com/schuellerf/image-builder-mcp - jira-mcp-server 🐍 🏠 - An experimental MCP server to allow LLMs to interact with Jira
pythonmcpserverllmpip install git+https://github.com/chasepd/jira-mcp-server - jotform-mcp-server 🐍 🏠 📇 - MCP Server for interacting with the Jotform API, generated from the original Python client.
pythonmcpserverapipip install git+https://github.com/The-AI-Workshops/jotform-mcp-server - jaipandya_producthunt-mcp-server 🐍 🏠 - Mirror of https://github.com/jaipandya/producthunt-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/jaipandya_producthunt-mcp-server - jira-mcp 🐍 🏠 - a simple mcp server for querying jira tasks
pythonmcpserverpip install git+https://github.com/chuan-khuna/jira-mcp - JiraMCPServer 🐍 🏠 - A simple protoype of a MCP server for Jira
pythonmcpserverpip install git+https://github.com/harshalmittal4/JiraMCPServer - jszemcp 🐍 🏠 - For MCP Server Development
pythonmcpserverpip install git+https://github.com/Potasio101/jszemcp - jasiekkk/jan-stripe 📘 🏠 ☁️ - Deploy a remote MCP server on Cloudflare Workers without authentication, enabling seamless integration with Cloudflare AI Playground and local MCP clients.
remotelocalauthhttpai - jonemo_openpyxl-mcp-server 🐍 🏠 - Mirror of https://github.com/jonemo/openpyxl-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jonemo_openpyxl-mcp-server - jordy33_iot_mcp_server 🐍 🏠 - Mirror of https://github.com/jordy33/iot_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jordy33_iot_mcp_server - jquants-free-mcp-server 🐍 🏠 📇 - J-Quants APIの無償版で利用可能な機能のMCPサーバー
pythonmcpapipip install git+https://github.com/cygkichi/jquants-free-mcp-server - jakeyShakey_umami_mcp_server 🐍 🏠 - Mirror of https://github.com/jakeyShakey/umami_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jakeyShakey_umami_mcp_server - jasonsum_gmail-mcp-server 🐍 🏠 - Mirror of https://github.com/jasonsum/gmail-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/jasonsum_gmail-mcp-server - jedrazb_elastic-semantic-search-mcp-server 🐍 🏠 - Mirror of https://github.com/jedrazb/elastic-semantic-search-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jedrazb_elastic-semantic-search-mcp-server - JANHMS_needle-mcp-server 🐍 🏠 - Mirror of https://github.com/JANHMS/needle-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/JANHMS_needle-mcp-server - Jina AI MCP Tools - A Model Context Protocol (MCP) server that integrates with Jina AI Search Foundation APIs.
jinaaisearch - joaowinderfeldbussolotto_MCP-Websearch-Server 🐍 🏠 - Mirror of https://github.com/joaowinderfeldbussolotto/MCP-Websearch-Server
pythonmcpserverwebhttppip install git+https://github.com/MCP-Mirror/joaowinderfeldbussolotto_MCP-Websearch-Server - kakimochi_ros2-mcp-server 🐍 🏠 - Mirror of https://github.com/kakimochi/ros2-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/kakimochi_ros2-mcp-server - kenhuangus_mcp-vulnerable-server-demo 🐍 🏠 - Mirror of https://github.com/kenhuangus/mcp-vulnerable-server-demo
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/kenhuangus_mcp-vulnerable-server-demo - kev-mcp 🐍 🏠 - kev-mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/yeger00/kev-mcp - imlewc_elasticsearch7-mcp-server 🐍 🏠 - Mirror of https://github.com/imlewc/elasticsearch7-mcp-server
pythonmcpservermlhttppip install git+https://github.com/MCP-Mirror/imlewc_elasticsearch7-mcp-server - interactive_draw_mcp 🐍 🏠 - MCP Server for collaborative drawing with Large Language Models
pythonmcp-serverpython-mcptkinter-canvasmcppip install git+https://github.com/AaronGoldsmith/interactive_draw_mcp - ip-mcp-server 🐍 🏠 - A IP MCP server. (Python-based)
pythonmcpserverpip install git+https://github.com/huangxinping/ip-mcp-server - isaacwasserman_mcp_cube_server 🐍 🏠 - Mirror of https://github.com/isaacwasserman/mcp_cube_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/isaacwasserman_mcp_cube_server - JackKuo666_bioRxiv-MCP-Server 🐍 🏠 - Mirror of https://github.com/JackKuo666/bioRxiv-MCP-Server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/JackKuo666_bioRxiv-MCP-Server - juhemcp_jweather-mcp-server 🐍 🏠 - Mirror of https://github.com/juhemcp/jweather-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/juhemcp_jweather-mcp-server - JustTryAI_databricks-mcp-server 🐍 🏠 - Mirror of https://github.com/JustTryAI/databricks-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/JustTryAI_databricks-mcp-server - kubernetes-mcp-server 🐍 🏠 - An MCP server for debugging and managing Kubernetes using Natural Language
pythonmcpserverkubernetespip install git+https://github.com/ehiaig/kubernetes-mcp-server - kursk-ye_code2flow-mcp-server 🐍 🏠 - Mirror of https://github.com/kursk-ye/code2flow-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/kursk-ye_code2flow-mcp-server - isaacwasserman_mcp-snowflake-server 🐍 🏠 - Mirror of https://github.com/isaacwasserman/mcp-snowflake-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/isaacwasserman_mcp-snowflake-server - isaacwasserman_mcp-vegalite-server 🐍 🏠 - Mirror of https://github.com/isaacwasserman/mcp-vegalite-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/isaacwasserman_mcp-vegalite-server - jmonsellier_gmail-mcp-server 🐍 🏠 - Mirror of https://github.com/jmonsellier/gmail-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/jmonsellier_gmail-mcp-server - jonpojonpo_comfy-ui-mcp-server 🐍 🏠 - Mirror of https://github.com/jonpojonpo/comfy-ui-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jonpojonpo_comfy-ui-mcp-server - jtorreggiani_test-python-mcp-server 🐍 🏠 - Mirror of https://github.com/jtorreggiani/test-python-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/jtorreggiani_test-python-mcp-server - KashiwaByte_vikingdb-mcp-server 🐍 🏠 - Mirror of https://github.com/KashiwaByte/vikingdb-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/KashiwaByte_vikingdb-mcp-server - kpsunil97_devrev-mcp-server 🐍 🏠 - Mirror of https://github.com/kpsunil97/devrev-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/kpsunil97_devrev-mcp-server - ktanaka101_mcp-server-duckdb 🐍 🏠 - Mirror of https://github.com/ktanaka101/mcp-server-duckdb
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ktanaka101_mcp-server-duckdb - kylewoolstenhulme-block/Notion-Goose-MCP 🏠 📇 - Facilitates seamless interaction with the Notion API through an MCP server, enabling automated content management and integration.
apihttpmlgitgithub - langgraph-mcp-integration 🐍 🏠 - MCP architecture demo with single-server & multi-server clients using LangGraph, AI-driven tool calls, and async communication.
pythonmcpserveraipip install git+https://github.com/commitbyrajat/langgraph-mcp-integration - latest-news-mcp-server 🐍 🏠 - MCP (model context protocol) server to fetch latest news
pythonmcpserverpip install git+https://github.com/ronakkhandlwl/latest-news-mcp-server - leopeng1995_mssql-mcp-server 🐍 🏠 - Mirror of https://github.com/leopeng1995/mssql-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/leopeng1995_mssql-mcp-server - lifetechia-mcp-server 🐍 🏠 - Lifetechia MCP server
pythonmcpserverpip install git+https://github.com/ayurrin/lifetechia-mcp-server - LinkedInMCP 🐍 🏠 - Automate the Task with LLM
pythonllmpip install git+https://github.com/raghav18482/LinkedInMCP - linux-mcp 🐍 🏠 - mcp server and client for managing a linux server with an LLM agent
pythonmcpserverllmpip install git+https://github.com/brianmatzelle/linux-mcp - llm-mcp-personal-assistant 📘 🏠 - A personal assistant chat app that uses an MCP server
typescriptaianthropic-claudechatgithubnpm install mikefey/llm-mcp-personal-assistant - LeoMainini_dockerized-mcpaper-server 🐳 🏠 - Mirror of https://github.com/LeoMainini/dockerized-mcpaper-server
dockerfilemcpserveraihttpgit clone https://github.com/MCP-Mirror/LeoMainini_dockerized-mcpaper-server - LinkupPlatform_python-mcp-server 🐍 🏠 - Mirror of https://github.com/LinkupPlatform/python-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/LinkupPlatform_python-mcp-server - livecode-mcp 🐍 🏠 - Run io.livecode.ch as an MCP server
pythonmcpserverpip install git+https://github.com/namin/livecode-mcp - LLM_MCP 🏠 - Building MCP client and server for LLM
mcpserverllmgit clone https://github.com/Nkarnaud/LLM_MCP - marklogic-mcp 🐍 🏠 - A repository for MarkLogic MCP integration
pythonmcppip install git+https://github.com/karthiknarayankotha/marklogic-mcp - Machine-To-Machine_f1-mcp-server 🐍 🏠 - Mirror of https://github.com/Machine-To-Machine/f1-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Machine-To-Machine_f1-mcp-server - mailcheck-mcp-server 🐍 🏠 - The MailCheck MCP Server
pythonmcpserveraipip install git+https://github.com/skushagra/mailcheck-mcp-server - marcoeg_mcp-server-ntopng 🐍 🏠 - Mirror of https://github.com/marcoeg/mcp-server-ntopng
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/marcoeg_mcp-server-ntopng - mario-mcp-personal 🐍 🏠 - Python-based
pythonpip install git+https://github.com/m2f0/mario-mcp-personal - mcp 🐍 🏠 - Model Context Protocol (MCP) servers and clients
pythonmcpserverpip install git+https://github.com/aimiox/mcp - mcp 🐍 🏠 - Basic MCP server to see how they work.
pythonmcpserverpip install git+https://github.com/PJ-TST-238819/mcp - m0xai_trello-mcp-server 🐍 🏠 - Mirror of https://github.com/m0xai/trello-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/m0xai_trello-mcp-server - MailchimpMCP 🐍 🏠 📇 - Some utilities for developing an MCP server for the Mailchimp API
pythonmcpserverapiaipip install git+https://github.com/bryangsmith/MailchimpMCP - master_mcp_server 🐍 🏠 - AI Master Control Program (MCP) Server - Enabling AI models to interact with your system
pythonmcpserveraipip install git+https://github.com/GrizzFuOnYou/master_mcp_server - mattshu0410_MCP-server 🐍 🏠 - Mirror of https://github.com/mattshu0410/MCP-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/mattshu0410_MCP-server - mcp 🐍 🏠 - This is hobby for testing MCP servers
pythonmcpservertestingpip install git+https://github.com/samsha1/mcp - mcp 🐍 🏠 - Python implementation of an Elasticsearch MCP server
pythonmcpserverpip install git+https://github.com/meghanmurphy1/mcp - LucasHild_mcp-server-bigquery 🐍 🏠 - Mirror of https://github.com/LucasHild/mcp-server-bigquery
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/LucasHild_mcp-server-bigquery - madhukarkumar_singlestore-mcp-server 🐍 🏠 - Mirror of https://github.com/madhukarkumar/singlestore-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/madhukarkumar_singlestore-mcp-server - mamertofabian_elevenlabs-mcp-server 🐍 🏠 - Mirror of https://github.com/mamertofabian/elevenlabs-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/mamertofabian_elevenlabs-mcp-server - mastercode-io_scaflog-zoho-mcp-server 🐍 🏠 - Mirror of https://github.com/mastercode-io/scaflog-zoho-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/mastercode-io_scaflog-zoho-mcp-server - mcp 🏠 📇 - Generates an MCP server using Anthropic's SDK given input as OpenAPI or GraphQL specs.
mcpserverapigraphqlgit clone https://github.com/jmcentire/mcp - Mcp_cosyvoice 🐍 🏠 - Mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/943003797/Mcp_cosyvoice - mcp_jira 🐍 🏠 - MCP (Model Context Protocol) server for JIRA integration
pythonmcpserverpip install git+https://github.com/codingthefuturewithai/mcp_jira - mcp 🐍 🏠 - Mcp Server to access testrail data
pythonmcpserveraipip install git+https://github.com/Murali-Bobby/mcp_testrail - MCP 🐍 🏠 - MCP de mi perfil (Python-based)
pythonmcp-servernihilismmcppip install git+https://github.com/cdryampi/MCP - mcp 🐍 🏠 - AgentTorch MCP Server - Imagine if your models could simulate
pythonmcpserverpip install git+https://github.com/AgentTorch/mcp - mcp_ai_lab 📜 🏠 - A suite of AI agents and tools built on Model Context Protocol (MCP) for standardized, context-aware AI systems.
javascriptailangachainlangraphmcp-clientnpm install techySPHINX/mcp_ai_lab - mcp_change_analyzer 🐍 🏠 - MCP Server for analyzing outstanding changes to a repo
pythonmcpserverpip install git+https://github.com/manavgup/mcp_change_analyzer - mcp_docs_reader 🐍 🏠 - A lightweight MCP server that loads PDF files, extracts and chunks their text, builds a semantic vector index, and returns relevant passages to Claude or other AI agents for document-based question answering.
pythonmcpserveraipip install git+https://github.com/AIMIZING/mcp_docs_reader - mcp 🐍 🏠 - Enterprise MCP servers
pythonmcpserverpip install git+https://github.com/saptechengineer/mcp - MCP_Agent 🐍 🏠 - This is to demonstrate how an MCP server can be built for Claude Desktop MCP Client
pythonmcpserverpip install git+https://github.com/GayuniBas2001/MCP_claude - MCP_Agentic_AI 🐍 🏠 - Ai agent using MCP server
pythonmcpserveraipip install git+https://github.com/Sumit-Prasad01/MCP_Agentic_AI - mcp_bedrock_sample 🐍 🏠 📇 - mcp using bedrock converse api sample demo.
pythonmcpapipip install git+https://github.com/jikang-jeong/mcp_bedrock_sample - mcp_camstream_analizer 🐍 🏠 - mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/l1b0k/mcp_camstream_analizer - mcp_planio 🐍 🏠 - MCP server for Plan.IO
pythonmcpserverpip install git+https://github.com/karateboss/mcp_planio - mcp_email 🐍 🏠 - An MCP Server enabling POP3 and SMTP functionality for compatable AI Agents
pythonmcpserveraipip install git+https://github.com/gaddobenedetti/mcp_email - MCP_EXP 🐍 🏠 - MCP Client and Server Experiments
pythonmcpserverpip install git+https://github.com/alan-meigs/MCP_EXP - mcp_leanring 🐍 🏠 - mcp example from webset
pythonmcpmcp-clientmcp-serverwebpip install git+https://github.com/zhkzly/mcp_leanring - mcp_learning 🏠 - Learning how to build mcp-servers to connect in llms via langchain
mcpserveraillmgit clone https://github.com/JuanLadeira/mcp_learning - mcp_py_exam 🐍 🏠 - MCP servers and client with gemini
pythonmcpserverpip install git+https://github.com/istanadodan/mcp_py_exam - mcp_qwen 🐍 🏠 - MCP client/server example using qwen3
pythonmcpserverpip install git+https://github.com/tgohblio/mcp_qwen - mcp_sandbox 🐍 🏠 - Playing around with different ways to implement MCP servers
pythonmcpserverpip install git+https://github.com/jack-scott/mcp_sandbox - mcp_llm_inferencer 📘 🏠 - Uses Claude or OpenAI API to convert prompt-mapped input into concrete MCP server components such as tools, resource templates, and prompt handlers.
typescriptailibraryllm-call-engine-withmachine-learningnpm install Sumedh1599/mcp_llm_inferencer - mcp_netlify_template 🐍 🏠 - A barebones MCP server template for Netlify deployment
pythonmcpserverpip install git+https://github.com/memextech/mcp_netlify_template - MCP_SERVER_PYTHON_POC 🐍 🏠 - MCP server poc python
pythonmcpserverpip install git+https://github.com/guptarajiv535/MCP_SERVER_PYTHON_POC - MCP_Python 🐍 🏠 - his is a demonstration implementation of a Model Context Protocol (MCP) server.
pythonmcpserverpip install git+https://github.com/Lysi1983/MCP_Python - mcp_py_sse_browser_control 🐍 🏠 - This is a reference design for a MCP server that hosts a web page that connects back to the server via sse and allows Claude to execute javascript on the page.
pythonmcpserverwebpip install git+https://github.com/matdmiller/mcp_py_sse_browser_control - mcp_server 📜 🏠 - MCP Server using TypeScript and JavaScript made with official MCP docs handling US Weather data having context for two tools - showing weather forecast and weather alerts for US based location. Used Zod for data validation and architectured two folders - src and build , development (ts) and production (js) respectively.
javascriptaiclaude-aigenerative-aimcpnpm install AdiGo22/mcp_server - mcp_server_email 🐍 🏠 - This repository is a mail-sending service developed based on the MCP protocol and Resend. It can be used to send emails, including mass emails. Additionally, it allows querying emails by ID, updating delayed emails, and canceling delayed emails.
pythonemail-sendermcp-servermcpaipip install git+https://github.com/Marary/mcp_server_email - mcp_server_generator 📘 🏠 - Automatically generates a full MCP server codebase (Node/Python/Java) using the validated schema, outputting modular files for CLI-based execution or Claude Desktop connection.
typescriptaiclaude-desktop-compacreates-tools-resourlibrarynpm install Sumedh1599/mcp_server_generator - mcp_server 🐍 🏠 - Очень удобный поисковик на python. Можно внедрить на сайт или использовать локально на ПК с любой ОС.
pythonpip install git+https://github.com/romanshablio/mcp_server - mcp_server 🐍 🏠 - implementing a sample mcp_server using dolphin_mcp client
pythonmcpserverpip install git+https://github.com/karansharma3009/mcp_server - mcp_server_101 🐍 🏠 - MCP server example practice
pythonmcpserverpip install git+https://github.com/harshal-14/mcp_server_101 - mcp_server_client_impl 🐍 🏠 - This is a basic MCP Server-Client Impl using SSE
pythonmcpserverpip install git+https://github.com/parasjain2426/mcp_server_client_impl - mcp_server_ibmcloud 🏠 - MCP server which provides IBM Cloud as a tool for use by LLM's, eg. via Anthopic Claude Desktop or map-cli (open source).
mcpserverllmgit clone https://github.com/ccmitchellusa/mcp_server_ibmcloud - mcp_server_memory 🐍 🏠 - MCP demp (Python-based)
pythonmcppip install git+https://github.com/yangsenessa/mcp_server_memory - mcp_server_research 🐍 🏠 - research claude code and mcp server
pythonmcpserverpip install git+https://github.com/ckz/mcp_server_research - MCP_Server_try_python 🏠 - Trying to build a MCP server with python instruction
mcpserverpythongit clone https://github.com/DeJungTseng/MCP_Server_try_python - MCP_Servers 🏠 - Top MCP Servers to use with AI
mcpserveraigit clone https://github.com/Baptoshi/MCP_Servers - mcp-foodguidecanada 🐍 🏠 📇 - A MCP Server for Canada's Food Guide - To allow LLM's with preset webscraping tools to fetch recipes.
pythonllmmcpnutritionserverpip install git+https://github.com/Aryan-Jhaveri/mcp-foodguidecanada - mcp-lab 🐍 🏠 - This repository contains a modular setup for experimenting with MCP in Python. It includes both a server and a client, as well as reusable tool modules.
pythonmcpserveraipip install git+https://github.com/LPFerreira33/mcp-lab - mcp_sonic_config 🐍 🏠 - MCP server to configure and interact with SONiC network devices
pythonmcpserverpip install git+https://github.com/MheniMerz/mcp_sonic_config - mcp_tutorial 🐍 🏠 - Model Context Protocol (MCP) Server tutorial
pythonmcpserverpip install git+https://github.com/RommelTJ/mcp_tutorial - mcp-first 🐍 🏠 - A simple MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/fjmpaez/mcp-first - mcp_sqlite3_v1 🐍 🏠 - Python-based
pythonpip install git+https://github.com/tanster1234/mcp_sqlite3_v1 - mcp_template 🐍 🏠 - MCP Server Example (Python-based)
pythonmcpserverpip install git+https://github.com/myyrakle/mcp_template - mcp_tool_override_tester 🐍 🏠 - A Model Context Protocol server implementation that demonstrates how tools can be dynamically overridden across multiple servers.
pythonmcp-servermodelcontextprotocolserverpip install git+https://github.com/kibitzing/mcp_tool_override_tester - mcp_unhcr 🐍 🏠 - MCP server provides access to UNHCR RDF
pythonmcpserverpip install git+https://github.com/rvibek/mcp_unhcr - mcp-adk-dev-environment 🐍 🏠 - MCP (Model Context Protocol) development environment with Google ADK Python framework integration and custom network discovery server
pythonmcpservergopip install git+https://github.com/linus-mcmanamey/mcp-adk-dev-environment - mcp-agent 🐍 🏠 - rummaging around mcp servers and ai agents
pythonmcpserveraipip install git+https://github.com/ChrCoello/mcp-agent - Mcp_trial 🐍 🏠 - Trying out MCP server and its working
pythonmcpserverpip install git+https://github.com/Stormbreaker06/Mcp_trial - mcp_weather_scraper 🐍 🏠 📇 - A lightweight prototype demonstrating how to integrate an LLM (via OpenAI) with a Model Context Protocol (MCP) server to extract real-time weather data by scraping and processing open web content using HTML parsing and caching.
pythonllm-mcp-openai-fastapi-pydantic-selectolaxmcpserverapipip install git+https://github.com/EXPESRaza/mcp_weather_scraper - mcp-api 🐍 🏠 - mcp client and server
pythonmcpmodelcontextprotocolserverpip install git+https://github.com/isakulaksiz/mcp-api - MCP-API-Server 🐍 🏠 📇 - A FastAPI-MCP server that fetches Wikipedia summaries for AI assistants, deployed using Google Colab and Ngrok.
pythonmcpserverapiaipip install git+https://github.com/Rishavv007/MCP-Wikipedia-API-Server - mcp-atendeai 🏠 - Server MCP for atendeAi
mcpserveraigit clone https://github.com/ViniciusAmeric/mcp-atendeai - mcp-auto-tools-ms 🐍 🏠 📇 - This Helm chart dynamically deploys an MCP server accessible remotely via Server-Sent Events (SSE). It allows you to integrate existing REST APIs from your application and publish them as tools within the MCP server, enabling easy discovery and interaction by intelligent agents or external clients.
pythonmcpserverapirestpip install git+https://github.com/lgiuppone/mcp-auto-tools-ms - mcp-blank 🐍 🏠 - Repository for MCP blank project with GitHub MCP server setup
pythonmcpserverpip install git+https://github.com/BruceChanceBeatverse/mcp-blank - mcp-bone 📜 🏠 - MCP Bone npm package which is used to connect to MCP Bone as a MCP Server and is also used as SDK
httpllmgitgithubjavascriptnpm install tangshuang/mcp-bone - mcp-brockevents 🐍 🏠 - A MCP Server for Events at Brock. Now use claude to help you search for events and more
pythonmcpserverpip install git+https://github.com/Aryan-Jhaveri/mcp-brockevents - MCP-Claude-Desktop-Project-Demo 🐍 🏠 - This project demonstrates the use of the mcp (Modular Claude Protocol) server with the FastMCP framework to create a set of programmable tools and resources. It includes a basic calculator, note-taking functionality, and real-time currency exchange rate lookup. Designed to integrate easily with Claude Desktop
pythonmcpserverpip install git+https://github.com/Samm-OB/MCP-Claude-Desktop-Project-Demo - mcp-box 🐍 🏠 - mcp-box for mcp server
pythonmcpserverpip install git+https://github.com/RRRoger/mcp-box - mcp-browser-automation 🐍 🏠 - Python-based MCP toolset with Echo server for testing and Browser Automation server using browser-use and LangChain for AI-driven web interactions
pythonmcpserverwebaipip install git+https://github.com/djpapzin/mcp-browser-automation - mcp-changtianML 🏠 - mcp server to access changtianML
mcpservermlgit clone https://github.com/AFAN-LIFE/mcp-changtianML - mcp-deep-research 🐍 🏠 - An mcp server designed for local-deployed deep research.
pythonmcpserverpip install git+https://github.com/Pb-207/mcp-deep-research - MCP-Client-and-Server-Demo 🐍 🏠 - This project demonstrates how to build a minimal MCP server using the
mcpPython SDK and connect it to Claude Desktop as a client. It simulates a simple Travel Desk system with tools to submit, view, and track employee travel requests — all accessible directly from Claude's interface.pythonagentic-aiaigenerative-aimcp-serverpip install git+https://github.com/ChaitanyaK77/MCP-Client-and-Server-Demo - mcp-client-gradio 🐍 🏠 - Simple MCP client using Gradio with locally run MCP servers.
pythonmcpserverpip install git+https://github.com/mhendrey/mcp-client-gradio - mcp-cornell-resume 🐍 🏠 - A Model Context Protocol (MCP) server that automatically generates Cornell-style study notes and summaries from the conversational context, with RAG active recall question generation and Notion integration.
pythonmcpserverpip install git+https://github.com/johndezr/mcp-cornell-resume - mcp-client-server 🐍 🏠 - make MCP Client&Server
pythonmcpserverpip install git+https://github.com/httpsxiao/mcp-client-server - mcp-client-server-python 🐍 🏠 - Basic implementation mcp client server
pythonmcpserverpip install git+https://github.com/sofianhw/mcp-client-server-python - mcp-dev 🐍 🏠 - mcpを試す https://modelcontextprotocol.io/quickstart/server
pythonmcpserverhttppip install git+https://github.com/KosukeUchida/mcp-dev - mcp-database-read-prototype 🐍 🏠 - Model context protocol for reading information from a database.
pythondatabasepip install git+https://github.com/riefer02/mcp-database-read-prototype - mcp-docs 🏠 - A Simple MCP server to serve documentation for AI apps
mcpserveraidocumentationgit clone https://github.com/antunsz/mcp-docs - mcp-f1analisys 🐍 🏠 📇 - MCP server for F1 Analysis API
pythonaimcpmcp-servermodelcontextprotocolpip install git+https://github.com/Maxbleu/mcp-f1analisys - mcp-claude-weather 📘 🏠 - A CLI tool for real-time weather alerts, forecasts, and warnings from the US National Weather Service, powered by MCP Claude.
httpmlgitgithubtypescriptnpm install AlexShan2008/mcp-claude-weather - mcp-fashion-server 🐍 🏠 - AI 기반 여성 의류 쇼핑몰 콘텐츠 자동화 시스템
pythonaipip install git+https://github.com/Kimkeunwoo-OSE/mcp-fashion-server - mcp-dominican-layer 📜 🏠 - This MCP server provides access to information about the Dominican Congress, including legislative agendas, legislator activity, and new bills.
javascriptaimcp-servernodejsmcpnpm install EnzoVezzaro/mcp-dominican-layer - mcp-fastapi-learning 🐍 🏠 - A test repository created using the GitHub MCP server
pythonmcpserverpip install git+https://github.com/xxradar/mcp-test-repo - mcp-file-summarizer 🐍 🏠 - Lightweight MCP server that summarizes local .txt and .md files using AI agents
pythonmcpserveraipip install git+https://github.com/DevOpsDynamoHub/mcp-file-summarizer - mcp-file-finder 🐍 🏠 - MCP server on Python
pythonmcpserverpip install git+https://github.com/cavil2015/mcp-file-finder - mcp-flight-search-server 🐍 🏠 📇 - MCP Server for flight search using serpAPI service
pythonmcpserverapipip install git+https://github.com/KVSSetty/mcp-flight-search-server - mcp-github-enterprise 🐍 🏠 - A powerful Model Context Protocol (MCP) server for GitHub Enterprise that enables AI agents to access and manage enterprise users, organizations, and licenses.
pythonmcpserveraipip install git+https://github.com/vipink1203/github-mcp-bridge - mcp-holster 🐍 🏠 - MCP server that will edit your claude configs
pythonmcpserverpip install git+https://github.com/kimjune01/mcp-holster - mcp-hub-ui 🏠 - Skeleton for mcp server hub
htmlmcpservergit clone https://github.com/gfuener/mcp-hub-ui - mcp-image 🐍 🏠 - MCP Server to Generate Image
pythonmcpserverpip install git+https://github.com/mingdaoai/mcp-image - mcp-jira 🐍 🏠 - A high-performance, asynchronous Model Context Protocol (MCP) server that integrates with JIRA using stdio transport
pythonmcpserverpip install git+https://github.com/judexzhu/mcp-jira - mcp-github 📜 🏠 📇 - 🔗 GitHub MCP Tool | 基于MCP协议的GitHub工具,为Cursor编辑器提供AI操作GitHub能力 | AI-powered GitHub operations for Cursor Editor through MCP protocol
javascriptaiapiautomationbotnpm install shuakami/mcp-github - mcp-i18n 🏠 - MCP server to help with i18n translations
htmlmcpservergit clone https://github.com/martincik/mcp-i18n - mcp-finnhub 🐍 🏠 📇 - An MCP server to interface with Finnhub API.
pythonmcpserverapipip install git+https://github.com/catherinedparnell/mcp-finnhub - mcp-imagen-server 🏠 - mcp server for use when you want to make images casually. fal.ai and a very cheap hall of fame is also possible!
mcpserveraigit clone https://github.com/MASAKASUNO1/mcp-imagen-server - mcp-kafka-processor 🏠 - An MCP server for processing Kafka events and enabling LLMs to interact with event streams
mcpserverllmgit clone https://github.com/boufnichel/mcp-kafka-processor - mcp-litellm-proxy 🏠 - An MCP Server for LiteLLM Proxy
mcpserverllmgit clone https://github.com/cege7480/mcp-litellm-proxy - mcp-market-data-server 🐍 🏠 - Standalone server designed to deliver market data insights to AI trading agents. It processes data from external brokers and computes structured information to help LLMs and other AI systems make more informed trading decisions using JSON RPC protocol
pythonserveraillmjsonpip install git+https://github.com/fintools-ai/mcp-market-data-server - MCP-Mistral-Ocr 🐍 🏠 - Mcp ocr server (Python-based)
pythonmcpserverpip install git+https://github.com/sathizz7/MCP-Mistral-Ocr - mcp-order-flow-server 🐍 🏠 - This is the mcp to fetch and get order flow information
pythonmcppip install git+https://github.com/fintools-ai/mcp-order-flow-server - MCP-LLM-Sample 🐍 🏠 - Sample MCP Server & Client setup, compatible with LangChain
pythonmcpserveraipip install git+https://github.com/TaQuangTu/MCP-LLM-Sample - mcp-mermaidjs-server 🏠 - An MCP server for working with MermaidJS, using
mmdc.makefilemcpserveraigit clone https://github.com/unravel-team/mcp-mermaidjs-server - mcp-metal-price 🐍 🏠 📇 - An MCP server that provides current and historical gold/precious metal prices via the GoldAPI.io service.
pythonmcpserverapigopip install git+https://github.com/isdaniel/mcp-metal-price - mcp-minimal 🐍 🏠 - A minimal MCP server to validate that MCP client configurations are working.
pythonmcpserverpip install git+https://github.com/janspoerer/mcp-minimal - MCP-Model-Context-Protocol-Projects 🐍 🏠 - In this Repo I am learning and practically implementing MCP clients and servers in python.
pythonmcpserverpip install git+https://github.com/manojshipra/MCP-Model-Context-Protocol-Projects - mcp-monday-server 🐍 🏠 - Python-based
pythonpip install git+https://github.com/Sofias-ai/mcp-monday-server - mcp-naver-weather 🐍 🏠 - A lightweight MCP server that fetches weather data from Naver and relays it to Claude or other AI agents.
pythonmcpserveraipip install git+https://github.com/AIMIZING/mcp-naver-weather - mcp-noaa-tides 🐍 🏠 - An MCP Server for NOAA Tide data
pythonmcpserverpip install git+https://github.com/seanofahey/mcp-noaa-tides - mcp-notebooks 🐍 🏠 - Notebook execution MCP server
pythonmcpserverpip install git+https://github.com/Neuron1c/mcp-notebooks - mcp-ocm 🐍 🏠 📇 - A comprehensive Model Control Protocol (MCP) server for Red Hat OpenShift Cluster Manager (OCM) API operations. This server provides 12 intelligent tools for cluster management, account operations, and infrastructure monitoring.
pythonmcpserverapimonitoringpip install git+https://github.com/judexzhu/mcp-ocm - mcp-openrouter-base_url 🐍 🏠 - Implement an MCP (Model Context Protocol) server with an AI agent using the OpenAI SDK and an OpenRouter base URL,
pythonmcpserveraipip install git+https://github.com/KlausJager10110/mcp-openrouter-base_url - mcp-kafka-server 🐍 🏠 - MCP Kafka服务器 - 通过MCP协议连接Kafka,支持查询Topic信息、读写数据和回放历史数据
pythonmcppip install git+https://github.com/yufule/mcp-kafka-server - mcp-githubcli 🐍 🏠 - MCP server on GithubCLI allow you to access private repos
pythonmcpserverpip install git+https://github.com/Chenlong-Tao/mcp-githubcli - mcp-notes 🐍 🏠 - MCP Server for taking notes using an LLM client like Claude Desktop.
pythonmcpserverllmpip install git+https://github.com/BeingSoumyadeepSharma/mcp-notes - mcp-mssql 🐍 🏠 - MCP server for MSSQL
pythonmcpserverpip install git+https://github.com/FarukNetworks/mcp-mssql - mcp-myip 🐍 🏠 - A Model Context Protocol (MCP) server for providing your public IP to LLMs
pythonllmmcpmcp-serverserverpip install git+https://github.com/nikolaypavlov/mcp-myip - mcp-nefino 🐍 🏠 - Nefino middleware implementation of the Model Context Protocol (MCP)
pythonmcppip install git+https://github.com/nefino/mcp-nefino - mcp-ntopng 🐍 🏠 - An MCP server for network monitoring software ntopng
pythonmcpservermonitoringpip install git+https://github.com/marcoeg/mcp-ntopng - baba786_angleone-mcp-server 🐍 🏠 - Mirror of https://github.com/baba786/angleone-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/baba786_angleone-mcp-server - baba786_phabricator-mcp-server 🐍 🏠 - Mirror of https://github.com/baba786/phabricator-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/baba786_phabricator-mcp-server - bio-mcp-servers 🏠 - A compilation for all the available bio agent
aigit clone https://github.com/kleonai/bio-mcp-servers - china-festival-mcp 🐍 🏠 - 为 AI Agent 提供准确的法定节假日、调休安排、中国传统节日、农历转换、二十四节气和八字计算功能。西方节日都是固定公历日期,不需要查询工具。
pythonaipip install git+https://github.com/Eis4TY/china-festival-mcp - CoderSoumya007_Anthropic-MCP-Server 🏠 - Mirror of https://github.com/CoderSoumya007/Anthropic-MCP-Server
mcpserverhttpgit clone https://github.com/MCP-Mirror/CoderSoumya007_Anthropic-MCP-Server - comitest22/linear-mcp 🏠 📇 - Facilitates interaction with the Linear API through a Model Context Protocol server, offering tools for ticket management and prioritization.
apihttpgitgithub - Custom-cliente-mcp 🐍 🏠 - A real example of a custom client mcp custom server
pythonmcpserverpip install git+https://github.com/DaliGabriel/Custom-cliente-mcp - document-search-mcp-server 🐍 🏠 📇 - MCP (Model Context Protocol) server that allows users to search for documentation from popular libraries such as LangChain, LlamaIndex, and OpenAI using the Serper API. The server fetches search results and extracts the relevant documentation from the web using HTTP requests and BeautifulSoup.
pythonclaude-ailangchainmcp-servermcp-toolspip install git+https://github.com/sawantudayan/python-mcp-server - commcare-connect-mcp 🐍 🏠 - A proof of concept demo of an MCP server for CommCare Connect
pythonmcpserverpip install git+https://github.com/dimagi/commcare-connect-mcp - deepseek-MCP-server 🐍 🏠 - MCP server that enhances Claude's reasoning capabilities by integrating DeepSeek R1's advanced reasoning engine
pythonmcpserverpip install git+https://github.com/moyu6027/deepseek-MCP-server - demo-mcp 🐍 🏠 - just a demo mcp server
pythonmcpserverpip install git+https://github.com/phoenix-kd/demo-mcp - ConechoAI_openai-websearch-mcp 🐍 🏠 - Mirror of https://github.com/ConechoAI/openai-websearch-mcp
pythonmcpwebaihttppip install git+https://github.com/MCP-Mirror/ConechoAI_openai-websearch-mcp - content-creator-mcp 🐍 🏠 - MCP Server that implements a content creator agent.
pythonmcpserverpip install git+https://github.com/MatheusOliveiraSilva/content-creator-mcp - coucya_mcp-server-requests 🐍 🏠 - Mirror of https://github.com/coucya/mcp-server-requests
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/coucya_mcp-server-requests - Cris-0k_mcp-server-python-template 🐍 🏠 - Mirror of https://github.com/Cris-0k/mcp-server-python-template
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Cris-0k_mcp-server-python-template - ctvidic_strava-mcp-server 🐍 🏠 - Mirror of https://github.com/ctvidic/strava-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ctvidic_strava-mcp-server - custom-mcp-servers 🐍 🏠 - A collection of custom MCP servers I’ve built 🧠⚡️.
pythonllmmcp-servermcpserverpip install git+https://github.com/AryanK1511/custom-mcp-servers - CustomMCPServer 🐍 🏠 - build a custom MCP server in Python and connect that to an AI agent.
pythonmcpserveraipip install git+https://github.com/abhimvp/CustomMCPServer - Dataring-engineering_mcp-server-trino 🐍 🏠 - Mirror of https://github.com/Dataring-engineering/mcp-server-trino
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Dataring-engineering_mcp-server-trino - datax-mcp-server 🐍 🏠 - Datax is an intelligent data analysis tool designed for the AI era, enabling users to interact with data through natural language to effortlessly gain deep business insights and predictive analytics.
pythonaipip install git+https://github.com/haobosang/datax-mcp-server - DivyanshKushwaha_GitHub-MCP-Server-Claude 🐍 🏠 - Mirror of https://github.com/DivyanshKushwaha/GitHub-MCP-Server-Claude
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/DivyanshKushwaha_GitHub-MCP-Server-Claude - document-understanding-mcp-server 🐍 🏠 - A document reading, search, and metadata server to provide access to PDFs (and, in the future, other formats) to LLMs via the Model Context Protocol (MCP)
pythonmcpserverllmpip install git+https://github.com/jaesharp/document-understanding-mcp-server - demo-mcp-server 🐍 🏠 - Learning how to configure an MCP server from https://modelcontextprotocol.io/quickstart/server
pythonmcpserverhttppip install git+https://github.com/hjfender/demo-mcp-server - dabouelhassan_mcp-server-example-v2 🐍 🏠 - Mirror of https://github.com/dabouelhassan/mcp-server-example-v2
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/dabouelhassan_mcp-server-example-v2 - dazzaji_mcp-client-server 🐍 🏠 - Mirror of https://github.com/dazzaji/mcp-client-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/dazzaji_mcp-client-server - domain-lookup-mcp 🏠 - An mini mcp server for domain name lookup
mcpserveraigit clone https://github.com/MinjetTech/domain-lookup-mcp - drdeeks/remote-mcp-server 🏠 ☁️ - Deploy a remote MCP server on Cloudflare Workers with OAuth login, enabling seamless integration with tools like Claude Desktop.
remoteauthoauthhttpml - enreachvoice_mcp 🐍 🏠 📇 - EnreachVoice API MCP Server
pythonmcpserverapipip install git+https://github.com/mokso/enreachvoice_mcp - ericzakariasson_uber-eats-mcp-server 🐍 🏠 - Mirror of https://github.com/ericzakariasson/uber-eats-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ericzakariasson_uber-eats-mcp-server - espresso-mcp 🐍 🏠 - An MCP Server for the Espresso Android Test Framework, crafted to improve testing capabilities and optimize development workflows.
pythonandroidautomationemulatorespressopip install git+https://github.com/vs4vijay/espresso-mcp - example-mcp-server-backup 🐍 🏠 - Backup of MCP server with rope tool implementation
pythonmcpserverpip install git+https://github.com/MarkPushRec/example-mcp-server-backup - ergut_mcp-logseq-server 🐍 🏠 - Mirror of https://github.com/ergut/mcp-logseq-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ergut_mcp-logseq-server - etcd-mcp-server 🏠 - An MCP server for etcd for AI clients to interact with
mcpserveraigit clone https://github.com/anveshreddy18/etcd-mcp-server - EverArt - AI image generation using various models
aiimage-generationart - expensivefav/mcp 🏠 📇 - Facilitates interaction with Algolia APIs through experimental MCP servers, enabling search and data manipulation tasks.
apihttpgitgithub - fctr-id_okta-mcp-server 🐍 🏠 - Mirror of https://github.com/fctr-id/okta-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/fctr-id_okta-mcp-server - forge_docs_mcp_server 🐍 🏠 - Forge is an advanced 3D Gaussian Splatting renderer for THREE.js
pythonpip install git+https://github.com/angrypenguinpng/forge_docs_mcp_server - famano_mcp-server-office 🐍 🏠 - Mirror of https://github.com/famano/mcp-server-office
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/famano_mcp-server-office - FastMCP_Claude_Desktop 🐍 🏠 - First play with MCP server on Claude Desktop
pythonmcpserverpip install git+https://github.com/nuke66/FastMCP_Claude_Desktop - fhir-mcp-server-medagentbench 🐍 🏠 - An implementation of Model Context Protocol server for use with MedAgentBench (FHIR request generation)
pythonserverpip install git+https://github.com/mike-holcomb/fhir-mcp-server-medagentbench - FileSystemMCP 🏠 - A Python-based Model Context Protocol (MCP) server using a file‑system backend, offering tools for note taking, file I/O, directory management, search, compression, and metadata retrieval.
mcpserverpythongit clone https://github.com/mohsinkar/FileSystemMCP - gemini_mcp 🐍 🏠 - MCP server for orchestrating multiple Gemini AI agents with persistent sessions
pythonmcpserveraipip install git+https://github.com/ivangrynenko/gemini_mcp - github-mcp-sse 🐍 🏠 - MCP (Model Context Protocol) client for GitHub Multi-User Server with Claude integration. Interactive chat interface for GitHub operations using natural language.
pythonmcpserverpip install git+https://github.com/devendershekhawat/github-mcp-sse - freedanfan_mcp_server 🐍 🏠 - Mirror of https://github.com/freedanfan/mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/freedanfan_mcp_server - Funmula-Corp_BigGo-MCP-Server 🐍 🏠 - Mirror of https://github.com/Funmula-Corp/BigGo-MCP-Server
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/Funmula-Corp_BigGo-MCP-Server - gatherings-mcp 🐍 🏠 - This is a TypeScript-based MCP server, which wraps around a python script. together it helps track expenses and payments for social events, making it easy to calculate reimbursements and settle balances between friends.
pythonmcpserverpip install git+https://github.com/abutbul/gatherings-mcp - gatherings-mcp-python 🐍 🏠 📇 - The Gatherings MCP Server provides an API that allows AI assistants to interact with the Gatherings application through the Machine Conversation Protocol. This enables AI systems to help users manage shared expenses for social events, outings, or any gathering where costs are split among participants.
pythonmcpserverapiaipip install git+https://github.com/abutbul/gatherings-mcp-python - georgi-terziyski_database_mcp_server 🐍 🏠 - Mirror of https://github.com/georgi-terziyski/database_mcp_server
pythonmcpserverdatabasehttppip install git+https://github.com/MCP-Mirror/georgi-terziyski_database_mcp_server - getting-started-with-mcp-server 📘 🏠 - This tutorial walks you through setting up a basic MCP (Model Context Protocol) server to expose read-only resources to Large Language Models (LLMs) like Claude.
typescriptagentaimcpmodel-context-protocolnpm install cycle-sync-ai/getting-started-with-mcp-server - GitHub-Security-MCP-Server 📘 🏠 📇 - Model Context Protocol (MCP) server that provides GitHub API tools for user information, security issue creation, and repository security scanning. Built with TypeScript and the MCP SDK
typescriptagentaigithubgithub-advanced-securitynpm install RickardHF/GitHub-Security-MCP-Server - Geeksfino_kb-mcp-server 🐍 🏠 - Mirror of https://github.com/Geeksfino/kb-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Geeksfino_kb-mcp-server - github-mcp-server-config 🏠 - Documentation and configuration details for GitHub MCP server setup
mcpserveraidocumentationgit clone https://github.com/yosay-org/github-mcp-server-config - goweb3_mcp_server 🐍 🏠 - MCP Server for GoWeb3 events and news
pythonmcpserverwebgopip install git+https://github.com/roadahead1/goweb3_mcp_server - board-game-mcp 🐍 🏠 📇 - This is an MCP server using the BoardGameGeek (BGG) API that helps you and your LLM to find the right board game for you.
pythonmcpserverapillmpip install git+https://github.com/malte-b/board-game-mcp - go-mcp 🐍 🏠 - Golang MCP server example
pythonmcpservergopip install git+https://github.com/wagnerjt/go-mcp - burakdirin_mysqldb-mcp-server 🐍 🏠 - Mirror of https://github.com/burakdirin/mysqldb-mcp-server
pythonmcpserverhttpmysqlpip install git+https://github.com/MCP-Mirror/burakdirin_mysqldb-mcp-server - blender-mcp 🐍 🏠 - MCP server to run code in Blender
pythonmcpserverpip install git+https://github.com/rectalogic/blender-mcp - bloodhound-mcp 🐍 🏠 📇 - MCP server for bloodhound's api
pythonmcpserverapipip install git+https://github.com/tac01337/bloodhound-mcp - bobtista_luma-ai-mcp-server 🐍 🏠 - Mirror of https://github.com/bobtista/luma-ai-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/bobtista_luma-ai-mcp-server - boopai-mcp 🐍 🏠 - The boopai-mcp server implements Solana blockchain functionality for the boopai launchpad.
pythonmcpserveraipip install git+https://github.com/boopaispace/boopai-mcp - box-community_mcp-server-box 🐍 🏠 - Mirror of https://github.com/box-community/mcp-server-box
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/box-community_mcp-server-box - bus-mgmt-mcp-server 🐍 🏠 - MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/calvinw/bus-mgmt-mcp-server - cabrit0_mcp_server_reuneMacacada 🐍 🏠 - Mirror of https://github.com/cabrit0/mcp_server_reuneMacacada
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/cabrit0_mcp_server_reuneMacacada - calebmwelsh_file-system-mcp-server 🐍 🏠 - Mirror of https://github.com/calebmwelsh/file-system-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/calebmwelsh_file-system-mcp-server - CampusLostFoundMCP 🐍 🏠 - Modular CLI-based MCP server to manage campus lost & found items using Claude Desktop.
pythonmcpserverpip install git+https://github.com/utkarshagawade17/CampusLostFoundMCP - clickhouse-mcp 🐍 🏠 - a readonly clickhouse mcp server and ensure your ai use clickhouse safely
pythonmcpserveraipip install git+https://github.com/the-nine-nation/clickhouse-mcp - cline-mcp-server 🐍 🏠 - Cline MCP Server - Internal workflow orchestration for agentic tasks
pythonmcpserverpip install git+https://github.com/mows21/cline-mcp-server - dschuler36_reaper-mcp-server 🐍 🏠 - Mirror of https://github.com/dschuler36/reaper-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/dschuler36_reaper-mcp-server - e-gonghun-mcp 🐍 🏠 - e-gonghun-mcp 프로젝트 (Python-based)
pythonmcpgopip install git+https://github.com/shinkeonkim/e-gonghun-mcp - easy-mcp-github-tools-python 🐍 🏠 - A set of powerful tools designed for seamless integration with GitHub via MCP
pythonmcpmcp-serveroauth2mlpip install git+https://github.com/ground-creative/easy-mcp-github-tools-python - elfa-mcp 🐍 🏠 - Elfa MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/elfa-ai/elfa-mcp - emotion_playlist_mcp 🐍 🏠 - An MCP Server that makes spotify playlists based on your emotions
pythonmcpserverpip install git+https://github.com/dldnlee/emotion_playlist_mcp - gmail-mcp-server 🐍 🏠 - A Gmail Model Context Protocol server for seamless integration with AI assistants
pythonserveraimlpip install git+https://github.com/Imsharad/gmail-mcp-server - anthropic-mcp-kotlin-sdk 🎯 🏠 - The official Kotlin SDK for Model Context Protocol servers and clients. Maintained in collaboration with JetBrains
kotlinserveraigit clone https://github.com/wiremock-inc/anthropic-mcp-kotlin-sdk - apache_iotdb-mcp-server 🐍 🏠 - Mirror of https://github.com/apache/iotdb-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/apache_iotdb-mcp-server - aptos-mcp-server 🐍 🏠 - A Model Context Protocol (MCP) server for interacting with Aptos documentation and creating full-stack Aptos blockchain applications.
pythonmcpserveraidocumentationpip install git+https://github.com/Tlazypanda/aptos-mcp-server - ariunbolor_nsaf-mcp-server 🐍 🏠 - Mirror of https://github.com/ariunbolor/nsaf-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ariunbolor_nsaf-mcp-server - ceshine_git-prompts-mcp-server 🐍 🏠 - Mirror of https://github.com/ceshine/git-prompts-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ceshine_git-prompts-mcp-server - cloudflare-images-mcp 🐍 🏠 - Simple MCP server to add images to Cloudflare Images
pythonmcpserverpip install git+https://github.com/philipp-eisen/cloudflare-images-mcp - firecrawl-simple-mcp 📘 🏠 📇 - MCP server for Firecrawl Simple — a web scraping and site mapping tool enabling LLMs to access and process web content
typescriptaifirecrawlllmmcpnpm install Sacode/firecrawl-simple-mcp - fledge-mcp 🐍 🏠 - Fledge Model Context Protocol (MCP) Server for Cursor AI integration
pythonmcpserveraipip install git+https://github.com/Krupalp525/fledge-mcp - Flex-MCP-Agent 🐍 🏠 - Flex MCP Agent is an AI-powered agent designed to interface with MCP servers to process and resolve user queries. Simply configure it with MCP servers, and watch it scale effortlessly—no limits, no bottlenecks.
pythonmcpserveraipip install git+https://github.com/MahithChigurupati/Flex-MCP-Agent - fluent_mcp 🐍 🏠 - python package for creating MCP servers with embedded LLM reasoning
pythonmcpserverllmpip install git+https://github.com/FluentData/fluent_mcp - fortunto2_prefect-mcp-server 🐍 🏠 - Mirror of https://github.com/fortunto2/prefect-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/fortunto2_prefect-mcp-server - Github-MCP-Server-Demo 🐍 🏠 - Repository created via custom MCP Python server
pythonmcpserverpip install git+https://github.com/jatinnahar15/mcp-python-test - GongRzhe_Office-Word-MCP-Server 🐍 🏠 - Mirror of https://github.com/GongRzhe/Office-Word-MCP-Server
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/GongRzhe_Office-Word-MCP-Server - google-calendar-mcp 🐍 🏠 - MCP server for google calendar
pythonmcpservergopip install git+https://github.com/surana-mudit/google-calendar-mcp - gmail-mcp-client-server 🐍 🏠 - MCP client and server to hook up Claude to Gmail.
pythonmcpserveraipip install git+https://github.com/karimdabbouz/gmail-mcp-client-server - google-calendar-mcp-server 🐍 🏠 📇 - Google Calendar APIを使用したMCPサーバー
pythonmcpapigopip install git+https://github.com/101ta28/google-calendar-mcp-server - gradio-transcript-mcp 🐍 🏠 - Gradio demo cum MCP server to generate transcripts from Audio/Video
pythonmcpserverpip install git+https://github.com/bsmnyk/gradio-transcript-mcp - cloudinary-mcp-server 🐍 🏠 - Cloudinary-MCP-Server optimizes and manages Cloudinary’s image hosting, providing efficient media storage, processing, and delivery to enhance app performance and user experience.
pythonmcpserverpip install git+https://github.com/JaeGerW2016/cloudinary-mcp-server - clssck_mcp-time-server 🐍 🏠 - Mirror of https://github.com/clssck/mcp-time-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/clssck_mcp-time-server - cnitlrt_headless-ida-mcp-server 🐍 🏠 - Mirror of https://github.com/cnitlrt/headless-ida-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/cnitlrt_headless-ida-mcp-server - CodeByWaqas_MRConfluenceLinker-mcp-server 🐍 🏠 - Mirror of https://github.com/CodeByWaqas/MRConfluenceLinker-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/CodeByWaqas_MRConfluenceLinker-mcp-server - CodeByWaqas_weather-mcp-server 🐍 🏠 - Mirror of https://github.com/CodeByWaqas/weather-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/CodeByWaqas_weather-mcp-server - CodeLogicIncEngineering_codelogic-mcp-server 🐍 🏠 - Mirror of https://github.com/CodeLogicIncEngineering/codelogic-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/CodeLogicIncEngineering_codelogic-mcp-server - Google-Calendar-MCP-Server 🐍 🏠 📇 - MCP Server for Google Calendar API
pythonmcpserverapigopip install git+https://github.com/Arkyapatwa/Google-Calendar-MCP-Server - gpt-mcp-project 🐍 🏠 - Simple chat with Function Calling to a dummy MCP server
pythonmcpserverpip install git+https://github.com/muralinarisetty/gpt-mcp-project - glean-mcp-server 🐍 🏠 - MCP Server for Glean Chat
pythonmcpserverpip install git+https://github.com/rahul-roy-glean/glean-mcp-server - GreptimeTeam_greptimedb-mcp-server 🐍 🏠 - Mirror of https://github.com/GreptimeTeam/greptimedb-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/GreptimeTeam_greptimedb-mcp-server - AgentWong_iac-memory-mcp-server-project 🐍 🏠 - Mirror of https://github.com/AgentWong/iac-memory-mcp-server-project
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/AgentWong_iac-memory-mcp-server-project - alexander-zuev_supabase-mcp-server 🐍 🏠 - Mirror of https://github.com/alexander-zuev/supabase-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/alexander-zuev_supabase-mcp-server - h-yanagawa_research-mcp-server 🐍 🏠 - Mirror of https://github.com/h-yanagawa/research-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/h-yanagawa_research-mcp-server - aallsbury_qb-time-mcp-server 🐍 🏠 - Mirror of https://github.com/aallsbury/qb-time-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/aallsbury_qb-time-mcp-server - Ad-Veritas_mcp-server-trueRAG 🐍 🏠 - Mirror of https://github.com/Ad-Veritas/mcp-server-trueRAG
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Ad-Veritas_mcp-server-trueRAG - AgentWong_optimized-memory-mcp-serverv2 🐍 🏠 - Mirror of https://github.com/AgentWong/optimized-memory-mcp-serverv2
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/AgentWong_optimized-memory-mcp-serverv2 - aindreyway_mcp-server-neurolora-p 🐍 🏠 - Mirror of https://github.com/aindreyway/mcp-server-neurolora-p
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/aindreyway_mcp-server-neurolora-p - alexgoller_illumio-mcp-server 🐍 🏠 - Mirror of https://github.com/alexgoller/illumio-mcp-server
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/alexgoller_illumio-mcp-server - alexgoller_mcp-server-agenda 🐍 🏠 - Mirror of https://github.com/alexgoller/mcp-server-agenda
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/alexgoller_mcp-server-agenda - alexwohletz_language-server-mcp 🏠 - Mirror of https://github.com/alexwohletz/language-server-mcp
htmlmcpserverhttpgit clone https://github.com/MCP-Mirror/alexwohletz_language-server-mcp - allenporter_mcp-server-home-assistant 🐍 🏠 - Mirror of https://github.com/allenporter/mcp-server-home-assistant
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/allenporter_mcp-server-home-assistant - anpigon_mcp-server-obsidian-omnisearch 🐍 🏠 - Mirror of https://github.com/anpigon/mcp-server-obsidian-omnisearch
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/anpigon_mcp-server-obsidian-omnisearch - aoirint_aoirint_mcping_server 🐍 🏠 - Mirror of https://github.com/aoirint/aoirint_mcping_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/aoirint_aoirint_mcping_server - arben-adm_mcp-claude-dev 🐍 🏠 - Mirror of https://github.com/arben-adm/mcp-claude-dev
pythonmcphttppip install git+https://github.com/MCP-Mirror/arben-adm_mcp-claude-dev - blazickjp_arxiv-mcp-server 🐍 🏠 - Mirror of https://github.com/blazickjp/arxiv-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/blazickjp_arxiv-mcp-server - blazickjp_shell-mcp-server 🐍 🏠 - Mirror of https://github.com/blazickjp/shell-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/blazickjp_shell-mcp-server - blazickjp_web-browser-mcp-server 🐍 🏠 - Mirror of https://github.com/blazickjp/web-browser-mcp-server
pythonmcpserverwebhttppip install git+https://github.com/MCP-Mirror/blazickjp_web-browser-mcp-server - CaesarYangs_prometheus_mcp_server 🐍 🏠 - Mirror of https://github.com/CaesarYangs/prometheus_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/CaesarYangs_prometheus_mcp_server - chatmcp_mcp-server-collector 🐍 🏠 - Mirror of https://github.com/chatmcp/mcp-server-collector
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/chatmcp_mcp-server-collector - claude-mcp-repl 🐍 🏠 - A python/shell/perl MCP written by Claude itself
pythonmcppip install git+https://github.com/lyuhau/claude-mcp-repl - Claude-MCP-server-test 🏠 - A simple coming soon website for testing
htmlwebtestinggit clone https://github.com/sudhanbhandari0/Claude-MCP-server-test - daikw_mcp-server-on-raspi 🐍 🏠 - Mirror of https://github.com/daikw/mcp-server-on-raspi
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/daikw_mcp-server-on-raspi - DMontgomery40_mcp-local-server 🐍 🏠 - Mirror of https://github.com/DMontgomery40/mcp-local-server
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/DMontgomery40_mcp-local-server - duan-li_mcp-weather-server-example 🐍 🏠 - Mirror of https://github.com/duan-li/mcp-weather-server-example
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/duan-li_mcp-weather-server-example - github-mcp-server-practice 🐍 🏠 - Practice repository for MCP server implementation
pythonmcpserverpip install git+https://github.com/soso0024/github-mcp-server-practice - gowtham3105_mcp_server_opensearch 🐍 🏠 - Mirror of https://github.com/gowtham3105/mcp_server_opensearch
pythonmcpserverhttpgopip install git+https://github.com/MCP-Mirror/gowtham3105_mcp_server_opensearch - hackernew-mcp 🏠 - AI Friendly MCP Server for Hacker News
mcpserveraigit clone https://github.com/yunfanye/hackernew-mcp - mcp-server 🐍 🏠 - 一系列 mcp 服务 (Python-based)
pythonmcppip install git+https://github.com/DreamCats/mcp-server - mcp-pagerduty 🐍 🏠 - A Model Context Protocol (MCP) server that provides integration with PagerDuty for incident management and monitoring operations.
pythonmcpservermonitoringpip install git+https://github.com/judexzhu/mcp-pagerduty - mcp-pdf2pics 🐍 🏠 - pdf to pictures mcp server
pythonmcpserverpip install git+https://github.com/gfhe/mcp-pdf2pics - mcp-playground 🐍 🏠 - Core MCP Server with React Frontend and Multi-Agent Support
pythonmcpserverreactpip install git+https://github.com/skolte/mcp-playground - mcp-proxmox 🐍 🏠 - mcp server for interfacing with proxmox
pythonmcpserverpip install git+https://github.com/johnstetter/mcp-proxmox - mcp-sample 🐍 🏠 - The minimal mcp server sample for learning
pythonmcpserverpip install git+https://github.com/Hinaser/mcp-sample - mcp-scratchpad 🐍 🏠 - A scratchpad repository for MCP clients/servers.
pythonmcpserverpip install git+https://github.com/cpaulisi/mcp-scratchpad - mcp-sentiment 🐍 🏠 - MCP server to facilitate Sentiment Analysis
pythonmcpserverpip install git+https://github.com/shubhamagr24/mcp-sentiment - MCP-Recon-Client 🐍 🏠 - Client for communicating with MCP-Recon-Server
pythonmcpserverpip install git+https://github.com/seyrup1987/MCP-Recon-Client - MCP-Recon-Server 🐍 🏠 - MCP server with tools for domain reconnaissance
pythonmcpserveraipip install git+https://github.com/seyrup1987/MCP-Recon-Server - mcp-protocol-server 🐍 🏠 📇 - A Model Context Protocol server implementation with FastAPI
pythonserverapipip install git+https://github.com/tian1ll1/mcp-protocol-server - mcp-python-server 🐍 🏠 - mcp and python test server
pythonmcpserverpip install git+https://github.com/rohanjoackhim/mcp-python-server - mcp-risk-calculator 🏠
htmlgit clone https://github.com/Guhan4396/mcp-risk-calculator - mcp-searxng-tool 🏠 - 一個用來讓 AI Agent 可透過 SearXNG 服務來搜尋外部網站內容與資訊的 MCP server 。
mcpserveraigit clone https://github.com/erhwenkuo/mcp-searxng-tool - mcp-server 🐍 🏠 - This repository hosts the “Weapon Recoil Generator” MCP Server deployed on Smithery.
pythonmcpserverpip install git+https://github.com/Hyeongseob91/mcp-server - MCP-Server 🐍 🏠 - MCP Server for tool calling
pythonmcpserverpip install git+https://github.com/datzii/MCP-Server - mcp-server 🐍 🏠 - 4-openai-integration
pythonaipip install git+https://github.com/Robinson777-prog/mcp-server - mcp-server 🐍 🏠 - SSAFY 학생들을 위한 프로젝트 포트폴리오 및 면접 준비 도우미 서버
pythonpip install git+https://github.com/wonnyboi/mcp-server - MCP-Server 🐍 🏠 - Sử dụng MCP Server & Agent LangChain/LangGraph
pythonmcpserveraipip install git+https://github.com/ThangQT2606/MCP-Server - mcp-server-deepseek 🐍 🏠 - A MCP server provides access to DeepSeek-R1's reasoning capabilities for LLMs
pythonmcpserverllmpip install git+https://github.com/tizee/mcp-server-deepseek - mcp-server 🐍 🏠 📇 - Zyla API Hub MCP Server
pythonmcpserverapipip install git+https://github.com/Zyla-Labs/mcp-server - mcp-server 🐍 🏠 - FereAI's MCP Server - The most powerful Crypto MCP Server.
pythoncryptomcpmcp-serverserverpip install git+https://github.com/fere-ai/mcp-server - mcp-server 🐍 🏠 - mcp-server : tools, resources, prompts
pythonmcpserverpip install git+https://github.com/mcp-ruah/mcp-server - mcp-server 🐍 🏠 - complete mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/ugundhar/mcp-server - mcp-server 🐍 🏠 - MCP server that allows you to get the latest documentation
pythonmcpserverdocumentationpip install git+https://github.com/egeokt/mcp-server - mcp-server 🐍 🏠 - example mcp server for claude
pythonmcpserverpip install git+https://github.com/sauravfouzdar/mcp-server - mcp-server 🐍 🏠 - Python MCP Server
pythonmcpserverpip install git+https://github.com/kongo97/mcp-server - mcp-server 🐍 🏠 - This project implements an MCP-compliant server that allows AI models to discover and invoke tools through a standardized protocol. The server is designed to be modular, with each tool implemented as a separate Python module.
pythonmcpserveraipip install git+https://github.com/sampad1990/mcp-server - mcp-server 🐍 🏠 - This is a repository for mcp servers
pythonmcpserverpip install git+https://github.com/avinash539/mcp-server - mcp-server 🐍 🏠 - A simple AI-powered sticky notes app using MCP (Model Context Protocol) to add, read, delete, and summarize notes through Claude Desktop.
pythonmcpaipip install git+https://github.com/itsmerizzi/mcp-server - mcp-server 🐍 🏠 - With this MCP, you can debug your application by querying any issue to an LLM using the latest documentation available on the web. We currently support LangChain, LlamaIndex, and OpenAI docs, but you can add any other sources as needed.
pythonmcpwebaillmpip install git+https://github.com/JeanVittory/mcp-server - MCP-Server 🐍 🏠 - doing something with MCP server
pythonmcpserverpip install git+https://github.com/21520894/MCP-Server - mcp-server-calculator 🐍 🏠 - Demo of a local running MCP Server
pythonmcpserverpip install git+https://github.com/simonberner/mcp-server-calculator - mcp-server-demo 🐍 🏠 - MCP server basic demo with stdio and sse transports
pythonmcpserverpip install git+https://github.com/chaitanya1731/mcp-server-demo - mcp-server-101 🐍 🏠 - an mcp server serving tools to manage AWS account
pythonmcpserverawspip install git+https://github.com/mounirelbakkali1/mcp-server-101 - MCP-server 🐍 🏠 - everyday series assignment
pythonpip install git+https://github.com/ds231/MCP-server - mcp-server-again 🐍 🏠 - mcp-server-again (Python-based)
pythonmcpserveraipip install git+https://github.com/seemanttripathi/mcp-server-again - mcp-server-customer-db 🐍 🏠 - Experiment with MCP for an internal customer database
pythonmcpdatabasepip install git+https://github.com/Marcelixoo/mcp-server-customer-db - MCP-server 🐍 🏠 - MCP server setup (Python-based)
pythonmcpserverpip install git+https://github.com/wubbyweb/MCP-server - MCP-Server-AI 📜 🏠 - A Simple Model Context Server (MCP) For AI Usecases
javascriptaiai-agentanthropicmcpnpm install kabragaurav/MCP-Server - mcp-server-danchoicloud 🐍 🏠 - MCP Server (Python-based)
pythonai-agentmcpserverpip install git+https://github.com/hoangndst/mcp-server-danchoicloud - mcp-server-demo 🐍 🏠 📇 - 一个基于MCP框架的服务器演示项目,提供了简单的API接口实现,包括数字运算、时间查询、订单信息查询等功能。
pythonmcpapipip install git+https://github.com/raycao871218/mcp-server-demo - mcp-server-demo 🏠 - Le protocole MCP permet aux applications de fournir un contexte aux LLM de manière standardisée, en dissociant la fourniture du contexte de l'interaction réelle avec le LLM. Ce SDK Python implémente l'intégralité de la spécification MCP,
mcpllmpythongit clone https://github.com/mamouddiallo/mcp-server-demo - MCP-server-HF-papers 🏠 - This repository is an MCP server that let's me talk to HF daily papers via WhatsApp.
mcpserveraigit clone https://github.com/amaarora/MCP-server-HF-papers - mcp-server-letter-counter 🐍 🏠 - MCP server to count letters
pythonmcpserverpip install git+https://github.com/higherpass/mcp-server-letter-counter - mcp-server-learn 🐍 🏠 - Python-based
pythonpip install git+https://github.com/netr/mcp-server-learn - mcp-server-moke-wenshu 🏠 - MokeWenShu is an AI-powered analysis tool for China Judgments Online, leveraging NLP and legal knowledge graphs to enable conversational document analysis, similar-case pattern mapping, and visualized judgment trend tracking, delivering dynamic insights for legal decision-making.
aigit clone https://github.com/gzfutureai/mcp-server-moke-wenshu - mcp-server-oxigraph 🐍 🏠 - MCP server for connecting to Oxigraph
pythonmcpserverpip install git+https://github.com/identimoji/mcp-server-oxigraph - mcp-servers 🐍 🏠 - My MCP servers (Python-based)
pythonmcpserverpip install git+https://github.com/goofansu/mcp-servers - mcp-servers-manager 🐍 🏠 - MCP Servers Manager (Python-based)
pythonmcpserverpip install git+https://github.com/betimd/mcp-servers-manager - mcp-server-presupuesto-mysql1 🐍 🏠 - mcp-server-presupuesto-mysql1
pythonmcpservermysqlpip install git+https://github.com/w2pwinlinux/mcp-server-presupuesto-mysql1 - mcp-server-search 🐍 🏠 - MCP server to use a search engine to obtain locations of relevant information on the internet
pythonmcpserveraipip install git+https://github.com/MaartenSmeets/mcp-server-search - mcp-server-talk 🏠 - Tech Talk about MCP servers
htmlmcpservergit clone https://github.com/SwonVIP/mcp-server-talk - mcp-server-with-amazon-bedrock-agent 🐍 🏠 - mcp server with amazon bedrock agent
pythonmcpserverpip install git+https://github.com/shridharMe/mcp-server-with-amazon-bedrock-agent - mcp-servers-experiments 🐍 🏠 - this repo contains my experiments with mcp servers
pythonmcpserveraipip install git+https://github.com/HarshTomar1234/mcp-servers-experiments - mcp-server-email 🐍 🏠 - Give your AI assistant an email address
pythonaipip install git+https://github.com/RKeelan/mcp-server-email - mcp-sop-server 🐍 🏠 - A Model Context Protocol (MCP) server for accessing and searching Standard Operating Procedures (SOPs) with Italian language support.
pythonmcpserverpip install git+https://github.com/dadapera/mcp-sop-server - mcp-server-demo 🐍 🏠 - A demonstration server implementing the Model Context Protocol (MCP)
pythonmcpserverpip install git+https://github.com/tian1ll1/mcp-server-demo - mcp-server-dynamic-env 🐍 🏠 - Kubernetes MCP server for managing DynamicEnv custom resources with real-time updates and AI-driven integration.
pythonmcpserveraikubernetespip install git+https://github.com/yonathan-shtekel/mcp-server-dynamic-env - mcp-server-playbook-2025 🐍 🏠 - Model Context Protocol Quick Start Guide - 2025
pythonpip install git+https://github.com/munganaai/mcp-server-playbook-2025 - mcp-server-say-hello-py 🐍 🏠 - The most simple ModelContext Protocol server example, just say hello to user. Written by python
pythonserverpip install git+https://github.com/BrightLin/mcp-server-say-hello-py - mcp-server-poc-projects 🐍 🏠 - Simple POC Projects w/ stdio transports for Desktop
pythonpip install git+https://github.com/ahmedmusawir/mcp-server-poc-projects - mcp-server-python-demo 🐍 🏠 - This is a demo of an MCP server using Python, intended to be tested with vscode Copilot in Agent mode
pythonagent-modecopilotcopilot-chatdevboxpip install git+https://github.com/legomb/mcp-server-python-demo - mcp-server-strava 🐍 🏠 📇 - Интеграция Strava API с Model Context Protocol SDK
pythonapipip install git+https://github.com/rbctmz/mcp-server-strava - mcp-server-test 🐍 🏠 - hyeongseob's mcp test server repo.
pythonmcpserverpip install git+https://github.com/Hyeongseob91/mcp-server-test - Mcp-Server-Study 🐍 🏠 - 个人学习MCP (Python-based)
pythonmcppip install git+https://github.com/uoky5217/mcp_server - mcp-server-test 🐍 🏠 - MCP サーバーのテスト (Python-based)
pythonmcppip install git+https://github.com/i-icc/mcp-server-test - mcp-server-test 🐍 🏠 - Référentiel de test pour l'intégration MCP server GitHub
pythonmcpserverpip install git+https://github.com/Erkkul/mcp-server-test - mcp-server-test 🏠 - MCP server test repository
htmlmcpservergit clone https://github.com/khanhlenhut/mcp-server-test - MCP-Server-TEST1 🐍 🏠 - testing mcp-server functionality venice and gemini (images)
pythonmcpservertestingpip install git+https://github.com/jhacksman/MCP-Server-TEST1 - mcp-server-trfrmarket 🐍 🏠 - An MCP server for transfer market based on popular R package & some other decorations
pythonmcpserverpip install git+https://github.com/abhishek9909/mcp-server-trfrmarket - mcp-server-weather 🐍 🏠 - MCP server to get wearer forecast.
pythonmcpserverpip install git+https://github.com/debanshu005/mcp-server-weather - mcp-server-yahoo-finance 🐍 🏠 - MCP Yahoo Finance Server and UI
pythonmcpserverpip install git+https://github.com/quartermaine/mcp-server-yahoo-finance - mcp-server-youtube 🐍 🏠 - An MCP Server for personal YouTube feeds via OAuth
pythonmcpserverauthoauthpip install git+https://github.com/saginawj/mcp-server-youtube - MCP-SERVER-YOUTUBE 🐍 🏠 - MCP SERVER IMPLEMENTATION FOR YOUTUBE INTEGRATION
pythonmcpserverpip install git+https://github.com/Ryuzaki1415/MCP-SERVER-YOUTUBE - mcp-servers 🐍 🏠 - My MCP servers (Python-based)
pythonmcpserverpip install git+https://github.com/WillChangeThisLater/mcp-servers - mcp-servers 🐍 🏠 - Collection of Model Context Protocol (MCP) servers for Cline, Roo, and Claude Desktop
pythonmcpserverpip install git+https://github.com/mows21/mcp-servers - mcp-servers 🐍 🏠 - Dockerized MCP servers for portability
pythonmcpserverdockerpip install git+https://github.com/m0r6aN/mcp-servers - mcp-spring 🏠 - This project primarily serves as a demonstration of setting up Spring MCP. It focuses on the setup and usage of the MCP client and MCP server modules.
htmlmcpservergit clone https://github.com/bxmzero/mcp-spring - mcp-servers 🐍 🏠 - MCP Server building examples
pythonmcpserverpip install git+https://github.com/KalyanbrataMaity/mcp-servers - mcp-servers 🐍 🏠 - MCP Servers (Python-based)
pythonmcpserverpip install git+https://github.com/andrelbraga/mcp-servers - mcp-servers 🐍 🏠 - MCP Servers for dev work
pythonmcpserverpip install git+https://github.com/prasoon2211/mcp-servers - mcp-simple-arxiv-client 🐍 🏠 - A simple Python client to interact with the arXiv MCP server.
pythonmcpserverpip install git+https://github.com/om4r932/mcp-simple-arxiv-client - mcp-snowflake-reader 🐍 🏠 - A Model Context Protocol (MCP) server that provides secure, read-only access to Snowflake databases. Allows LLMs to safely query tables and describe schemas without write permissions. Built with Python and the official Snowflake SDK.
pythonmcpserverdatabasellmpip install git+https://github.com/fnf-deepHeading/mcp-snowflake-reader - mcp-sondehub 🐍 🏠 📇 - A MCP Server for the SondeHub API primarily to experiment with MCP
pythonmcpserverapipip install git+https://github.com/LukePrior/mcp-sondehub - mcp-sse-langchain-example 🐍 🏠 - Example of using MCP servers, both over sdio + sse. Also using langchain-mcp
pythonmcpserveraipip install git+https://github.com/fredrikp999/mcp-sse-langchain-example - mcp-sysinfo 🐍 🏠 - MCP Server to get system info
pythonmcpserverpip install git+https://github.com/allenbijo/mcp-sysinfo - mcp-talib 🏠 - A Model Context Protocol (MCP) server that provides the functions of the ta-lib-python
mcpserverpythongit clone https://github.com/Jung-YongHan/mcp-talib - mcp-tap-server 🏠 - This is an MCP-Server adapter provided by TapData for use with LLM's
mcpserverllmgit clone https://github.com/tapdata/mcp-tap-server - mcp-token-api 🐚 🏠
shellaiblockchainmcpthegraphgit clone https://github.com/pinax-network/mcp-token-api - mcpTerm 🐍 🏠 - a cli for interacting with mcp servers using your favourite llms
pythonmcpserverllmpip install git+https://github.com/VivekMara/mcpTerm - medical-mcp 🐍 🏠 - Python-based
pythonpip install git+https://github.com/chris-lovejoy/medical-mcp - model-context-protocol 🐍 🏠 - Model Context Protocols for Cursor
pythongit clone https://github.com/ericaxelrod-1/model-context-protocol - mutation-clinical-trial-matching-mcp 🐍 🏠 - MCP server to query clinicaltrial.gov to identify mutation specific trials
pythonagentic-codingai-assistantclaude-desktopclinicaltrialsgovpip install git+https://github.com/pickleton89/mutation-clinical-trial-matching-mcp - mcp-thisweek 🐍 🏠 - A simple MCP (Model Context Protocol) that returns the dates from Monday to Friday of this week, and today's date.
pythonmcppip install git+https://github.com/taku-o/mcp-thisweek - mcpm 🐍 🏠 - MCP Manager tool, to faciliate installing, runnning and managing MCP servers
pythonmcpserverpip install git+https://github.com/musdechocolate/mcpm - mcpserver_udemy 🐍 🏠 - Udemy training on building MCP Servers
pythonmcpserveraipip install git+https://github.com/Wendelius/mcpserver_udemy - mcpserver-AngleOne 🐍 🏠 - Local MCP server connecting to Angle One SDK
pythonmcpserverpip install git+https://github.com/ankushCodeX/mcpserver-AngleOne - MCPServerTest 🐍 🏠 - It is a test MCP server.
pythonmcpserverpip install git+https://github.com/KORONEzyy/MCPServerTest - model-context-playground 🐍 🏠 - Playing around with MCP clients and servers
pythonmcpservergit clone https://github.com/jsnyde0/model-context-playground - mvn-mcp-server 🐍 🏠 - MCP Server to communicate with Maven Central Feed
pythonmcpserverpip install git+https://github.com/danielscholl/mvn-mcp-server - MySQL-MCP-Server 🐍 🏠 - Custom MCP Server for MySQL
pythonmcpservermysqlpip install git+https://github.com/gopikapeenikkal/MySQL-MCP-Server - MCP-template 🐍 🏠 - A template project to create MCP server and client projects
pythonmcpserverpip install git+https://github.com/wubbyweb/MCP-template - mcp-test-openshift 🐍 🏠 - Red Hat Openshift test for MCP server
pythonmcpserverpip install git+https://github.com/blumareks/mcp-test-openshift - MCP-to-Langchain-addapter 🐍 🏠 - Addapter that turns MCP server tools into langchain usable tools
pythonmcpserveraipip install git+https://github.com/SDCalvo/MCP-to-Langchain-addapter - mcp-tools-server 🏠 - In this repository I want to create my personalized tools for llms
llmgit clone https://github.com/Dkuaik/mcp-tools-server - mcp-window-screenshooter 🐍 🏠 - 🔄 Mirror of GitLab repo - Please visit GitLab for issues/PRs
pythongitlab-mirrorpip install git+https://github.com/Tiartyos/mcp-window-screenshooter - mcp-weather-app 🐍 🏠 - Learning about MCP servers.
pythonmcpserverpip install git+https://github.com/daycyberwox/mcp-weather-app - mcpcloudtools 🐍 🏠 - Dynamically generate and test MCP tools in real time from cURL inputs using a simple FastAPI Web Application.
pythonclouddynamic-toolsfastapimcp-clientpip install git+https://github.com/risabhmishra/mcpcloudtools - MCP-Transformers 🐍 🏠 - LangChain wrapper for seamless integration MCP-servers with different open-source large language models from transformers library.
pythonmcpserveraimlpip install git+https://github.com/getStRiCtd/MCP-Transformers - mcp-weather 🐍 🏠 - 一個給 AI Agent 使用的 MCP Server 範例,用來取得美國各州的天氣預報與警示資訊
pythonmcpserveraipip install git+https://github.com/erhwenkuo/mcp-weather - mcp-weather-server 🐍 🏠 - This repository contains files for building an MCP server for weather tasks.
pythonmcpserveraipip install git+https://github.com/RoystonDAlmeida/mcp-weather-server - mcp-yfinance 🐍 🏠 - An MCP tool wrapping a common yFinance Ticker history call.
pythonmcppip install git+https://github.com/nicholasf/mcp-yfinance - mcp-weather-server 🐍 🏠 - An example Model Context Protocol server that provides weather data to LLMs.
pythonserverllmpip install git+https://github.com/MiesnerJacob/mcp-weather-server - mcp-web-integration 🐍 🏠 - A collection of web integration tools for Model Context Protocol (MCP).
pythonmcpwebpip install git+https://github.com/DeanXu2357/mcp-web-integration - mcp-web-tool-python 🐍 🏠 - Python-based
pythonpip install git+https://github.com/ground-creative/mcp-web-tool-python - mcp-ynu 🐍 🏠 - Python-based
pythonpip install git+https://github.com/ynu/mcp-ynu - MCPExec 🐍 🏠 - MCP Server to exec local cli commands
pythonmcpserverpip install git+https://github.com/0xBruno/MCPExec - mcpgo 🐹 🏠 - Server side MCP implementation for Golang
goaianthropicllmmcpgo install Southclaws/mcpgo@latest - mcpserver 🐍 🏠 - A sample MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/Vinayak9769/mcpserver - MCPServer 🐍 🏠 - A Simple MCP Server for enabling agentic workflow
pythonmcpserverpip install git+https://github.com/ganesh-karthick/MCPServer - mcp-weather-server-example 🐍 🏠 - Claude Model Context Protocol Weather Server Example
pythonserverpip install git+https://github.com/duan-li/mcp-weather-server-example - mcpi-server-list 🏠
htmlgit clone https://github.com/PythonScratcher/mcpi-server-list - mcps-playground 🏠 - MCP Playground: Experiment with Anthropic's Claude & Model Context Protocol. Chat, connect servers, test tools.
cloudflaremcpmcp-clientmcp-cloudflaremcp-servergit clone https://github.com/bighadj22/mcps-playground - mcptime 🐍 🏠 - SImple MCP server to return the current time
pythonmcpserverpip install git+https://github.com/troyharris/mcptime - MCPUltimate 🏠 - Ultimate MCP server aimed at stateful agents and managing vast workspaces
mcpserveraigit clone https://github.com/CryingSurrogate/MCPUltimate - merlin 🐍 🏠 - HTTP Only Implementation of MCP v0.3
pythonmcphttpgit clone https://github.com/elevate-human-experiences/only_mcp - mcpwrap 🐍 🏠 - Python-based
pythonpip install git+https://github.com/K-Mistele/example-mcp - mcss-mcp-server 🐍 🏠 - Model Context Protocol server for MCSS (Minecraft Server Soft)
pythonserverpip install git+https://github.com/largeorbitalobject/mcss-mcp-server - Medical_calculator_MCP 🐍 🏠 - MCP server for medical calculations
pythonmcpserverpip install git+https://github.com/johnyquest7/Medical_calculator_MCP - medieage_supabase-mcp-server 🐍 🏠 - Mirror of https://github.com/medieage/supabase-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/medieage_supabase-mcp-server - medullar-mcp-server 🐍 🏠 - Medullar MCP Server (Python-based)
pythonmcpserverpip install git+https://github.com/medullar/medullar-mcp-server - memento-mcp-oauth 🏠 - Memento MCP Server with OAuth authentication for Claude.ai
mcpserveraiauthoauthgit clone https://github.com/odenizo/memento-mcp-oauth - memes-mcp 🐍 🏠 - MCP Server for memes.bupt.site
pythonmcp-servermememcpserverpip install git+https://github.com/wangzhigang1999/memes-mcp - mermaid-mcp-server 🏠
git clone https://github.com/longjianjiang/mermaid-mcp-server - mermaid-preview-mcp 🏠 - MCP server for previewing Mermaid diagrams with syntax error handling. Supports GitHub repository visualization.
mcpserveraigit clone https://github.com/jptrainers/mermaid-preview-mcp - miguelyad26_alpaca-mcp-server 🐍 🏠 - Mirror of https://github.com/miguelyad26/alpaca-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/miguelyad26_alpaca-mcp-server - mikemc_todoist-mcp-server 🐍 🏠 - Mirror of https://github.com/mikemc/todoist-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/mikemc_todoist-mcp-server - mikecreighton-dot-com-content-mcp 🐍 🏠 - A Model Context Protocol (MCP) server that will provide all of the Mike Creighton Consulting website pages as Resources to any MCP clients.
pythonmcpserverwebpip install git+https://github.com/mikecreighton/mikecreighton-dot-com-content-mcp - Mineru98_mysql-mcp-server 🐍 🏠 - Mirror of https://github.com/Mineru98/mysql-mcp-server
pythonmcpserverhttpmysqlpip install git+https://github.com/MCP-Mirror/Mineru98_mysql-mcp-server - mingdedi_InternetSearch-mcp-server 🐍 🏠 - Mirror of https://github.com/mingdedi/InternetSearch-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/mingdedi_InternetSearch-mcp-server - minhalvp_android-mcp-server 🐍 🏠 - Mirror of https://github.com/minhalvp/android-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/minhalvp_android-mcp-server - minio_mcp-server-aistor 🏠 - Mirror of https://github.com/minio/mcp-server-aistor
mcpserveraihttpgit clone https://github.com/MCP-Mirror/minio_mcp-server-aistor - mix-mcp-server 🐍 🏠 - This is the simplest mcp server in the world to get local current time.
pythonmcpserverpip install git+https://github.com/qiaoliang/mix-mcp-server - mla-mcp 🐍 🏠 - Python-based
pythonpip install git+https://github.com/ml-alpha/mla-mcp - model_context_protocol_examples 🐍 🏠 - Some examples to build server, client test in model context protocol. Một số ví dụ sử dụng MCP
pythonmcpservergit clone https://github.com/anhnx000/model_context_protocol_examples - model-context-protocol 🐍 🏠 - A custom server project built using the Model Context Protocol (MCP) in Python. This repository documents my learning, experiments, and development progress.
pythonmcpservergit clone https://github.com/PyBhagya/model-context-protocol - model-context-protocol 🐍 🏠 - Implementation of Anthropic's Model Context Protocol
pythonanthropicanthropic-claudeclaudefastmcpgit clone https://github.com/arkapatra31/model-context-protocol - MultiAgent_MCP_Langgraph 🐍 🏠 - Multi Agents with MCP servers implementation using Langgraph
pythonmcpserverpip install git+https://github.com/rakeshrau/MultiAgent_MCP_Langgraph - my_mcp 🐍 🏠 - My MCP server repository
pythonmcpserverpip install git+https://github.com/whmyb6666/my_mcp - mongo-mcp 🐍 🏠 - Python-based
pythonpip install git+https://github.com/nick887/mongo-mcp - mock-assistant-mcp-server 📘 🏠 - mcp server assistant for mock data
typescriptaimcp-servermcpservernpm install ogulcanarbc/mock-assistant-mcp-server - moyu6027_deepseek-MCP-server 🐍 🏠 - Mirror of https://github.com/moyu6027/deepseek-MCP-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/moyu6027_deepseek-MCP-server - mprokopov_ledger-mcp-server 🐍 🏠 - Mirror of https://github.com/mprokopov/ledger-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/mprokopov_ledger-mcp-server - MRConfluenceLinker-mcp-server 🐍 🏠 - Python-based
pythonpip install git+https://github.com/CodeByWaqas/MRConfluenceLinker-mcp-server - my-mcp-server 📘 🏠 - My MCP Server POC (TypeScript-based)
typescriptanthropic-ai-sdkcloudflare-workershonojsopenainpm install quang-pham-dev/my-mcp-server - my-mcp-servers 🐍 🏠 - A collection of my MCP servers.
pythonmcpserverpip install git+https://github.com/nengelmann/my-mcp-servers - my-mcp-setup 🏠 - My MCP (Model Context Protocol) server setup for local environment to automate anything by LLM
mcpserverllmgit clone https://github.com/ntsd/my-mcp-setup - myanimelist-mcp 🏠 - MCP server for myanimelist integration with LLMs
mcpserverllmgit clone https://github.com/davilbs/myanimelist-mcp - Notion-MCP 🐍 🏠 📇 - A simple MCP server that integrates with Notion's API to manage my personal habit track.
pythonmcpserverapipip install git+https://github.com/phoenine/Notion-MCP - p6xer-mcp-server 🐍 🏠 - This is the Model Context Protocol (MCP) Server for P6 XER files, exposes machine-readable MCP manifests for PyP6XER's modules for use by AI models.
pythoncpmmcpmcp-serverp6pip install git+https://github.com/osama-ata/p6xer-mcp-server - NeuroMCP 🔷 🏠 - NeuroMCP (Neural Model Context Protocol) is a collection of specialized microservices that enable AI agents to interact with various backend systems through a standardized API.
c#aiazure-devopsazure-devops-mcpc-sharpgit clone https://github.com/AhmedKhalil777/NeuroMCP - News-MCP-Server 🐍 🏠 📇 - MCP-server for nyhetsanalyse med AI-integrasjon – henter artikler, genererer sammendrag og lager tidslinjer ved hjelp av NewsAPI og Claude AI.
pythonmcpserverapiaipip install git+https://github.com/Danieljoh98/News-MCP-Server - note-manger-mcp-server 🐍 🏠 - MCP Server for a note management application that integrates with Agents with MCP client integration - Tested with Claude Desktop
pythonmcpserverpip install git+https://github.com/ximanta/note-manger-mcp-server - nova-act-mcp 🐍 🏠 - Nova Act MCP Server on ECS Fargate
pythoncdkmcp-servernova-actplaywrightpip install git+https://github.com/awsdataarchitect/nova-act-mcp - obsidian-mcp-server 🐍 🏠 - MCP (Model Context Protocol) server for Obsidian notes access via CouchDB LiveSync
pythonmcpserverpip install git+https://github.com/roelven/obsidian-mcp-server - nutritionix_mcp 🐍 🏠 📇 - MCP Server and Client for Nutritionix API v2
pythonmcpserverapipip install git+https://github.com/GuptaPurujit/nutritionix_mcp - openapi2mcp 🐍 🏠 📇 - Automatically generate FAST Model-Context-Protocol (MCP) servers from OpenAPI/Swagger specs.
pythonmcpserverapipip install git+https://github.com/VitalyMalakanov/openapi2mcp - spotify_mcp 🐍 🏠 - MCP Server to control Spotify
pythonmcpserverpip install git+https://github.com/jmoro0408/spotify_mcp - spring-ai-mcp-poc 🏠 - Spring AI Model Context Protocol (MCP) Proof of Concept with GitHub MCP Server
htmlmcpserveraigit clone https://github.com/shesadri/spring-ai-mcp-poc - Spotify-MCP-Server 🐍 🏠 - A server that enables AI assistants to interact with Spotify via the Model Context Protocol (MCP). It allows fetching current playback, controlling playback, and accessing user playlists.
pythonmcpserveraipip install git+https://github.com/Shrau1711/Spotify-MCP-Server - sqlite-mcp 🐍 🏠 - A lightweight Model Context Protocol (MCP) server that enables Large Language Models (LLMs) to autonomously interact with SQLite databases.
pythonmcpserverdatabasellmpip install git+https://github.com/dubydu/sqlite-mcp - stocks-mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/natifridman/stocks-mcp - subtitle-mcp 🐍 🏠 - This is a MCP Server for ETL(Extract Translate and Load)
pythonmcpserverpip install git+https://github.com/onebirdrocks/subtitle-mcp - ssh-tools-mcp 🐍 🏠 - SSH tools and utilities for MCP servers
pythonmcpserverpip install git+https://github.com/lightfate/ssh-tools-mcp - StarRocks_mcp-server-starrocks 🐍 🏠 - Mirror of https://github.com/StarRocks/mcp-server-starrocks
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/StarRocks_mcp-server-starrocks - steamstats-mcp 🐍 🏠 📇 - MCP Server for Steam Web API Game Statistics
pythonmcpserverapiwebpip install git+https://github.com/algorhythmic/steamstats-mcp - strava-mcp 🐍 🏠 - An MCP server for Strava users
pythonmcpserverpip install git+https://github.com/anton-mcquinn/strava-mcp - soso0024_github-mcp-server-practice 🐍 🏠 - Mirror of https://github.com/soso0024/github-mcp-server-practice
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/soso0024_github-mcp-server-practice - spencerhhubert_illustrator-mcp-server 🐍 🏠 - Mirror of https://github.com/spencerhhubert/illustrator-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/spencerhhubert_illustrator-mcp-server - ssb-mcp 🏠 📇 - MCP server for interacting with Statistics Norway (SSB) API - enabling AI agents to access Norwegian statistical data
mcpserverapiaigit clone https://github.com/haakonjacobsen/ssb-mcp - tatn_mcp-server-fetch-python 🐍 🏠 - Mirror of https://github.com/tatn/mcp-server-fetch-python
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/tatn_mcp-server-fetch-python - Testing-of-FakePixelPe-Mcpe-Server 🏠 - I am Abinanda and I am Main Head of The project so I am Trying to make a Server like Hypixel in Mcpe With Private and Public+Paid Plugins
mcpserveraigit clone https://github.com/LoveZero29/Testing-of-FakePixelPe-Mcpe-Server - thailand-earthquake-mcp 🏠 - MCP Server for Thailand Meteorological Department earthquake data - เซิร์ฟเวอร์ MCP สำหรับดึงข้อมูลแผ่นดินไหวจากกรมอุตุนิยมวิทยา
mcpserveraigit clone https://github.com/aekanundatascience/thailand-earthquake-mcp - uupt-mcp-freight-server 🐍 🏠 - Python-based
pythonpip install git+https://github.com/uupt-mcp/uupt-mcp-freight-server - sugarforever_amap-mcp-server 🐍 🏠 - Mirror of https://github.com/sugarforever/amap-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/sugarforever_amap-mcp-server - tesla-mcp-server 🐍 🏠 📇 - MCP Server for Tesla Products, specifically using the Owner API
pythonmcpmcp-serverteslatesla-apipip install git+https://github.com/robcerda/tesla-mcp-server - transportnsw-mcp 🐍 🏠 📇 - A Model Context Protocol (MCP) implementation for some useful Transport NSW API endpoints.
pythonmcpapipip install git+https://github.com/danhussey/transportnsw-mcp - surveymars-mcp 🐍 🏠 📇 - Official SurveyMars Model Context Protocol (MCP) server that enables interaction with SurveyMars APIs. This server allows MCP clients like Claude Desktop, Cursor, Windsurf, OpenAI Agents and others to create, distribute, and analyze surveys.
pythonmcpserverapiaipip install git+https://github.com/surveymars/surveymars-mcp - tasks-mcp 🐍 🏠 - A tasks creation mcp server
pythonmcpserverpip install git+https://github.com/dev-hack95/tasks-mcp - template-mcp-server 🐍 🏠 - Template for creating Model Context Protocol (MCP) servers
pythonmcpserverpip install git+https://github.com/djaboxx/template-mcp-server - tess-mcp-server 🐍 🏠 📇 - Servidor MCP para integração com a API TESS, permitindo utilizar agentes TESS via protocolo MCP
pythonmcpapipip install git+https://github.com/diegofornalha/tess-mcp-server - test_mcp_servers_git 🐍 🏠 - A repository for testing MCP servers
pythonmcpservertestingpip install git+https://github.com/sumitsatapathy/test_mcp_servers_git - thingsboard-mcp-server 🐍 🏠 - Thingsboard MCP Server
pythonmcpserverpip install git+https://github.com/akashtalole/thingsboard-mcp-server - time-mcp 🐍 🏠 - MCP Server which returns current timestamp with streamlit app
pythonmcpservermlpip install git+https://github.com/suryawanshishantanu6/time-mcp - test-mcp 🏠 - test mcp servers and tokens used
htmlmcpservergit clone https://github.com/287852793/test-mcp - ThirdBrAIn-MCPSERVERS-IQ 🐍 🏠 - MCP Servers focused collection of repo's (using git-subrepo for easy updating --ALL)
pythonmcpserverpip install git+https://github.com/cbruyndoncx/ThirdBrAIn-MCPSERVERS-IQ - time_fastmcp_server 🐍 🏠 - Used FastMCP to replicate the official repo's Time Mcp Server feature.
pythonmcpserverpip install git+https://github.com/fykong/time_fastmcp_server - todo-mcp-server 🐍 🏠 - This repository provides an MCP (Model Context Protocol) server for interacting with the Todo App through Claude and other MCP-compatible AI tools. This project allows AI agents to access and manage todos using the standardized MCP interface.
pythonmcp-servertodo-appmcpserverpip install git+https://github.com/Adhishtanaka/todo-mcp-server - time-mcp 🐍 🏠 - MCP server - make Claude tell the time! Highly reliable and consistent.
pythonmcpserverpip install git+https://github.com/samay58/time-mcp - ultimate-team-mcp-server 🐍 🏠 - FDU Utils (Python-based)
pythonpip install git+https://github.com/msaelices/ultimate-team-mcp-server - us_stock_mcp_server 🐍 🏠 - Python-based
pythonpip install git+https://github.com/mingyaw/us_stock_mcp_server - StrongApps_MCPE_servers 🏠 - Mirror of https://github.com/StrongApps/MCPE_servers
htmlmcpserverhttpgit clone https://github.com/MCP-Mirror/StrongApps_MCPE_servers - Sunwood-ai-labs_mcp-weather-service-server 🐍 🏠 - Mirror of https://github.com/Sunwood-ai-labs/mcp-weather-service-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/Sunwood-ai-labs_mcp-weather-service-server - TakumiY235_uniprot-mcp-server 🐍 🏠 - Mirror of https://github.com/TakumiY235/uniprot-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/TakumiY235_uniprot-mcp-server - tanigami_mcp-server-perplexity 🐍 🏠 - Mirror of https://github.com/tanigami/mcp-server-perplexity
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/tanigami_mcp-server-perplexity - tatn_mcp-server-diff-python 🐍 🏠 - Mirror of https://github.com/tatn/mcp-server-diff-python
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/tatn_mcp-server-diff-python - Tomatio13_mcp-server-tavily 🐍 🏠 - Mirror of https://github.com/Tomatio13/mcp-server-tavily
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Tomatio13_mcp-server-tavily - toolhouse-community_mcp-server-toolhouse 🐍 🏠 - Mirror of https://github.com/toolhouse-community/mcp-server-toolhouse
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/toolhouse-community_mcp-server-toolhouse - trezero_mcpServers 🐍 🏠 - Mirror of https://github.com/trezero/mcpServers
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/trezero_mcpServers - tumf_mcp-shell-server 🐍 🏠 - Mirror of https://github.com/tumf/mcp-shell-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/tumf_mcp-shell-server - tzafrir_mcp-server-replicate 🐍 🏠 - Mirror of https://github.com/tzafrir/mcp-server-replicate
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/tzafrir_mcp-server-replicate - URL - https://mcp.my-awesome-server.com/sse
http - vault-mcp-server 🐍 🏠 - The third-party FOSS MCP server for Vault
pythonmcpmcp-servervaultvault-pluginpip install git+https://github.com/mschuchard/vault-mcp-server - vbr-mcp-server 🐍 🏠 - MCP server to gather AWS cost information for VBR repositores
pythonmcpserverawspip install git+https://github.com/wjquigsAZ/vbr-mcp-server - weather_mcp 🐍 🏠 - A MCP server for weather forecast
pythonmcpserverpip install git+https://github.com/brunolnetto/weather_mcp - weather-mcp 📘 🏠 - Simple Weather MCP Server
typescriptaicursormcpmcp-servernpm install gifflet/weather-mcp - weather-mcp 🐍 🏠 - MCP server for weather forecasts and alerts
pythonmcpserverpip install git+https://github.com/ruankie/weather-mcp - weather-mcp-server 🐍 🏠 - vibe coding - weather mcp server
pythonmcpserverpip install git+https://github.com/snowan/weather-mcp-server - web-search-mcp-server 🐍 🏠 - Servidor MCP que busca documentação mais atualizada de tools
pythonmcpaipip install git+https://github.com/joao-santillo/web-search-mcp-server - weather-mcp-server 🐍 🏠 - 这是一个基于 FastMCP 构建的天气查询 MCP 服务器
pythonmcppip install git+https://github.com/qianyan/weather-mcp-server - weather-server-mcp 🐍 🏠 - A server that can be used to call function that give current weather status in Claude Desktop. Following this tutorial: https://modelcontextprotocol.io/quickstart/server#why-claude-for-desktop-and-not-claude-ai
pythonserveraihttppip install git+https://github.com/aashimajaiswal/weather-server-mcp - weatherlink-mcp 🐳 🏠 - A Model Context Protocol (MCP) server that provides real-time weather data to AI assistants.
dockerfilemcpserveraigit clone https://github.com/tomohiroJin/weatherlink-mcp - waldur_waldur-mcp-server 🐍 🏠 - Mirror of https://github.com/waldur/waldur-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/waldur_waldur-mcp-server - weather-mcp 🐍 🏠 📇 - A Model Context Protocol (MCP) server that provides weather forecast data from the Government of Canada Weather API. Fetch accurate 5-day forecasts for any location in Canada by latitude and longitude. Easily integrates with Claude Desktop and other MCP-compatible clients.
pythonmcpserverapigopip install git+https://github.com/SeanLF/weather-mcp - weather-mcp-server 🐍 🏠 - this is a Mcp server for us weather, I create it for test purposes
pythonmcpserverpip install git+https://github.com/michael7736/weather-mcp-server - Web_Search_MCP 🐍 🏠 - An MCP(Model Context Protocol) Server with a web search tool
pythonmcpserverwebpip install git+https://github.com/memohib/Web_Search_MCP - web-mcp-server 🏠 📇 - A web scraping MCP server that integrates BeautifulSoup, Gemini AI, and Selenium for automated content extraction and analysis.
mcpserverapiwebaigit clone https://github.com/djaboxx/web-mcp-server - zk-mcp 🐍 🏠 - MCP server for zk (Python-based)
pythonmcpserverpip install git+https://github.com/koei-kaji/zk-mcp - PersonalMcp 🐍 🏠 - Repository for personal mcp server configuration
pythonmcpserverpip install git+https://github.com/willyii/PersonalMcp - PersonalMCP 🦉 🏠 - A collection Swift projects which aim to build a MCP server for completing personal tasks
swiftmcpserveraigit clone https://github.com/spprichard/PersonalMCP - Personas-MCP-Server 🏠 - Model Context Protocol server implementation for my AI personas
serveraigit clone https://github.com/aaronbassett/Personas-MCP-Server - qyweixin_bot_mcp_server 🐍 🏠 - 企业微信群通知机器人 (Python-based)
pythonpip install git+https://github.com/zuojianghua/qyweixin_bot_mcp_server - rahgadda_oracledb_mcp_server 🐍 🏠 - Mirror of https://github.com/rahgadda/oracledb_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/rahgadda_oracledb_mcp_server - qs-first-mcp 🐍 🏠 - Following Quick Start from Anthropic's MCP guide
pythonmcppip install git+https://github.com/SSGrady/qs-first-mcp - Quantum-369_Gmail-mcp-server 🐍 🏠 - Mirror of https://github.com/Quantum-369/Gmail-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/Quantum-369_Gmail-mcp-server - Quantumcompute_mcp 🏠 - A Model Context Protocol (MCP) server that integrates large language models (LLMs) with quantum computing platforms, such as IBM Quantum’s Qiskit.
mcpserverllmgit clone https://github.com/sakshiglaze/Quantumcompute_mcp - qweather-mcp-server 🐍 🏠 📇 - 和风天气API MCP服务(练习用) (Python-based)
pythonmcpapipip install git+https://github.com/yangxt65535/qweather-mcp-server - qwert666_mcp-server-foundry 🐍 🏠 - Mirror of https://github.com/qwert666/mcp-server-foundry
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/qwert666_mcp-server-foundry - radial-hks_MCP-Unreal-Server 🏠 - Mirror of https://github.com/radial-hks/MCP-Unreal-Server
htmlmcpserverhttpgit clone https://github.com/MCP-Mirror/radial-hks_MCP-Unreal-Server - radiofrance-podcast-explorer-mcp 🐍 🏠 - A Model Control Protocol (MCP) server for exploring and accessing Radio France podcasts and audio content.
pythonmcpserverpip install git+https://github.com/infinitimeless/radiofrance-podcast-explorer-mcp - rag-mcp-pipeline-research 🐍 🏠 - A learning repository exploring Retrieval-Augmented Generation (RAG) and Multi-Cloud Processing (MCP) server integration using free and open-source models.
pythonllmsmcp-serverragmcppip install git+https://github.com/dzikrisyairozi/rag-mcp-pipeline-research - raju-deriv_mcp-deriv-api-server 🐍 🏠 📇 - Mirror of https://github.com/raju-deriv/mcp-deriv-api-server
pythonmcpserverapihttppip install git+https://github.com/MCP-Mirror/raju-deriv_mcp-deriv-api-server - ransomwarelive-mcp-server 🐍 🏠 - Ransomware Live MCP Server ✨🔐
pythonmcpserverpip install git+https://github.com/slouchd/ransomwarelive-mcp-server - rbctmz_mcp-server-strava 🐍 🏠 - Mirror of https://github.com/rbctmz/mcp-server-strava
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/rbctmz_mcp-server-strava - quckstart-mcp-server 🐍 🏠 - mcp server 테스트 (Python-based)
pythonmcpserverpip install git+https://github.com/abel9851/quckstart-mcp-server - reading-plus-ai_mcp-server-data-exploration 🐍 🏠 - Mirror of https://github.com/reading-plus-ai/mcp-server-data-exploration
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/reading-plus-ai_mcp-server-data-exploration - Red-exe-Engineer_MCPE-Server-Proxy 🐍 🏠 - Mirror of https://github.com/Red-exe-Engineer/MCPE-Server-Proxy
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Red-exe-Engineer_MCPE-Server-Proxy - redmine-mcp-server 🏠 - A Model Context Protocol (MCP) server that enables AI assistants to interact with Redmine for focused and transparent project management.
mcpserveraigit clone https://github.com/zacharyelston/redmine-mcp-server - remote-mcp-webapp-python 🐍 🏠 📇 - FastAPI MCP server on Azure App Service
pythonmcpserverapiazurepip install git+https://github.com/madebygps/remote-mcp-webapp-python - reymerekar7_beehiiv-mcp-server 🐍 🏠 - Mirror of https://github.com/reymerekar7/beehiiv-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/reymerekar7_beehiiv-mcp-server - remote-mcp-server 🐍 🏠 📇 - MCP Server using SSE - can be hsoted remotely (build using fastapi, fastmcp, uv)
pythonmcpserverapipip install git+https://github.com/jaygodara45IP/remote-mcp-server - saras-mcp 🐍 🏠 - MCP server code for Saras
pythonmcpserverpip install git+https://github.com/ashyam-saras/saras-mcp - repo-to-txt-mcp 🐍 🏠 - MCP server for analyzing and converting Git repositories to text files for LLM context
pythonmcpserverllmpip install git+https://github.com/chromewillow/repo-to-txt-mcp - reminia_zendesk-mcp-server 🐍 🏠 - Mirror of https://github.com/reminia/zendesk-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/reminia_zendesk-mcp-server - ResembleMCP 🏠 - Resemble AI MCP Server Implementation Challenge
mcpserveraigit clone https://github.com/liwilliam2021/ResembleMCP - RichardHan_mssql_mcp_server 🐍 🏠 - Mirror of https://github.com/RichardHan/mssql_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/RichardHan_mssql_mcp_server - rijksmuseum-mcp-oaipmh 🏠 📇 - MCP server for Rijksmuseum OAI-PMH API
mcpserverapiaigit clone https://github.com/shenhai-ran/rijksmuseum-mcp-oaipmh - Rootly-AI-Labs_Rootly-MCP-server 🐍 🏠 - Mirror of https://github.com/Rootly-AI-Labs/Rootly-MCP-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/Rootly-AI-Labs_Rootly-MCP-server - rt-mcp 🐍 🏠 - A Model Context Protocol (MCP) server for Request Tracker
pythonmcpserverpip install git+https://github.com/richieri/rt-mcp - saaros-mcp-server 🐍 🏠 📇 - A Model Context Protocol (MCP) server that provides access to the Brave Search API, running as a background thread
pythonmcpserverapipip install git+https://github.com/mjochum64/saaros-mcp-server - rishikavikondala_mcp-server-aws 🐍 🏠 - Mirror of https://github.com/rishikavikondala/mcp-server-aws
pythonmcpserverhttpawspip install git+https://github.com/MCP-Mirror/rishikavikondala_mcp-server-aws - salesforcemcp 🏠 - A Python MCP server providing tools for Salesforce metadata manipulation, data operations, and documentation search. Designed to power AI assistants for Salesforce tasks.
mcpserveraipythondocumentationgit clone https://github.com/abouabd/salesforcemcp - sargoth-mcp 🐍 🏠 - MCP Server for the Sargoth Mermaid Editor API
pythonchartcharting-librarycharting-library-integrationdiagrampip install git+https://github.com/floor-licker/sargoth-mcp - school-db-mcp-server 🐍 🏠 - MCP server for a school database
pythonmcpserverdatabasepip install git+https://github.com/eoinmooremath/school-db-mcp-server - sbb-mcp 🐍 🏠 - an mcp server to interact with SBB.ch
pythonmcpserverpip install git+https://github.com/grll/sbb-mcp - sek-fx-mcp 🐍 🏠 📇 - En Model Context Protocol-server (MCP) som kopplar en LLM till Riksbankens API för kronans växelkurs.
pythonclaude-aimcpmcp-servermodelcontextprotocolpip install git+https://github.com/bromaniac/sek-fx-mcp - senechal-mcp 🐍 🏠 - Thi sis a companion MCP server for the Senechal project
pythonmcpserverpip install git+https://github.com/mattjoyce/senechal-mcp - serverMCprt 🐍 🏠 - prueba (Python-based)
pythonpip install git+https://github.com/kevinixz/serverMCprt - shankarpriyank/remote-mcp-server-authless 🏠 ☁️ - Deploy a remote MCP server without authentication on Cloudflare Workers, enabling seamless integration with Cloudflare AI Playground and local MCP clients.
remotelocalauthhttpai - simplelocalize-mcp-server 📘 🏠 📇 - Interact with the SimpleLocalize API using AI assistants like Github Copilot, Claude, or in AI-powered IDEs like Cursor AI.
typescriptcursor-aii18nllmmcpnpm install simplelocalize/simplelocalize-mcp-server - sms-mcp-server 🐍 🏠 - sms mcp server (Python-based)
pythonmcpserverpip install git+https://github.com/675256493/sms-mcp-server - social_mcp 🐍 🏠 - Socail MCP Server (Python-based)
pythonmcpserveraipip install git+https://github.com/kitadmin01/social_mcp - podbeanMCP 🐍 🏠 📇 - An MCP server for the Podbean API
pythonmcpmcp-servermodelcontextprotocolpodbeanpip install git+https://github.com/amurshak/podbeanMCP - openmeteo-weather-mcp 🐍 🏠 - MCP server that fetches current weather info and forecast for a given location.
pythonmcpserverpip install git+https://github.com/walidsi/openmeteo-weather-mcp - Oxen-MCP 🐍 🏠 - Oxen MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/Eric-Laurence/Oxen-MCP - Pokeapi-MCP 🐍 🏠 - MCP server for agentic AI to withdraw information
pythonmcpserveraipip install git+https://github.com/GomesAdhikari/Pokeapi-MCP - postgresql-mcp 🐍 🏠 - A postgresql-mcp server
pythonmcpserverpostgrespip install git+https://github.com/tobecrazy/postgresql-mcp - pragmar_mcp_server_webcrawl 🐍 🏠 - Mirror of https://github.com/pragmar/mcp_server_webcrawl
pythonmcpserverwebhttppip install git+https://github.com/MCP-Mirror/pragmar_mcp_server_webcrawl - pyBittle-mcp-server 🐍 🏠 - MCP Server to control pyBittle via BLE
pythonmcpserverpip install git+https://github.com/cluesang/pyBittle-mcp-server - pydbcx-mcp 🐍 🏠 - Python MCP server for enabling data communication (databases, web services, scripts) via JDBCX server.
pythonmcpserverdatabasewebpip install git+https://github.com/jdbcx/pydbcx-mcp - simple-mcp 🐍 🏠 - Practice building MCP servers
pythonmcpserverpip install git+https://github.com/ThomasVuNguyen/simple-mcp - OpenLinkSoftware_mcp-sqlalchemy-server 🐍 🏠 - Mirror of https://github.com/OpenLinkSoftware/mcp-sqlalchemy-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/OpenLinkSoftware_mcp-sqlalchemy-server - owayo_gitlab-mcp-server 🐍 🏠 - Mirror of https://github.com/owayo/gitlab-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/owayo_gitlab-mcp-server - pab1it0_adx-mcp-server 🐍 🏠 - Mirror of https://github.com/pab1it0/adx-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/pab1it0_adx-mcp-server - pool_services_figma_mcp_test 🏠 - Test w/ Figma MCP server to generate a pool services page
htmlmcpservergit clone https://github.com/EmundoT/pool_services_figma_mcp_test - port-experimental_port-mcp-server 🐍 🏠 - Mirror of https://github.com/port-experimental/port-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/port-experimental_port-mcp-server - prajwalnayak7_mcp-server-redis 🐍 🏠 - Mirror of https://github.com/prajwalnayak7/mcp-server-redis
pythonmcpserverhttpredispip install git+https://github.com/MCP-Mirror/prajwalnayak7_mcp-server-redis - ProbonoBonobo_sui-mcp-server 🐍 🏠 - Mirror of https://github.com/ProbonoBonobo/sui-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ProbonoBonobo_sui-mcp-server - processing-claude-mcp-bridge 🐍 🏠 - Integración entre Processing y Claude mediante el Model Context Protocol (MCP). Permite controlar y crear sketches de Processing mediante conversaciones en lenguaje natural con Claude.
pythonmcppip install git+https://github.com/donchelo/processing-claude-mcp-bridge - promptmcp 🐍 🏠 - An MCP server that uses a local directory to store prompt templates (default ~/.promptmcp)
pythonmcpserverpip install git+https://github.com/arevak/promptmcp - progmo-mcp-server 🏠 - Experimental project to create an MCP agent to help with coding
htmlmcpgit clone https://github.com/whitmo/progmo-mcp-server - PsiACE_nebulagraph-mcp-server 🐍 🏠 - Mirror of https://github.com/PsiACE/nebulagraph-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/PsiACE_nebulagraph-mcp-server - PythonCMCPServer 🐍 🏠 - Building a Custom MCP Server using Python
pythonmcpserverpip install git+https://github.com/maneeshsit/PythonCMCPServer - PythonServerMcp 🐍 🏠 - A template repository for MCP
pythonmcppip install git+https://github.com/stevearagonsite/PythonServerMcp - shopify-mcp-server 🐍 🏠 - Shopify MCP server (Python-based)
pythonmcpserverpip install git+https://github.com/abhi-mahule/shopify-mcp-server - simple-mcp-server 🐍 🏠 - Model Context Protocol (MCP) server integrated with an external inference service (e.g., Ollama/Gemma3) via middleware.
pythonmcpserverpip install git+https://github.com/jorgesandoval/simple-mcp-server - simple-mcp-server 🐍 🏠 - A basic stdio & streamable http implementation of FastMCP Server
pythonmcpserverhttppip install git+https://github.com/rjmoggach/simple-mcp-server - wenb1n-dev_mysql_mcp_server_pro 🐍 🏠 - Mirror of https://github.com/wenb1n-dev/mysql_mcp_server_pro
pythonmcpserverhttpmysqlpip install git+https://github.com/MCP-Mirror/wenb1n-dev_mysql_mcp_server_pro - workout_mcp_server 🐍 🏠 - MCP Server for workout info
pythonmcpserverpip install git+https://github.com/ipdelete/workout_mcp_server - youtube-mcp-server 🐍 🏠 - An MCP server that enables uploading videos to YouTube through Claude Desktop or any MCP-compatible client
pythonmcpserverpip install git+https://github.com/adamanz/youtube-mcp-server - neo4j-mcp-chainlit 🐍 🏠 📇 - A poc of Neo4j mcp server with Chainlit (MCP host) and Claude LLM (Anthropic) API
pythonmcpserverapiaipip install git+https://github.com/Abhid14/neo4j-mcp-chainlit - neoforge-mcp-server 🐍 🏠 - NeoMCP server (Python-based)
pythonmcpserverpip install git+https://github.com/neoforge-dev/neoforge-mcp-server - netwrix_mcp-server-naa 🐍 🏠 - Mirror of https://github.com/netwrix/mcp-server-naa
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/netwrix_mcp-server-naa - NewAITees_ollama-MCP-server 🐍 🏠 - Mirror of https://github.com/NewAITees/ollama-MCP-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/NewAITees_ollama-MCP-server - noah-vh_mcp-server-clickup 🐍 🏠 - Mirror of https://github.com/noah-vh/mcp-server-clickup
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/noah-vh_mcp-server-clickup - notion-mcp 🐍 🏠 - A simple Notion MCP Server
pythonmcpserverpip install git+https://github.com/flyer103/notion-mcp - ntealan-apis-mcp-server 🐍 🏠 📇 - A modular, extensible Model Context Protocol (MCP) server for NTeALan REST APIs dictionaries and contributions. This project provides a unified interface for managing dictionary data, articles, and user contributions, and is designed for easy integration and extension.
pythongenerative-ailexicographymcp-serverntealanpip install git+https://github.com/Levis0045/ntealan-apis-mcp-server - NvkAnirudh_YT-to-LinkedIn-MCP-Server 🐍 🏠 - Mirror of https://github.com/NvkAnirudh/YT-to-LinkedIn-MCP-Server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/NvkAnirudh_YT-to-LinkedIn-MCP-Server - obsidian-mcp-cursor 🐍 🏠 - Obsidian MCP integration for Cursor IDE - A bridge between your Obsidian vault and Cursor IDE.
pythonmcppip install git+https://github.com/frank889JJ/obsidian-mcp-cursor - omni-server 🐍 🏠 - A MCP Server to get familiarize to Model Context Protocol
pythonmcpserverpip install git+https://github.com/abhijithk1/omni-server - openai-mcp-implementation 🏠 - Implementation of OpenAI MCP Server
htmlmcpserveraigit clone https://github.com/Spysailor/openai-mcp-implementation - OpenLinkSoftware_mcp-pyodbc-server 🐍 🏠 - Mirror of https://github.com/OpenLinkSoftware/mcp-pyodbc-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/OpenLinkSoftware_mcp-pyodbc-server - YanxingLiu_dify-mcp-server 🐍 🏠 - Mirror of https://github.com/YanxingLiu/dify-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/YanxingLiu_dify-mcp-server - yfinance-mcp 🏠 - A Python MCP Server for yfinance
mcpserverpythongit clone https://github.com/flipthedog/yfinance-mcp - zerobounce-mcp-server 🐍 🏠 - zerobounce-mcp-server
pythonmcpserverpip install git+https://github.com/avivshafir/zerobounce-mcp-server - pan-os-mcp 🐍 🏠 📇 - PAN-OS MCP Server (XML API)
pythonmcpserverapimlpip install git+https://github.com/edoscars/pan-os-mcp - parallels-ras-mcp-server 🐍 🏠 📇 - MCP server for Parallels RAS using FastAPI
pythonmcpserverapipip install git+https://github.com/kamalsrini17/parallels-ras-mcp-server - Pet-store-MCP-server-3 🐍 🏠 - MCP server test (Python-based)
pythonmcpserverpip install git+https://github.com/octaviusp/Pet-store-MCP-server-3 - playwright-mcp-project 🏠 - A project to demonstrate Playwright MCP server usage with Jenkins pipeline
htmlmcpservergit clone https://github.com/vikaskumarprofessional92/playwright-mcp-project - playwright-universal-mcp 🐍 🏠 - A universal Playwright MCP server for browser automation in containerized environments
pythonmcpserveraipip install git+https://github.com/xkiranj/playwright-universal-mcp - QAInsights_jmeter-mcp-server 🐍 🏠 - Mirror of https://github.com/QAInsights/jmeter-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/QAInsights_jmeter-mcp-server - QAInsights_locust-mcp-server 🐍 🏠 - Mirror of https://github.com/QAInsights/locust-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/QAInsights_locust-mcp-server - qdrant_mcpserver 🐍 🏠 - A simple MCP server to access Qdrant
pythonmcpserverpip install git+https://github.com/davidwynter/qdrant_mcpserver - shreyaskarnik_huggingface-mcp-server 🐍 🏠 - Mirror of https://github.com/shreyaskarnik/huggingface-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/shreyaskarnik_huggingface-mcp-server - simple_agent_api_tool 🐍 🏠 - Test Simple MCP server
pythonmcpservergit clone https://github.com/natapone/simple_mcp_server - simple-mcp-test 🐍 🏠 - A sample project testing Model Context Protocol (MCP) server and client interaction.
pythonmcpservertestingpip install git+https://github.com/tjjd4/simple-mcp-test - SimpleServerSetup 🐍 🏠 - A dual-mode Python calculator server supporting both Server-Sent Events (SSE) for web clients and Standard Input/Output (STDIO) for terminal interaction.
pythonmcpmcp-clientmcp-serveruvpip install git+https://github.com/DionBenFernandes-Dev/SimpleServerSetup - sionic-ai_serverless-rag-mcp-server 🐍 🏠 - Mirror of https://github.com/sionic-ai/serverless-rag-mcp-server
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/sionic-ai_serverless-rag-mcp-server - smithery-openapi-server 🐍 🏠 📇 - OpenAPI server for Smithery Registry, providing access to MCP servers
pythonmcpserverapipip install git+https://github.com/chinpeerapat/smithery-openapi-server - softgridinc-pte-ltd_mcp-excel-reader-server 🐍 🏠 - Mirror of https://github.com/softgridinc-pte-ltd/mcp-excel-reader-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/softgridinc-pte-ltd_mcp-excel-reader-server - website 📘 🏠 - The portal for aimcp
typescriptaiawesomecollectionmcpgit clone https://github.com/aimcp/website - wordhippo-mcp-server 🐍 🏠 - Thesaurus MCP server that scrapes WordHippo
pythonmcpserverpip install git+https://github.com/clareliguori/wordhippo-mcp-server - weekly-report-mcp 🐍 🏠 - An MCP server that checks weekly report submissions in a Google Sheet
pythonmcpservergopip install git+https://github.com/kaneyxx/weekly-report-mcp - WeiWanMcpServer 🐍 🏠 - 私人McpServer (Python-based)
pythonmcpserverpip install git+https://github.com/WeiWan5675/WeiWanMcpServer - wheather-mcp 🐍 🏠 - Simple MCP weather server
pythonmcpserverpip install git+https://github.com/sarankrishna/wheather-mcp - XGenerationLab_xiyan_mcp_server 🐍 🏠 - Mirror of https://github.com/XGenerationLab/xiyan_mcp_server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/XGenerationLab_xiyan_mcp_server - ZbigniewTomanek_my-mcp-server 🐍 🏠 - Mirror of https://github.com/ZbigniewTomanek/my-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ZbigniewTomanek_my-mcp-server - zerubroberts_safetyculture-mcp-server 🐍 🏠 - Mirror of https://github.com/zerubroberts/safetyculture-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/zerubroberts_safetyculture-mcp-server - mcp-tavily-search 🐍 🏠 - MCP server to give client the ability to search on the internet
pythonmcpserverpip install git+https://github.com/algonacci/mcp-tavily-search - motherduckdb_mcp-server-motherduck 🐍 🏠 - Mirror of https://github.com/motherduckdb/mcp-server-motherduck
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/motherduckdb_mcp-server-motherduck - mymcpserv 🐍 🏠 - A modern, scalable MCP server implementation with support for multiple AI providers, advanced monitoring, and robust conversation management.
pythonmcpserveraimonitoringpip install git+https://github.com/eagurin/mymcpserv - siddhantbajaj_shopify-mcp-server 🐍 🏠 - Mirror of https://github.com/siddhantbajaj/shopify-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/siddhantbajaj_shopify-mcp-server - hannesrudolph_imessage-query-fastmcp-mcp-server 🐍 🏠 - Mirror of https://github.com/hannesrudolph/imessage-query-fastmcp-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/hannesrudolph_imessage-query-fastmcp-mcp-server - MladenSU_cli-mcp-server 🐍 🏠 - Mirror of https://github.com/MladenSU/cli-mcp-server
pythonmcpservermlhttppip install git+https://github.com/MCP-Mirror/MladenSU_cli-mcp-server - nexon33_search-fetch-server-mcp 🐍 🏠 - Mirror of https://github.com/nexon33/search-fetch-server-mcp
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/nexon33_search-fetch-server-mcp - noahvanhart_mcp-server-clickup 🐍 🏠 - Mirror of https://github.com/noahvanhart/mcp-server-clickup
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/noahvanhart_mcp-server-clickup - non-dirty_mcp-client-and-server 🐍 🏠 - Mirror of https://github.com/non-dirty/mcp-client-and-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/non-dirty_mcp-client-and-server - non-dirty_mcp-server-restart 🐍 🏠 - Mirror of https://github.com/non-dirty/mcp-server-restart
pythonmcpserverresthttppip install git+https://github.com/MCP-Mirror/non-dirty_mcp-server-restart - odysseus0_mcp-server-shell 🐍 🏠 - Mirror of https://github.com/odysseus0/mcp-server-shell
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/odysseus0_mcp-server-shell - phil65_mcp-server-llmling 🐍 🏠 - Mirror of https://github.com/phil65/mcp-server-llmling
pythonmcpservermlllmpip install git+https://github.com/MCP-Mirror/phil65_mcp-server-llmling - philgei_mcp_server_filesystem 🐍 🏠 - Mirror of https://github.com/philgei/mcp_server_filesystem
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/philgei_mcp_server_filesystem - pierrebrunelle_mcp-server-openai 🐍 🏠 - Mirror of https://github.com/pierrebrunelle/mcp-server-openai
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/pierrebrunelle_mcp-server-openai - plurigrid_juvix-mcp-server 🐍 🏠 - Mirror of https://github.com/plurigrid/juvix-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/plurigrid_juvix-mcp-server - PythonScratcher_mcpi-server-list 🏠 - Mirror of https://github.com/PythonScratcher/mcpi-server-list
htmlmcpserverhttppythongit clone https://github.com/MCP-Mirror/PythonScratcher_mcpi-server-list - Sivan22_mcp-otzaria-server 🐍 🏠 - Mirror of https://github.com/Sivan22/mcp-otzaria-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/Sivan22_mcp-otzaria-server - skydeckai_mcp-server-aidd 🐍 🏠 - Mirror of https://github.com/skydeckai/mcp-server-aidd
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/skydeckai_mcp-server-aidd - skydeckai_mcp-server-rememberizer 🐍 🏠 - Mirror of https://github.com/skydeckai/mcp-server-rememberizer
pythonmcpserveraihttppip install git+https://github.com/MCP-Mirror/skydeckai_mcp-server-rememberizer - wrale_mcp-server-make 🐍 🏠 - Mirror of https://github.com/wrale/mcp-server-make
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/wrale_mcp-server-make - wrale_mcp-server-yahoo-finance 🐍 🏠 - Mirror of https://github.com/wrale/mcp-server-yahoo-finance
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/wrale_mcp-server-yahoo-finance - yr-mcp-server 🐍 🏠 - MCP Server for using Yr Weather Data as Context in LLM tools.
pythonmcpserverllmpip install git+https://github.com/AnyContext-ai/yr-mcp-server - mcp-cps-data 🐍 🏠 - MCP Server for locally hosted data on Chicago Public Schools
pythonmcpservergopip install git+https://github.com/mdagost/mcp-cps-data - YUZongmin_semantic-scholar-fastmcp-mcp-server 🐍 🏠 - Mirror of https://github.com/YUZongmin/semantic-scholar-fastmcp-mcp-server
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/YUZongmin_semantic-scholar-fastmcp-mcp-server - ZZZHDW_mcp-server-kusto 🐍 🏠 - Mirror of https://github.com/ZZZHDW/mcp-server-kusto
pythonmcpserverhttppip install git+https://github.com/MCP-Mirror/ZZZHDW_mcp-server-kusto - MCPE-Server-Proxy 🐍 🏠 - This helps with joining MCPI servers on MCPE
pythonmcpserverpip install git+https://github.com/Red-exe-Engineer/MCPE-Server-Proxy
🌐 Web Development
- playwright-mcp 📘 🏠 (⭐ 19.1k, 🍴 1.5k, 🐛 40) - Playwright MCP server
typescriptmcpplaywrightserverwebnpm install microsoft/playwright-mcp - mcp-playwright 📘 🏠 📇 (⭐ 4.7k, 🍴 408, 🐛 48) - Playwright Model Context Protocol Server - Tool to automate Browsers and APIs in Claude Desktop, Cline, Cursor IDE and More 🔌
httpgitgithubtypescriptservernpm install executeautomation/mcp-playwright - firecrawl-mcp-server 📜 🏠 (⭐ 4.4k, 🍴 448, 🐛 49) - 🔥 Official Firecrawl MCP Server - Adds powerful web scraping to Cursor, Claude and any other LLM clients.
javascriptbatch-processingclaudecontent-extractiondata-collectionnpm install mendableai/firecrawl-mcp-server - mcp 📘 🏠 (⭐ 4.1k, 🍴 287, 🐛 87) - Browser MCP is a Model Context Provider (MCP) server that allows AI applications to control your browser
typescriptbrowser-automationbrowser-extensionclaudecursornpm install browsermcp/mcp - magic-mcp 📘 🏠 (⭐ 3.5k, 🍴 242, 🐛 15) - It's like v0 but in your Cursor/WindSurf/Cline. 21st dev Magic MCP server for working with your frontend like Magic
typescriptmcpserverhttpgitnpm install 21st-dev/magic-mcp - notion-mcp-server 📘 🏠 (⭐ 3.1k, 🍴 286, 🐛 49) - Official Notion MCP Server
typescriptmcpserverhttpgitnpm install makenotion/notion-mcp-server - n8n-nodes-mcp 📘 🏠 (⭐ 2.7k, 🍴 466, 🐛 66) - n8n custom node for MCP
typescriptmcpnodenpm install nerding-io/n8n-nodes-mcp - XcodeBuildMCP 📘 🏠 (⭐ 2.5k, 🍴 104, 🐛 19) - A Model Context Protocol (MCP) server that provides Xcode-related tools for integration with AI assistants and other MCP clients.
typescriptmcpmcp-servermodel-context-protocolmodel-context-protocol-serversnpm install cameroncooke/XcodeBuildMCP - fastmcp 📘 🏠 (⭐ 2.5k, 🍴 191, 🐛 24) - A TypeScript framework for building MCP servers.
typescriptmcpsseserverhttpnpm install punkpeye/fastmcp - apple-mcp 📘 🏠 (⭐ 2.4k, 🍴 192, 🐛 8) - Collection of apple-native tools for the model context protocol.
typescriptapplescriptsmodelcontextprotocolnpm install Dhravya/apple-mcp - exa-mcp-server 📘 🏠 📇 (⭐ 2.2k, 🍴 187, 🐛 27) - Exa is a Web Search API | This is Exa MCP (Model Context Protocol)
apiwebhttpaigitnpm install exa-labs/exa-mcp-server - supabase-mcp 📘 🏠 (⭐ 2k, 🍴 209, 🐛 59) - Connect Supabase to your AI assistants
typescriptainpm install supabase-community/mcp-supabase - mobile-mcp 📘 🏠 📇 (⭐ 2k, 🍴 182, 🐛 48) - Model Context Protocol Server for Mobile Automation and Scraping (iOS, Android, Emulators, Simulators and Real Devices)
typescriptagentandroidemulatoriosnpm install mobile-next/mobile-mcp - MCP-SuperAssistant 📘 🏠 (⭐ 1.8k, 🍴 234, 🐛 65) - Brings MCP to ChatGPT, DeepSeek, Perplexity, Grok, Gemini, Google AI Studio, OpenRouter, DeepSeek, T3 Chat and more...
typescriptaistudioassistantchatgptdeepseeknpm install srbhptl39/MCP-SuperAssistant - arxiv-mcp-server 🐍 🏠 (⭐ 1.6k, 🍴 110, 🐛 25) - A Model Context Protocol server for searching and analyzing arXiv papers
httpgitgithubpythonaipip install git+https://github.com/blazickjp/arxiv-mcp-server - open-mcp-client 📘 🏠 (⭐ 1.6k, 🍴 243, 🐛 14) - TypeScript-based
typescriptnpm install CopilotKit/open-mcp-client - modelcontextprotocol 📜 🏠 📇 (⭐ 1.6k, 🍴 213, 🐛 31) - A Model Context Protocol Server connector for Perplexity API, to enable web search without leaving the MCP ecosystem.
javascriptmcpserverapiwebgit clone https://github.com/ppl-ai/modelcontextprotocol - mcp-installer 📜 🏠 (⭐ 1.4k, 🍴 180, 🐛 16) - An MCP server that installs other MCP servers for you
javascriptmcpserverhttpainpm install anaisbetts/mcp-installer - n8n-mcp-server 📘 🏠 📇 (⭐ 1.3k, 🍴 224, 🐛 23) - MCP server that provides tools and resources for interacting with n8n API
typescriptmcpserverapihttpnpm install leonardsellem/n8n-mcp-server - mcphub 📘 🏠 (⭐ 1.2k, 🍴 140, 🐛 25) - A unified hub for centralized management and dynamic organization of multiple MCP servers into streamable HTTP (SSE) endpoints, with support for flexible routing strategies
typescriptmcpmcp-hubmcp-routermcp-servernpm install samanhappy/mcphub - mcp-obsidian 📜 🏠 (⭐ 1.1k, 🍴 77, 🐛 16) - A connector for Claude Desktop to read and search an Obsidian vault.
javascriptnpm install smithery-ai/mcp-obsidian - mcp-server-chatsum 📘 🏠 (⭐ 1k, 🍴 98, 🐛 7) - Query and Summarize your chat messages.
typescriptchatbotchatsummcp-serverhttpnpm install chatmcp/mcp-server-chatsum - ios-simulator-mcp 📜 🏠 (⭐ 988, 🍴 46, 🐛 12) - MCP server for interacting with the iOS simulator
javascriptmcpserverhttpgitnpm install joshuayoes/ios-simulator-mcp - deepwiki-mcp 📘 🏠 (⭐ 983, 🍴 56, 🐛 5) - 📖 MCP server for fetch deepwiki.com and get latest knowledge in Cursor and other Code Editors
httpaillmgitgithubnpm install regenrek/deepwiki-mcp - mcp-remote 📘 🏠 (⭐ 942, 🍴 135, 🐛 49) - TypeScript-based
typescriptnpm install geelen/mcp-remote - mcp-jetbrains 📜 🏠 (⭐ 921, 🍴 69, 🐛 36) - A model context protocol server to work with JetBrains IDEs: IntelliJ, PyCharm, WebStorm, etc. Also, works with Android Studio
javascriptideintellijjetbrainsmcpnpm install JetBrains/mcp-jetbrains - ollama-mcp-bridge 📘 🏠 (⭐ 918, 🍴 105, 🐛 17) - Bridge between Ollama and MCP servers, enabling local LLMs to use Model Context Protocol tools
typescriptmcpserverllmnpm install patruff/ollama-mcp-bridge - openapi-mcp-server 📜 🏠 📇 (⭐ 800, 🍴 87, 🐛 7) - Allow AI to wade through complex OpenAPIs using Simple Language
javascriptapiaihttpgitnpm install snaggle-ai/openapi-mcp-server - openapi-mcp-server 📜 🏠 📇 (⭐ 800, 🍴 87, 🐛 7) - Allow AI to wade through complex OpenAPIs using Simple Language
javascriptapiainpm install janwilmake/openapi-mcp-server - mcp-server-mysql 📜 🏠 (⭐ 765, 🍴 110, 🐛 27) - A Model Context Protocol server that provides read-only access to MySQL databases. This server enables LLMs to inspect database schemas and execute read-only queries.
javascriptserverdatabasellmmysqlnpm install benborla/mcp-server-mysql - nuxt-mcp 📘 🏠 (⭐ 749, 🍴 31, 🐛 5) - MCP server helping models to understand your Vite/Nuxt app better.
typescriptmcpnuxtviteservernpm install antfu/nuxt-mcp - tavily-mcp 📜 🏠 (⭐ 730, 🍴 127, 🐛 7) - Production ready MCP server with real-time search, extract, map & crawl.
javascriptmcpserverhttpainpm install tavily-ai/tavily-mcp - sitemcp 📘 🏠 (⭐ 712, 🍴 38, 🐛 7) - Fetch an entire site and use it as an MCP Server
typescriptmcpservernpm install ryoppippi/sitemcp - Gmail-MCP-Server 📜 🏠 (⭐ 664, 🍴 168, 🐛 27) - A Model Context Protocol (MCP) server for Gmail integration in Claude Desktop with auto authentication support. This server enables AI assistants to manage Gmail through natural language interactions.
javascriptmcpserveraiauthnpm install GongRzhe/Gmail-MCP-Server - memory-bank-mcp 📘 🏠 (⭐ 649, 🍴 62, 🐛 12) - A Model Context Protocol (MCP) server implementation for remote memory bank management, inspired by Cline Memory Bank.
typescriptantrophicclaudeclinecline-memory-banknpm install alioshr/memory-bank-mcp - mcp-knowledge-graph 📜 🏠 (⭐ 621, 🍴 81, 🐛 1) - MCP server enabling persistent memory for Claude through a local knowledge graph - fork focused on local development
javascriptai-memoryclaude-aiknowledge-graphmcpnpm install shaneholloman/mcp-knowledge-graph - mcp 📘 🏠 (⭐ 599, 🍴 48, 🐛 4) - A MCP server implementation for hyperbrowser
typescriptmcpserverhttpawsnpm install hyperbrowserai/mcp - workers-mcp 📘 🏠 (⭐ 595, 🍴 59, 🐛 21) - Talk to a Cloudflare Worker from Claude Desktop!
typescriptnpm install cloudflare/workers-mcp - HowToCook-mcp 📘 🏠 (⭐ 591, 🍴 31, 🐛 10) - 基于Anduin2017 / HowToCook (程序员在家做饭指南)的mcp server
typescriptmcpservernpm install worryzyy/HowToCook-mcp - google-calendar-mcp 📘 🏠 (⭐ 585, 🍴 179, 🐛 9) - MCP integration for Google Calendar to manage events.
typescriptmcpgohttpgitnpm install nspady/google-calendar-mcp - fetch-mcp 📘 🏠 (⭐ 581, 🍴 96, 🐛 4) - A flexible HTTP fetching Model Context Protocol server.
typescriptserverhttpjsonainpm install zcaceres/fetch-mcp - docs-mcp-server 📘 🏠 (⭐ 549, 🍴 57, 🐛 43) - Docs MCP Server: Enhance Your AI Coding Assistant
typescriptmcpserverainpm install arabold/docs-mcp-server - ref-tools-mcp 📘 🏠 (⭐ 523, 🍴 36, 🐛 2) - An MCP server to stop hallucinations with token efficient search over public and private documentation.
typescriptcoding-agentdocumentation-toolmcpmcp-servernpm install ref-tools/ref-tools-mcp - obsidian-mcp 📘 🏠 (⭐ 519, 🍴 52, 🐛 17) - A simple MCP server for Obsidian
typescriptmcpserverhttpgitnpm install StevenStavrakis/obsidian-mcp - mcp-shield 📘 🏠 (⭐ 502, 🍴 25, 🐛 3) - Security scanner for MCP servers
typescriptmcpservernpm install riseandignite/mcp-shield - mcp-server-neon 📘 🏠 📇 (⭐ 447, 🍴 73, 🐛 13) - MCP server for interacting with Neon Management API and databases
typescriptmcpserverapidatabasenpm install neondatabase-labs/mcp-server-neon - reference-servers 📜 🏠 (⭐ 424, 🍴 58, 🐛 3) - Model Context Protocol Servers
javascriptservernpm install smithery-ai/reference-servers - homeassistant-mcp 📘 🏠 (⭐ 410, 🍴 34, 🐛 15) - A MCP server for Home Assistant
typescriptmcpserverhttpgitnpm install tevonsb/homeassistant-mcp - mcp-send-email 📘 🏠 (⭐ 395, 🍴 50, 🐛 11) - Send emails directly from Cursor with this email sending MCP server
typescriptmcpserverainpm install ykhli/mcp-send-email - mcp-cli 📜 🏠 (⭐ 373, 🍴 29, 🐛 5) - A CLI inspector for the Model Context Protocol
javascripthttpgitgithubnpm install wong2/mcp-cli - apify-mcp-server 📘 🏠 📇 (⭐ 366, 🍴 47, 🐛 22) - Apify MCP server (tools for web scraping, data extraction, and automation)
apiwebhttpgitgithubnpm install apify/actors-mcp-server - openapi-mcp-generator 📘 🏠 📇 (⭐ 359, 🍴 53, 🐛 6) - A tool that converts OpenAPI specifications to MCP server
typescriptmcpserverapinpm install harsha-iiiv/openapi-mcp-generator - graphlit-mcp-server 📘 🏠 (⭐ 354, 🍴 47, 🐛 3) - Model Context Protocol (MCP) Server for Graphlit Platform
typescriptclaudecontent-extractioncontent-ingestiondata-collectionnpm install graphlit/graphlit-mcp-server - mcp-adapter 📘 🏠 (⭐ 339, 🍴 43, 🐛 11) - Easily spin up an MCP Server on Next.js, Nuxt, Svelte, and more
typescriptmcpserverhttpgitnpm install vercel/mcp-adapter - rails-mcp-server 💎 🏠 (⭐ 336, 🍴 19, 🐛 1) - A Ruby gem implementation of a Model Context Protocol (MCP) server for Rails projects. This server allows LLMs (Large Language Models) to interact with Rails projects through the Model Context Protocol.
rubymcpserveraillmgit clone https://github.com/maquina-app/rails-mcp-server - sentry-mcp 📘 🏠 (⭐ 335, 🍴 37, 🐛 44) - An MCP server for interacting with Sentry via LLMs.
typescriptmcp-servertag-productionmcpservernpm install getsentry/sentry-mcp - awesome-cursor-mpc-server 📘 🏠 (⭐ 333, 🍴 98, 🐛 5) - Example of an MCP server with custom tools that can be called directly from cursor
typescriptmcpservernpm install kleneway/awesome-cursor-mpc-server - youtube-mcp-server 📘 🏠 📇 (⭐ 332, 🍴 59, 🐛 11) - MCP Server for YouTube API, enabling video management, Shorts creation, and advanced analytics
typescriptmcpserverapihttpnpm install ZubeidHendricks/youtube-mcp-server - obsidian-mcp-tools 📘 🏠 (⭐ 322, 🍴 44, 🐛 8) - Add Obsidian integrations like semantic search and custom Templater prompts to Claude or any MCP client.
typescriptmcpmcp-servermodel-context-protocolnpm install jacksteamdev/obsidian-mcp-tools - minecraft-mcp-server 📘 🏠 (⭐ 317, 🍴 24, 🐛 1) - A Minecraft MCP Server powered by Mineflayer API. It allows to control a Minecraft character in real-time, allowing AI assistants to build structures, explore the world, and interact with the game environment through natural language instruction
typescriptartificial-intelligenceclaudejavascriptlarge-language-modelsnpm install yuniko-software/minecraft-mcp-server - automation-mcp 📘 🏠 (⭐ 315, 🍴 30, 🐛 4) - Control your Mac with detailed mouse, keyboard, screen, and window management capabilities.
typescriptmcpmcp-serverainpm install ashwwwin/automation-mcp - xcode-mcp-server 📘 🏠 (⭐ 314, 🍴 20) - MCP Server implementation for Xcode integration
typescriptmcpserverfilehttpnpm install r-huijts/xcode-mcp-server - evm-mcp-server 📘 🏠 (⭐ 312, 🍴 77, 🐛 5) - MCP server that provides LLMs with tools for interacting with EVM networks
typescriptagentblockchainethereumevmnpm install mcpdotdirect/evm-mcp-server - xhs-mcp 🐍 🏠 (⭐ 307, 🍴 71, 🐛 13) - 小红书MCP服务 x-s x-t js逆向
httpgitgithubpythonmcppip install git+https://github.com/jobsonlook/xhs-mcp - mcp 📘 🏠 (⭐ 304, 🍴 29, 🐛 14) - Enable AI agents to work reliably - giving them secure access to structured data, tools to take action, and the context needed to make smart decisions.
typescriptagentscopilotmcpmcp-servernpm install mondaycom/mcp - applescript-mcp 📘 🏠 (⭐ 298, 🍴 47, 🐛 9) - A macOS AppleScript MCP server
typescriptmcpservernpm install joshrutkowski/applescript-mcp - twitter-mcp 📘 🏠 📇 (⭐ 291, 🍴 38, 🐛 3) - A Model Context Protocol server allows to interact with Twitter, enabling posting tweets and searching Twitter.
typescriptserverapihttpgitnpm install EnesCinr/twitter-mcp - base-mcp 📘 🏠 📇 (⭐ 282, 🍴 93, 🐛 32) - A Model Context Protocol (MCP) server that provides onchain tools for LLMs, allowing them to interact with the Base network and Coinbase API.
typescriptmcpserverapiainpm install base/base-mcp - mcp-nodejs-debugger 📜 🏠 (⭐ 278, 🍴 12) - 🐞 MCP Node.js debugger
javascriptdebuggermcpmcp-servernodejsnpm install hyperdrive-eng/mcp-nodejs-debugger - deepseek-mcp-server 📜 🏠 📇 (⭐ 270, 🍴 33, 🐛 7) - Model Context Protocol server for DeepSeek's advanced language models
javascriptdeepseek-apideepseek-chatdeepseek-r1deepseek-v3npm install DMontgomery40/deepseek-mcp-server - open-mcp 📘 🏠 📇 (⭐ 255, 🍴 28, 🐛 222) - TypeScript-based
typescriptapiwebhttpgitnpm install wegotdocs/open-mcp - mcpsvr 📘 🏠 (⭐ 252, 🍴 41) - Discover Exceptional MCP Servers
typescriptmcp-servermodelcontextprotocolmcpservernpm install nanbingxyz/mcpsvr - MCP-Server-Playwright 📜 🏠 (⭐ 251, 🍴 33, 🐛 9) - MCP server for browser automation using Playwright
javascriptmcpserverhttpgitnpm install Automata-Labs-team/MCP-Server-Playwright - mcp-reasoner 📘 🏠 (⭐ 248, 🍴 26, 🐛 7) - A systematic reasoning MCP server implementation for Claude Desktop with beam search and thought evaluation.
typescriptmcpservernpm install Jacck/mcp-reasoner - perplexity-mcp 📜 🏠 (⭐ 241, 🍴 24, 🐛 3) - A Model Context Protocol (MCP) server for research and documentation assistance using Perplexity AI. Won 1st @ Cline Hackathon
javascriptmcpserveraidocumentationnpm install DaInfernalCoder/perplexity-researcher-mcp - mcp-server-simulator-ios-idb 📘 🏠 (⭐ 237, 🍴 19, 🐛 5) - A Model Context Protocol (MCP) server that enables LLMs to interact with iOS simulators through natural language commands.
typescriptclaudeclineiosmacosnpm install InditexTech/mcp-server-simulator-ios-idb - pdf-reader-mcp 📘 🏠 (⭐ 234, 🍴 29, 🐛 26) - An MCP server built with Node.js/TypeScript that allows AI agents to securely read PDF files (local or URL) and extract text, metadata, or page counts. Uses pdf-parse.
typescriptai-agentllm-toolmcpmodel-content-protocolnpm install shtse8/pdf-reader-mcp - vscode-mcp-server 📘 🏠 (⭐ 227, 🍴 40, 🐛 4) - MCP server to expose VS Code editing features to an LLM for AI coding
typescriptmcpserveraillmnpm install juehang/vscode-mcp-server - puppeteer-mcp-server 📘 🏠 (⭐ 223, 🍴 27, 🐛 8) - This MCP server provides browser automation capabilities through Puppeteer, allowing interaction with both new browser instances and existing Chrome windows.
typescriptmcpservernpm install merajmehrabi/puppeteer-mcp-server - mcp-prompt-server 📜 🏠 (⭐ 217, 🍴 154, 🐛 5) - 这是一个基于Model Context Protocol (MCP)的服务器,用于根据用户任务需求提供预设的prompt模板,帮助Cline/Cursor/Windsurf...更高效地执行各种任务。服务器将预设的prompt作为工具(tools)返回,以便在Cursor和Windsurf等编辑器中更好地使用。
javascriptmcpnpm install gdli6177/mcp-prompt-server - mcp-server-gemini 📜 🏠 📇 (⭐ 215, 🍴 45, 🐛 6) - MCP server implementation for Google's Gemini API
javascriptmcpserverapigonpm install aliargun/mcp-server-gemini - MCP-connect 📘 🏠 (⭐ 214, 🍴 29, 🐛 1) - Enables cloud-based AI services to access local Stdio based MCP servers via HTTP requests
typescriptmcpserveraihttpnpm install EvalsOne/MCP-bridge - firebase-mcp 📘 🏠 (⭐ 209, 🍴 39, 🐛 12) - 🔥 Model Context Protocol (MCP) server for Firebase.
typescriptfirebasemodelcontextprotocolmcpservernpm install gannonh/firebase-mcp - gibber-mcp 📜 🏠 (⭐ 209, 🍴 22, 🐛 4) - Tiny MCP server with cryptography tools, sufficient to establish end-to-end encryption between LLM agents
javascriptmcpserverllmnpm install anton10xr/gibber-mcp - multimodal-mcp-client 📘 🏠 (⭐ 204, 🍴 33, 🐛 5) - A Multi-modal MCP client for voice powered agentic workflows
typescriptgeminimcpmodel-context-protocolvoice-assistantnpm install Ejb503/multimodal-mcp-client - mcp-rb 💎 🏠 (⭐ 202, 🍴 14, 🐛 14) - A lightweight Ruby framework for building MCP servers with a Sinatra-like DSL
rubymcp-servermodelcontextprotocolmcpservergit clone https://github.com/funwarioisii/mcp-rb - g-search-mcp 📘 🏠 (⭐ 201, 🍴 18, 🐛 5) - A powerful MCP server for Google search that enables parallel searching with multiple keywords simultaneously.
typescriptgoogle-searchmcpplaywrightservernpm install jae-jae/g-search-mcp - mcp-server-code-runner 📘 🏠 (⭐ 199, 🍴 26, 🐛 8) - Code Runner MCP Server
typescriptmcpservernpm install formulahendry/mcp-server-code-runner - obsidian-mcp 📜 🏠 (⭐ 197, 🍴 20, 🐛 5) - Obsidian MCP (Model Context Protocol) Server
javascriptmcpservernpm install newtype-01/obsidian-mcp - mcp-searxng 📘 🏠 (⭐ 196, 🍴 36, 🐛 3) - MCP Server for SearXNG
httpgitgithubtypescriptainpm install ihor-sokoliuk/mcp-searxng - mcp-server-commands 📘 🏠 (⭐ 192, 🍴 33, 🐛 5) - Model Context Protocol server to run commands
typescriptserverhttpgitgithubnpm install g0t4/mcp-server-commands - mcp-taskmanager 📜 🏠 (⭐ 192, 🍴 48, 🐛 6) - Node.js-based
javascriptnpm install kazuph/mcp-taskmanager - mcp_code_executor 📜 🏠 (⭐ 187, 🍴 37, 🐛 3) - The MCP Code Executor is an MCP server that allows LLMs to execute Python code within a specified Conda environment.
javascriptmcpserverllmpythonnpm install bazinga012/mcp_code_executor - mcp-proxy 📘 🏠 (⭐ 186, 🍴 36, 🐛 4) - A TypeScript SSE proxy for MCP servers that use stdio transport.
typescriptmcpservernpm install punkpeye/mcp-proxy - mcp-compass 📜 🏠 (⭐ 184, 🍴 23, 🐛 6) - MCP Discovery & Recommendation Service - Find the right MCP server for your needs
javascriptmcpserverhttpgitnpm install liuyoshio/mcp-compass - mcp_flutter 📜 🏠 (⭐ 183, 🍴 17, 🐛 13) - MCP server for Dart VM and Flutter
javascriptdartfluttermcpmcp-servernpm install Arenukvern/mcp_flutter - litemcp 📘 🏠 (⭐ 182, 🍴 14, 🐛 5) - A TypeScript framework for building MCP servers elegantly
typescriptmcpmodel-context-protocoltypescript-libraryservernpm install wong2/litemcp - mcp-server-rag-web-browser 📜 🏠 📇 (⭐ 182, 🍴 23) - A MCP Server for the RAG Web Browser Actor
apiwebhttpgitgithubnpm install apify/mcp-server-rag-web-browser - mcp-maigret 📜 🏠 (⭐ 181, 🍴 28, 🐛 5) - MCP server for maigret, a powerful OSINT tool that collects user account information from various public sources.
javascriptmcpserveraihttpnpm install BurtTheCoder/mcp-maigret - mermaid-mcp-server 📜 🏠 (⭐ 179, 🍴 20, 🐛 4) - A Model Context Protocol (MCP) server that converts Mermaid diagrams to PNG images
javascriptmcpserverainpm install peng-shawn/mermaid-mcp-server - waldzell-mcp 📜 🏠 (⭐ 169, 🍴 27, 🐛 11) - Waldzell AI's monorepo of MCP servers. Use in Claude Desktop, Cline, Roo Code, and more!
javascriptmcpserverainpm install waldzellai/waldzell-mcp - mongo-mcp 📘 🏠 (⭐ 167, 🍴 32, 🐛 14) - A mongo db server for the model context protocol (MCP)
typescriptmcpservergodatabasenpm install QuantGeekDev/mongo-mcp - anki-mcp-server 📜 🏠 (⭐ 161, 🍴 27, 🐛 8) - An MCP server for Anki
javascriptmcpserverwebhttpnpm install scorzeth/anki-mcp-server - gcp-mcp 📘 🏠 (⭐ 159, 🍴 29, 🐛 7) - A Model Context Protocol (MCP) server that enables AI assistants like Claude to interact with your Google Cloud Platform environment. This allows for natural language querying and management of your GCP resources during conversations.
typescriptmcpserveraigcpnpm install eniayomi/gcp-mcp - mcp-n8n-workflow-builder 📘 🏠 (⭐ 157, 🍴 45, 🐛 1) - MCP server for Claude / Cursor building n8n workflow
typescriptmcpservernpm install salacoste/mcp-n8n-workflow-builder - mcp-proxy-server 📘 🏠 (⭐ 156, 🍴 43, 🐛 10) - An MCP proxy server that aggregates and serves multiple MCP resource servers through a single interface
typescriptmcpservernpm install adamwattis/mcp-proxy-server - mcp-trends-hub 📘 🏠 (⭐ 156, 🍴 20, 🐛 7) - 基于 Model Context Protocol (MCP) 协议的全网热点趋势一站式聚合服务
typescriptmcpnpm install baranwang/mcp-trends-hub - search1api-mcp 📘 🏠 📇 (⭐ 153, 🍴 35, 🐛 7) - TypeScript-based
apihttpaigitgithubnpm install fatwang2/search1api-mcp - MCP-Defender 📘 🏠 (⭐ 150, 🍴 13, 🐛 5) - Desktop app that automatically scans and blocks malicious MCP traffic in AI apps like Cursor, Claude, VS Code and Windsurf.
typescriptai-toolsmcpmcp-clientmcp-client-securitynpm install MCP-Defender/MCP-Defender - mcp-server-metamcp 📘 🏠 (⭐ 145, 🍴 39, 🐛 3) - MCP Server MetaMCP manages all your other MCPs in one MCP.
typescriptmcpservernpm install metatool-ai/mcp-server-metamcp - web3-research-mcp 📘 🏠 (⭐ 145, 🍴 59, 🐛 3) - Deep Research for crypto - free & fully local
typescriptmcpmcp-cryptomcp-serverwebnpm install aaronjmars/web3-research-mcp - mcp-gateway 📜 🏠 (⭐ 143, 🍴 14, 🐛 6) - A gateway demo for MCP SSE Server
javascriptclaudemcpmodel-context-protocolservernpm install lightconetech/mcp-gateway - Quickchart-MCP-Server 📜 🏠 (⭐ 142, 🍴 33, 🐛 11) - A Model Context Protocol server for generating charts using QuickChart.io . It allows you to create various types of charts through MCP tools.
javascriptmcpserverhttpgitnpm install GongRzhe/Quickchart-MCP-Server - brave-search-mcp-server 📘 🏠 📇 (⭐ 139, 🍴 26, 🐛 12) - TypeScript-based
typescriptapiwebhttpgitnpm install brave/brave-search-mcp-server - browser-control-mcp 📘 🏠 (⭐ 138, 🍴 31, 🐛 11) - MCP server paired with a browser extension that enables AI agents to control the user's browser.
localhttpaigitgithubnpm install eyalzh/browser-control-mcp - figma-mcp-server 📘 🏠 📇 (⭐ 138, 🍴 16, 🐛 4) - Model Context Protocol server implementation for Figma API
typescriptserverapinpm install TimHolden/figma-mcp-server - mcp-montano-server 📘 🏠 (⭐ 137, 🍴 53, 🐛 4) - Simple MCP Server Implementation
typescriptmcpservernpm install lucasmontano/mcp-montano-server - MCPHub-Desktop 📘 🏠 (⭐ 136, 🍴 23, 🐛 2) - Desktop APP for Discover and Install MCP Servers
typescriptmcpmodel-context-protocolserverhttpnpm install Jeamee/MCPHub-Desktop - Google-Search-MCP-Server 📘 🏠 (⭐ 135, 🍴 42, 🐛 3) - MCP Server built for use with VS Code / Cline / Anthropic - enable google search and ability to follow links and research websites
typescriptmcpserverwebgonpm install mixelpixx/GoogleSearch_McpServer - discordmcp 📘 🏠 (⭐ 134, 🍴 51, 🐛 3) - Discord MCP Server for Claude Integration
typescriptmcpserverhttpgitnpm install v-3/discordmcp - vibe-check-mcp-server 📘 🏠 (⭐ 134, 🍴 19, 🐛 7) - The definitive Vibe Coder's sanity check MCP server: Prevent cascading errors in AI workflows by implementing strategic pattern interrupts. Uses tool call "Vibe Check" with LearnLM 2.0 Flash, fine-tuned for pedagogy and metacognition to enhance complex workflow strategy, and prevents tunnel vision errors.
typescriptagentic-aiagentic-workflowai-agentscpinpm install PV-Bhat/vibe-check-mcp-server - sketchup-mcp 💎 🏠 (⭐ 133, 🍴 18, 🐛 11) - Sketchup Model Context Protocol
rubygit clone https://github.com/mhyrr/sketchup-mcp - mcp-zotero 📘 🏠 (⭐ 132, 🍴 16, 🐛 11) - A connector for Claude Desktop to work with collection and sources on your Zotero Cloud.
typescripthttpllmgitgithubnpm install kaliaboi/mcp-zotero - notion-mcp-server 📘 🏠 📇 (⭐ 131, 🍴 18, 🐛 1) - Notion MCP Server is a Model Context Protocol (MCP) server implementation that enables AI assistants to interact with Notion's API. This production-ready server provides a complete set of tools.
typescriptmcpmcp-servernotionnotion-ainpm install awkoy/notion-mcp-server - spotify-mcp-server 📘 🏠 (⭐ 131, 🍴 30, 🐛 5) - TypeScript-based
typescripthttpaigitgithubnpm install marcelmarais/spotify-mcp-server - strava-mcp 📘 🏠 📇 (⭐ 131, 🍴 16, 🐛 4) - A Model Context Protocol (MCP) server that connects to Strava API, providing tools to access Strava data through LLMs
typescriptmcpserverapillmnpm install r-huijts/strava-mcp - lsp-mcp 📘 🏠 (⭐ 130, 🍴 12, 🐛 5) - An Model Context Protocol (MCP) server that provides LLMs/AI Agents with the capabilities of a language server protocol (LSP) server. This gives the AI the ability to get language aware context from the codebase.
typescriptmcpserveraillmnpm install jonrad/lsp-mcp - mcp-client-server 📘 🏠 (⭐ 123, 🍴 8, 🐛 1) - An MCP Server that's also an MCP Client. Useful for letting Claude develop and test MCPs without needing to reset the application.
typescriptmcpservernpm install willccbb/mcp-client-server - claude-code-mcp 📘 🏠 (⭐ 122, 🍴 16, 🐛 1) - Letting Claude Code develop his own MCP tools :)
typescriptmcpnpm install willccbb/claude-code-mcp - think-mcp-server 📘 🏠 (⭐ 119, 🍴 12, 🐛 1) - TypeScript-based
typescriptnpm install PhillipRt/think-mcp-server - mcp 📘 🏠 (⭐ 118, 🍴 13, 🐛 16) - Official PostHog MCP Server 🦔
typescriptanalyticsfeature-flagsllmsmcpnpm install posthog/mcp - xero-mcp-server 📘 🏠 📇 (⭐ 117, 🍴 63, 🐛 13) - An MCP server that integrates with the MCP protocol. https://modelcontextprotocol.io/introduction
typescriptmcpserverhttpapinpm install XeroAPI/xero-mcp-server - bilibili-mcp-js 📘 🏠 (⭐ 116, 🍴 21, 🐛 4) - TypeScript-based
typescripthttpaigitgithubnpm install 34892002/bilibili-mcp-js - linear-mcp 📘 🏠 (⭐ 116, 🍴 39, 🐛 9) - a private MCP server for accessing Linear
typescriptmcpservernpm install cline/linear-mcp - postgresql-mcp-server 📘 🏠 (⭐ 116, 🍴 19, 🐛 1) - A Powerful PostgreSQL MCP server with 14 consolidated database management tools for AI assistants.
typescriptmcpserverdatabaseainpm install HenkDz/postgresql-mcp-server - UnityMCP 🔷 🏠 (⭐ 112, 🍴 4, 🐛 2) - Unity Editor integration with Model Context Protocol (MCP) enabling AI assistants like Claude to interact with Unity projects. Features a TypeScript MCP server and C# Unity plugin with extensible command handler architecture, TCP/IP communication, and dynamic plugin discovery.
c#csharpmodel-context-protocoltypescriptunity-editorgit clone https://github.com/isuzu-shiranui/UnityMCP - Deepseek-Thinking-Claude-3.5-Sonnet-CLINE-MCP 📜 🏠 (⭐ 109, 🍴 25, 🐛 1) - 🧠 MCP server implementing RAT (Retrieval Augmented Thinking) - combines DeepSeek's reasoning with GPT-4/Claude/Mistral responses, maintaining conversation context between interactions.
javascriptmcpserverainpm install newideas99/RAT-retrieval-augmented-thinking-MCP - mcp-mysql-server 📜 🏠 (⭐ 109, 🍴 24, 🐛 10) - A Model Context Protocol server for MySQL database operations
javascriptserverdatabasemysqlhttpnpm install f4ww4z/mcp-mysql-server - n8n-mcp-server 📘 🏠 (⭐ 109, 🍴 30, 🐛 6) - MCP server implementation for n8n workflow automation
typescriptmcpservernpm install illuminaresolutions/n8n-mcp-server - mcp-server-serper 📘 🏠 📇 (⭐ 108, 🍴 19, 🐛 5) - Serper MCP Server supporting search and webpage scraping
typescriptmcpserverapiwebnpm install marcopesani/mcp-server-serper - app-store-connect-mcp-server 📘 🏠 📇 (⭐ 106, 🍴 18, 🐛 3) - TypeScript-based
typescriptapihttpgitgithubnpm install JoshuaRileyDev/app-store-connect-mcp-server - smileyCoin 🏠 (⭐ 104, 🍴 10) - simple web ui to manage mcp (model context protocol) servers in the claude app
c++mcpserverwebgit clone https://github.com/zueai-mcp/mcp-manager - mcp-server-apple-reminders 📘 🏠 (⭐ 103, 🍴 19, 🐛 9) - TypeScript-based
typescripthttpgitgithubnpm install FradSer/mcp-server-apple-reminders - agent 📘 🏠 (⭐ 101, 🍴 15, 🐛 3) - A unified Model Context Protocol server implementation that aggregates multiple MCP servers into one.
typescriptmcpmcp-clientmcp-gatewaymcp-proxygit clone https://github.com/1mcp-app/agent - mcp-linear 📘 🏠 (⭐ 101, 🍴 20, 🐛 6) - MCP server that enables AI assistants to interact with Linear project management system through natural language, allowing users to retrieve, create, and update issues, projects, and teams.
typescriptclaudecursorlinearmcpnpm install tacticlaunch/mcp-linear - mcp-confluent 📘 🏠 📇 (⭐ 99, 🍴 29, 🐛 9) - TypeScript-based
typescriptapiresthttpgitnpm install confluentinc/mcp-confluent - memory-bank-MCP 📘 🏠 (⭐ 99, 🍴 17, 🐛 1) - Memory Bank is an MCP server that helps teams create, manage, and access structured project documentation. It generates and maintains a set of interconnected Markdown documents that capture different aspects of project knowledge, from high-level goals to technical details and day-to-day progress.
typescriptmcpserveraigonpm install tuncer-byte/memory-bank-MCP - mcp-server-asana 📘 🏠 📇 (⭐ 97, 🍴 37, 🐛 10) - TypeScript-based
typescriptapihttpanthropicgitnpm install roychri/mcp-server-asana - next-mcp-server 📘 🏠 (⭐ 97, 🍴 8, 🐛 2) - Help LLMs to understand your Next apps better
typescriptllmnpm install jazelly/next-mcp-server - slack-mcp-server 📜 🏠 (⭐ 96, 🍴 21, 🐛 3) - A Slack MCP server (Node.js-based)
javascriptmcpservernpm install ubie-oss/slack-mcp-server - unreal-analyzer-mcp 📘 🏠 (⭐ 96, 🍴 19, 🐛 5) - MCP server for Unreal Engine 5
typescriptmcpservernpm install ayeletstudioindia/unreal-analyzer-mcp - google-slides-mcp 📘 🏠 (⭐ 95, 🍴 19, 🐛 1) - MCP Server for Google Slides
typescriptmcpservergonpm install matteoantoci/google-slides-mcp - mcp-server-salesforce 📘 🏠 (⭐ 95, 🍴 52, 🐛 7) - Salesforce MCP Server
typescriptclaudemcpmodelcontextprotocolsalesforcenpm install tsmztech/mcp-server-salesforce - mcpm 📘 🏠 (⭐ 95, 🍴 23, 🐛 3) - A command-line tool for managing MCP servers in Claude App. Also can run a MCP Server to help you manage all your MCP Servers
typescriptclaudeclimcpmodel-context-protocolnpm install MCP-Club/mcpm - ghost-mcp 📘 🏠 (⭐ 94, 🍴 27, 🐛 3) - A Model Context Protocol (MCP) server for interacting with Ghost CMS through LLM interfaces like Claude. Allow you to control your Ghost blog by simply asking Claude etc.
typescriptclaudeclaude-aighostghost-blognpm install MFYDev/ghost-mcp - mcp-server-datadog 📘 🏠 (⭐ 94, 🍴 40, 🐛 10) - TypeScript-based
typescriptnpm install winor30/mcp-server-datadog - mcp-create 📘 🏠 (⭐ 93, 🍴 15, 🐛 5) - TypeScript-based
typescripthttpgitgithubnpm install tesla0225/mcp-create - ai-command 🐘 🏠 (⭐ 92, 🍴 15, 🐛 15) - Control WordPress using WP-CLI, AI, and MCP.
phpmcpmcp-clientmcp-hostmcp-servergit clone https://github.com/mcp-wp/ai-command - google-docs-mcp 📘 🏠 (⭐ 92, 🍴 23, 🐛 7) - Google Docs MCP is an MCP server (primarily for use in Claude Desktop) that gains full access to your google docs and allows claude to make direct edits and formatting. Use cases include writing notes, letters, resumes, creating tables, etc.
typescriptmcpserveraigonpm install a-bonus/google-docs-mcp - sonarqube-mcp-server 📘 🏠 📇 (⭐ 91, 🍴 13, 🐛 10) - Model Context Protocol (MCP) server for SonarQube
typescriptmcpmcp-servermodel-context-protocolmodel-context-protocol-serversnpm install sapientpants/sonarqube-mcp-server - vectorize-mcp-server 📜 🏠 (⭐ 90, 🍴 17, 🐛 3) - Official Vectorize MCP Server
javascriptmcpmcp-serverservernpm install vectorize-io/vectorize-mcp-server - mcp-3D-printer-server 📘 🏠 (⭐ 89, 🍴 20, 🐛 4) - Connects MCP to major 3D printer APIs (Orca, Bambu, OctoPrint, Klipper, Duet, Repetier, Prusa, Creality). Control prints, monitor status, and perform advanced STL operations like scaling, rotation, sectional editing, and base extension. Includes slicing and visualization.
typescript3d-printing3mfbambu-labbambu-studionpm install DMontgomery40/mcp-3D-printer-server - mcp-windows-desktop-automation 📘 🏠 (⭐ 89, 🍴 21, 🐛 5) - A Model Context Protocol (MCP) server for Windows desktop automation using AutoIt.
typescriptmcpservernpm install mario-andreschak/mcp-windows-desktop-automation - pluggedin-mcp-proxy 📘 🏠 (⭐ 88, 🍴 16, 🐛 1) - Plugged.in MCP Server manages all your other MCPs in one MCP.
typescriptmcpserverhttpgitnpm install VeriTeknik/pluggedin-mcp-proxy - coincap-mcp 📘 🏠 📇 (⭐ 87, 🍴 26, 🐛 7) - A coincap mcp server to access crypto data from coincap API
typescriptmcpserverapihttpnpm install QuantGeekDev/coincap-mcp - http-oauth-mcp-server 📘 🏠 (⭐ 87, 🍴 10, 🐛 2) - Remote MCP server (SEE + Streamable HTTP) implementing the MCP spec's authorization extension. Use directly from your agents, or from Cursor / Claude with mcp-remote
typescriptmcpserverauthhttpnpm install NapthaAI/http-oauth-mcp-server - claude-prompts-mcp 📘 🏠 (⭐ 86, 🍴 24, 🐛 6) - Claude MCP Server - Intelligent Prompt Engineering & Management
typescriptai-automationai-developmentai-orchestrationai-workflowsnpm install minipuft/claude-prompts-mcp - lapras-mcp-server 📘 🏠 (⭐ 86, 🍴 2, 🐛 2) - lapras.com 公式MCP Server
typescriptmcpmcp-serverservernpm install lapras-inc/lapras-mcp-server - mcp-server-and-gw 📜 🏠 (⭐ 85, 🍴 11, 🐛 3) - An MCP stdio to HTTP SSE transport gateway with example server and MCP client
javascriptmcpserverhttpnpm install boilingdata/mcp-server-and-gw - bsc-mcp 📘 🏠 (⭐ 83, 🍴 26, 🐛 4) - TypeScript-based
typescripthttpaimlgitnpm install TermiX-official/bsc-mcp - frappe_mcp_server 📘 🏠 (⭐ 83, 🍴 40, 🐛 7) - JavaScript/TypeScript implementation of Frappe MCP server (legacy version) - See frappe-mcp-server for the new Python implementation with advanced filtering
typescriptmcpserverpythonnpm install appliedrelevance/frappe_mcp_server - game-asset-mcp 📜 🏠 (⭐ 83, 🍴 17, 🐛 4) - An MCP server for creating 2D/3D game assets from text using Hugging Face AI models.
javascriptmcpserverainpm install MubarakHAlketbi/game-asset-mcp - manusmcp 📘 🏠 (⭐ 83, 🍴 10, 🐛 2) - ManusMCP is a project that implements AI agent workflows using Flowise. It features specialized AI agents with distinct roles (Planner, FileWizard, CommandRunner, WebNavigator) that can be used for task automation and complex problem-solving.
typescriptmcpwebainpm install mantrakp04/manusmcp - mcp-replicate 📘 🏠 📇 (⭐ 83, 🍴 18, 🐛 6) - Model Context Protocol server for Replicate's API
typescriptserverapihttpgitnpm install deepfates/mcp-replicate - web3-mcp 📘 🏠 (⭐ 83, 🍴 24, 🐛 5) - 1 MCP to rule all them chains
typescriptmcpainpm install strangelove-ventures/web3-mcp - browser-mcp 📘 🏠 (⭐ 82, 🍴 13, 🐛 1) - A browser extension and MCP server that allows you to interact with the browser you are using.
typescriptmcpservernpm install djyde/browser-mcp - gtasks-mcp 📘 🏠 📇 (⭐ 82, 🍴 28, 🐛 13) - A Google Tasks Model Context Protocol Server for Claude
typescriptservergoapihttpnpm install zcaceres/gtasks-mcp - mcp-virustotal 📘 🏠 📇 (⭐ 82, 🍴 10, 🐛 4) - A Model Context Protocol (MCP) server for querying the VirusTotal API.
typescriptmcpserverapirustnpm install BurtTheCoder/mcp-virustotal - mcp-miro 📘 🏠 📇 (⭐ 81, 🍴 26, 🐛 7) - TypeScript-based
typescriptapiauthoauthrestnpm install evalstate/mcp-miro - MiniMax-MCP-JS 📘 🏠 📇 (⭐ 81, 🍴 29, 🐛 4) - Official MiniMax Model Context Protocol (MCP) JavaScript implementation that provides seamless integration with MiniMax's powerful AI capabilities including image generation, video generation, text-to-speech, and voice cloning APIs.
typescriptimage-generationmcpmcp-servermcp-toolsnpm install MiniMax-AI/MiniMax-MCP-JS - server-google-news 📜 🏠 📇 (⭐ 81, 🍴 19, 🐛 3) - 【Star-crossed coders unite!⭐️】Model Context Protocol (MCP) server implementation providing Google News search capabilities via SerpAPI, with automatic news categorization and multi-language support.
httpgitgithubjavascriptainpm install ChanMeng666/server-google-news - pentest-mcp 📜 🏠 (⭐ 80, 🍴 17, 🐛 2) - NOT for educational purposes: An MCP server for professional penetration testers including STDIO/HTTP/SSE support, nmap, go/dirbuster, nikto, JtR, hashcat, wordlist building, and more.
javascriptcybersecuritydirbustergobusterhashcatnpm install DMontgomery40/pentest-mcp - agentcare-mcp 📜 🏠 (⭐ 79, 🍴 27, 🐛 8) - MCP Server for EMRs with FHIR
javascriptmcpservernpm install Kartha-AI/agentcare-mcp - yt-dlp-mcp 📘 🏠 (⭐ 79, 🍴 28, 🐛 1) - A Model Context Protocol (MCP) server that bridges Video & Audio content with Large Language Models using yt-dlp.
typescriptmcpservernpm install kevinwatt/yt-dlp-mcp - mcp-screenshot-website-fast 📜 🏠 📇 (⭐ 78, 🍴 7, 🐛 1) - Quickly screenshots webpages and converts to an LLM friendly size
javascriptclaudecodexfastmcpnpm install just-every/mcp-screenshot-website-fast - TRAVEL-PLANNER-MCP-Server 📜 🏠 📇 (⭐ 78, 🍴 27, 🐛 3) - Node.js-based
javascriptapihttpaigitnpm install GongRzhe/TRAVEL-PLANNER-MCP-Server - mcp_server_exe 📘 🏠 (⭐ 77, 🍴 11, 🐛 4) - 小智 & Cursor 的 MCP 启动器 - MCP For Cursor&xiaozhi。打包成可执行文件。Turn MCP server into an executable file
typescriptcursorexemcpmcp-clientnpm install shadowcz007/mcp_server_exe - mcp-read-website-fast 📜 🏠 (⭐ 77, 🍴 11, 🐛 1) - Quickly reads webpages and converts to markdown for fast, token efficient web scraping
javascriptclaudecodexcrawlerfastnpm install just-every/mcp-read-website-fast - mcp-server-stability-ai 📘 🏠 (⭐ 77, 🍴 26, 🐛 10) - MCP Server integrating MCP Clients with Stability AI-powered image manipulation functionalities: generate, edit, upscale, and more.
typescriptmcpserverainpm install tadasant/mcp-server-stability-ai - OmniFocus-MCP 📘 🏠 (⭐ 77, 🍴 21, 🐛 3) - Let LLMs interface with your tasks and projects through the Model Context Protocol. Add, organize, and query your OmniFocus database with natural language commands.
typescriptmcpmcp-servermodelcontextprotocolomnifocusnpm install themotionmachine/OmniFocus-MCP - plane-mcp-server 📘 🏠 📇 (⭐ 77, 🍴 20, 🐛 12) - Plane's Official Model Context Protocol Server 🔌 ⌨️ 🔥
javascriptservertypescriptmcp-servermodel-context-protocolnpm install kelvin6365/plane-mcp-server - mcp-node 📘 🏠 (⭐ 76, 🍴 17, 🐛 21) - MCP server for interacting with Algolia
typescriptalgoliamcpservergonpm install algolia/mcp-node - mcp-postman 📘 🏠 (⭐ 76, 🍴 17, 🐛 7) - MCP Server for running Postman Collections with Newman
typescriptmcpserverlocalhttpnpm install shannonlal/mcp-postman - paperless-mcp 📘 🏠 📇 (⭐ 76, 🍴 23, 🐛 4) - An MCP (Model Context Protocol) server for interacting with a Paperless-NGX API server. This server provides tools for managing documents, tags, correspondents, and document types in your Paperless-NGX instance.
typescriptclaudedocument-managementmcpmodel-context-protocolnpm install nloui/paperless-mcp - private-journal-mcp 📘 🏠 (⭐ 76, 🍴 10, 🐛 4) - A lightweight MCP server that provides Claude with a private journaling capability to process feelings and thoughts
typescriptmcpservernpm install obra/private-journal-mcp - claudeus-wp-mcp 📘 🏠 (⭐ 75, 🍴 34, 🐛 4) - TypeScript-based
typescriptnpm install deus-h/claudeus-wp-mcp - mcp-codex-keeper 📘 🏠 (⭐ 75, 🍴 25, 🐛 9) - An intelligent MCP server that serves as a guardian of development knowledge, providing Cline assistants with curated access to latest documentation and best practices across the software development landscape
typescriptmcpserverdocumentationnpm install aindreyway/mcp-codex-keeper - mcp-DEEPwebresearch 📘 🏠 (⭐ 75, 🍴 22, 🐛 6) - Enhanced MCP server for deep web research
typescriptmcpserverwebnpm install qpd-v/mcp-DEEPwebresearch - shopify-mcp 📘 🏠 📇 (⭐ 75, 🍴 24, 🐛 2) - MCP server for Shopify api, usable on mcp hosts such as Claude and Cursor
typescriptmcpmcp-servershopifyservernpm install GeLi2001/shopify-mcp - JSON-MCP-Server 📜 🏠 (⭐ 74, 🍴 18, 🐛 5) - JSON handling and processing mcp server
javascriptmcpserverjsonhttpnpm install GongRzhe/JSON-MCP-Server - mcp-prompts 📘 🏠 (⭐ 74, 🍴 16, 🐛 28) - Model Context Protocol server for managing, storing, and providing prompts and prompt templates for LLM interactions.
typescriptserverllmnpm install sparesparrow/mcp-prompts - mcp-shodan 📜 🏠 📇 (⭐ 74, 🍴 11, 🐛 4) - MCP server for querying the Shodan API
javascriptmcpserverapihttpnpm install BurtTheCoder/mcp-shodan - Vibe-Coder-MCP 📘 🏠 (⭐ 74, 🍴 18, 🐛 2) - Vibe-Coder-MCP server extends AI assistants with specialized software development tools.
typescriptagentsaugmentcodeclaude-desktopclinenpm install freshtechbro/Vibe-Coder-MCP - wordpress-mcp-server 📜 🏠 (⭐ 74, 🍴 23, 🐛 3) - This MCP server let you automate interactions with Wordpress
javascriptmcpservernpm install stefans71/wordpress-mcp-server - crypto-indicators-mcp 📜 🏠 (⭐ 73, 🍴 32, 🐛 5) - An MCP server providing a range of cryptocurrency technical analysis indicators and strategies.
javascriptmcpserverhttpgitnpm install kukapay/crypto-indicators-mcp - mcp-server 📘 🏠 📇 (⭐ 73, 🍴 23, 🐛 8) - Model Context Protocol (MCP) server for the Webflow Data API.
typescriptbuilt-with-fernbusiness-critical-yesgenerated-from-openapimcp-servernpm install webflow/mcp-server - vscode-mcp 📘 🏠 (⭐ 73, 🍴 13, 🐛 5) - TypeScript-based
typescriptnpm install block/code-mcp - mcp-server-multiverse 📘 🏠 (⭐ 71, 🍴 14, 🐛 6) - A middleware server that enables multiple isolated instances of the same MCP servers to coexist independently with unique namespaces and configurations.
typescriptmcpserverhttpgitnpm install lamemind/mcp-server-multiverse - ragie-mcp-server 📜 🏠 (⭐ 71, 🍴 16, 🐛 1) - Ragie Model Context Protocol Server
javascriptserverhttpaigitnpm install ragieai/ragie-mcp-server - mcp-tavily 🐍 🏠 📇 (⭐ 70, 🍴 16) - An MCP server for Tavily's search API
pythonmcpnewssearchtavilypip install git+https://github.com/RamXX/mcp-tavily - NASA-MCP-server 📘 🏠 📇 (⭐ 70, 🍴 13, 🐛 2) - A Model Context Protocol (MCP) server for NASA APIs, providing a standardized interface for AI models to interact with NASA's vast array of data sources.
typescriptmcpserverapiainpm install ProgramComputer/NASA-MCP-server - selfhosted-supabase-mcp 📘 🏠 (⭐ 69, 🍴 19, 🐛 12) - An MCP Server for your Self Hosted Supabase
typescriptmcpservernpm install HenkDz/selfhosted-supabase-mcp - mcp-memory-libsql 📘 🏠 (⭐ 68, 🍴 12, 🐛 9) - 🧠 High-performance persistent memory system for Model Context Protocol (MCP) powered by libSQL. Features vector search, semantic knowledge storage, and efficient relationship management - perfect for AI agents and knowledge graph applications.
typescriptai-toolsembeddingsknowledge-graphlibsqlnpm install spences10/mcp-memory-libsql - mcp-server-sample 📘 🏠 (⭐ 68, 🍴 40, 🐛 1) - Modelo de Servidor MCP baseado na documentação oficial
typescriptmcpnpm install gabrielfroes/mcp-server-sample - mcp-server-shortcut 📘 🏠 (⭐ 67, 🍴 28, 🐛 10) - The MCP server for Shortcut
typescriptmcpserverwebfilenpm install useshortcut/mcp-server-shortcut - mcp-llms-txt-explorer 📜 🏠 (⭐ 66, 🍴 14, 🐛 2) - MCP to explore websites with llms.txt files
javascriptcursorllms-txtllmstxtmcpnpm install thedaviddias/mcp-llms-txt-explorer - ChEMBL-MCP-Server 📜 🏠 (⭐ 65, 🍴 7, 🐛 2) - A comprehensive Model Context Protocol (MCP) server providing advanced access to the ChEMBL chemical database.
javascriptchemblcheminformaticsdrug-designdrug-discoverynpm install Augmented-Nature/Augmented-Nature-ChEMBL-MCP-Server - MCP-server-Deepseek_R1 📜 🏠 (⭐ 65, 🍴 12) - A Model Context Protocol (MCP) server implementation connecting Claude Desktop with DeepSeek's language models (R1/V3)
javascriptmcpserverhttpgitnpm install 66julienmartin/MCP-server-Deepseek_R1 - mcp-server-gsc 📘 🏠 (⭐ 65, 🍴 26, 🐛 1) - A Model Context Protocol (MCP) server providing access to Google Search Console
typescriptmcpservergohttpnpm install ahonn/mcp-server-gsc - airtable-mcp 📜 🏠 📇 (⭐ 64, 🍴 33, 🐛 5) - Search, create and update Airtable bases, tables, fields, and records using Claude Desktop and MCP (Model Context Protocol) clients
javascriptmcpaiairtableairtable-apinpm install felores/airtable-mcp - heroku-mcp-server 📘 🏠 (⭐ 64, 🍴 17, 🐛 11) - Heroku Platform MCP Server using the Heroku CLI
typescriptmcpserverdatabasehttpnpm install heroku/heroku-mcp-server - mcp-openai 📜 🏠 (⭐ 64, 🍴 21, 🐛 7) - Chat with OpenAI models from Claude Desktop
javascriptaihttpopenaigitnpm install mzxrai/mcp-openai - onchain-mcp 📘 🏠 📇 (⭐ 64, 🍴 14, 🐛 3) - Bringing the bankless onchain API to MCP
typescriptmcpapiaihttpnpm install bankless/onchain-mcp - amazon-fresh-server 📜 🏠 (⭐ 64, 🍴 6, 🐛 1) - An amazon fresh mcp server
javascriptmcpservernpm install Alec2435/amazon-fresh-server - mcp-server 📘 🏠 📇 (⭐ 63, 🍴 14, 🐛 15) - Pulumi MCP Server (TypeScript-based)
typescriptmcpserverhttpgitnpm install pulumi/mcp-server - mcp-server-circleci 📘 🏠 (⭐ 63, 🍴 36, 🐛 17) - A specialized server implementation for the Model Context Protocol (MCP) designed to integrate with CircleCI's development workflow. This project serves as a bridge between CircleCI's infrastructure and the Model Context Protocol, enabling enhanced AI-powered development experiences.
typescriptmcp-servermodelcontextprotocolmcpservernpm install CircleCI-Public/mcp-server-circleci - woocommerce-mcp-server 📜 🏠 (⭐ 63, 🍴 30, 🐛 5) - A WooCommerce (MCP) Model Context Protocol server
javascriptmcpmcp-serverwoocommercewordpressnpm install techspawn/woocommerce-mcp-server - deepseek-thinker-mcp 📜 🏠 📇 (⭐ 62, 🍴 14, 🐛 3) - A MCP provider Deepseek reasoning content to MCP-enabled AI Clients, like Claude Desktop. Supports access to Deepseek's CoT from the Deepseek API service or a local Ollama server.
javascriptmcpserverapiainpm install ruixingshi/deepseek-thinker-mcp - editor-mcp-server 📘 🏠 (⭐ 62, 🍴 12, 🐛 4) - MCP Server for AI automation of the PlayCanvas Editor
typescriptjavascriptmcpmcp-serverplaycanvasnpm install playcanvas/editor-mcp-server - multi-ai-advisor-mcp 📘 🏠 (⭐ 62, 🍴 17, 🐛 2) - council of models for decision
typescriptai-communicationollamahttpainpm install YuChenSSR/multi-ai-advisor-mcp - roam-research-mcp 📘 🏠 (⭐ 62, 🍴 14) - MCP Server for Roam Research Graph Integration
typescriptmcpservernpm install 2b3pro/roam-research-mcp - community-servers 📜 🏠 (⭐ 61, 🍴 19, 🐛 6) - This repository contains a collection of community-maintained Model Context Protocol (MCP) servers. All servers are automatically listed on the MCP Get registry and can be viewed and installed via CLI
javascriptmcpserverainpm install mcp-get/community-servers - contentful-mcp 📘 🏠 📇 (⭐ 61, 🍴 17, 🐛 10) - MCP (Model Context Protocol) server for the Contentful Management API
typescriptmcpserverapihttpnpm install ivo-toby/contentful-mcp - ls-mcp 📘 🏠 (⭐ 61, 🍴 5, 🐛 2) - List MCP Server configurations in your system used by AI applications like Cursor, Claude Desktop, VS Code and others
typescriptclaude-aiclaude-desktopcursorcursor-ainpm install lirantal/ls-mcp - mcpadvisor 📘 🏠 (⭐ 61, 🍴 11, 🐛 5) - MCP Advisor & Installation - Use the right MCP server for your needs
typescriptmcpservernpm install istarwyh/mcpadvisor - mcp-guide 📜 🏠 (⭐ 61, 🍴 15, 🐛 4) - A beginner-friendly guide server that helps users understand MCP concepts, provides interactive examples, and demonstrates best practices for building MCP integrations. Features tools for exploring MCP capabilities, resources for learning core concepts, and prompts for guided tutorials.
javascriptmcpservernpm install qpd-v/mcp-guide - agentic-tools-mcp 📘 🏠 (⭐ 60, 🍴 12, 🐛 3) - A comprehensive Model Context Protocol (MCP) server providing AI assistants with powerful task management and agent memories capabilities with project-specific storage.
typescriptmcpserverainpm install Pimzino/agentic-tools-mcp - kollektiv-mcp 📘 🏠 (⭐ 60, 🍴 3, 🐛 2) - Kollektiv MCP enables you to chat with and query your own documents directly from IDEs and MCP clients. Private, secure, and integrated into your favorite code editor
typescriptcloudflare-workersmcp-servermodelcontextprotocolmcpnpm install alexander-zuev/kollektiv-mcp - mcp-openapi 📘 🏠 📇 (⭐ 60, 🍴 10, 🐛 6) - OpenAPI specification MCP server.
typescriptclinecursormcp-serveropenapinpm install ReAPI-com/mcp-openapi - fastmcp-boilerplate 📘 🏠 (⭐ 59, 🍴 26, 🐛 1) - A simple MCP server built using FastMCP, TypeScript, ESLint, and Prettier.
typescriptboilerplatefastmcpmcpservernpm install punkpeye/fastmcp-boilerplate - PubMed-MCP-Server 🐍 🏠 (⭐ 59, 🍴 23, 🐛 8) - 🔍 Enable AI assistants to search, access, and analyze PubMed articles through a simple MCP interface.
typescriptai-agentsai-toolsbio-medical-researchmcpnpm install cyanheads/pubmed-mcp-server - shadcn-ui-mcp-server 📜 🏠 (⭐ 59, 🍴 8, 🐛 2) - MCP server for shadcn/ui component references
typescriptjavascriptmcp-servershadcn-uimcpnpm install heilgar/shadcn-ui-mcp-server - template-mcp-server 📜 🏠 (⭐ 59, 🍴 33, 🐛 1) - Template to quickly set up your own MCP server
javascriptagentboilerplatemcpmcp-servernpm install mcpdotdirect/template-mcp-server - duckduckgo-mcp-server 📘 🏠 (⭐ 58, 🍴 5, 🐛 1) - TypeScript-based
typescriptnpm install zhsama/duckduckgo-mpc-server - bitcoin-mcp 📘 🏠 (⭐ 57, 🍴 16, 🐛 1) - Bitcoin & Lightning Network MCP Server.
typescriptai-agentsbitcoinclaude-desktopgoosenpm install AbdelStark/bitcoin-mcp - docs-mcp 📜 🏠 (⭐ 57, 🍴 15, 🐛 3) - Turn any github repo to MCP server, and chat with code or docs
javascriptmcpservernpm install buger/docs-mcp - gitlab-mr-mcp 📜 🏠 (⭐ 57, 🍴 17, 🐛 6) - Interact seamlessly with GitLab repositories to manage merge requests and issues. Fetch details, add comments, and streamline your code review process with ease.
javascriptgitlabmcpmcp-servermerge-requestsnpm install kopfrechner/gitlab-mr-mcp - rijksmuseum-mcp 📜 🏠 📇 (⭐ 57, 🍴 12, 🐛 3) - Rijksmuseum MCP integration for artwork exploration and analysis
javascriptmcpapihttpainpm install r-huijts/rijksmuseum-mcp - smart-pet-with-mcp 🏠 (⭐ 57, 🍴 9, 🐛 1) - 一个桌宠形式的mcp client,可以对接任意mcp server,配合测试的mcp server 开源地址:https://github.com/shijianzhong/mcp-server-for-pc
vuemcpserverhttpgit clone https://github.com/shijianzhong/smart-pet-with-mcp - minecraft-mcp 📘 🏠 (⭐ 56, 🍴 19, 🐛 1) - MCP server for minecraft
typescriptmcpservernpm install FundamentalLabs/minecraft-mcp - raindrop-io-mcp-server 📘 🏠 (⭐ 56, 🍴 11, 🐛 17) - An integration that allows LLMs to interact with Raindrop.io bookmarks using the Model Context Protocol (MCP).
typescriptmodelcontextprotocolraindrop-iomcpainpm install hiromitsusasaki/raindrop-io-mcp-server - Sketch-Context-MCP 📜 🏠 (⭐ 56, 🍴 11, 🐛 6) - MCP server to provide Sketch layout information to AI coding agents like Cursor
javascriptmcpserverainpm install jshmllr/sketch-context-mcp - taskqueue-mcp 📘 🏠 (⭐ 56, 🍴 10, 🐛 17) - MCP tool for exposing a structured task queue to guide AI agent workflows. Great for taming an over-enthusiastic Claude.
typescriptmcpainpm install chriscarrollsmith/taskqueue-mcp - cursor10x-mcp 📜 🏠 (⭐ 54, 🍴 11, 🐛 10) - The Cursor10x MCP is a persistent multi-dimensional memory system for Cursor that enhances AI assistants with conversation context, project history, and code relationships across sessions.
javascriptagent-dbagent-memoryagenticagentic-ainpm install aurda012/cursor10x-mcp - Jira-MCP-Server 📜 🏠 (⭐ 54, 🍴 22, 🐛 4) - MCP server that allows interaction with Jira using natural language
javascriptmcpservernpm install George5562/Jira-MCP-Server - mcp-neo4j-server 📘 🏠 (⭐ 54, 🍴 11) - mcp-neo4j-server (TypeScript-based)
typescriptmcpserverdatabasehttpnpm install da-okazaki/mcp-neo4j-server - mcpn 📘 🏠 (⭐ 54, 🍴 8) - orchestrate & combine prompts + MCP servers into compound MCP tools
typescriptmcpservernpm install AgentDeskAI/workflows-mcp - codebase-mcp 📘 🏠 (⭐ 53, 🍴 9, 🐛 5) - Model Context Protocol implementation for retrieving codebases using RepoMix
typescriptnpm install DeDeveloper23/codebase-mcp - openai-mcp-client 📘 🏠 (⭐ 53, 🍴 10) - A rudimentary implementation of Anthropic's Model Context Protocol with OpenAIs Model
typescriptainpm install ResoluteError/openai-mcp-client - rember-mcp 📘 🏠 (⭐ 53, 🍴 7, 🐛 3) - A Model Context Protocol (MCP) server for Rember.
typescriptmcpserverhttpgitnpm install rember/rember-mcp - advanced-pocketbase-mcp-server 📜 🏠 (⭐ 52, 🍴 16, 🐛 4) - pocketbase-mcp-server
javascriptmcpservernpm install DynamicEndpoints/pocketbase-mcp-server - federated-mcp 📘 🏠 (⭐ 52, 🍴 10) - This implementation follows the official MCP specification, including proper message framing, transport layer implementation, and complete protocol lifecycle management. It provides a foundation for building federated MCP systems that can scale across multiple servers while maintaining security and standardization requirements.
typescriptmcpserverainpm install ruvnet/federated-mcp - md2card-mcp-server 📘 🏠 (⭐ 52, 🍴 6, 🐛 1) - md2card-mcp-server (TypeScript-based)
typescriptmcpservernpm install maqi1520/md2card-mcp-server - memories-with-lessons-mcp-server 📜 🏠 (⭐ 52, 🍴 11, 🐛 5) - I enhance the existing memory mcp server from the official mcp github, so big thanks and credits for creating this
javascriptmcpservernpm install T1nker-1220/memories-with-lessons-mcp-server - mcp-app-demo 📘 🏠 (⭐ 51, 🍴 5, 🐛 13) - Demo application showcasing how to build and secure MCP servers and clients with Pomerium using contextual access policies.
typescriptagentic-aimcpzerotrustservernpm install pomerium/mcp-app-demo - mcp-server-flomo 📜 🏠 (⭐ 51, 🍴 13, 🐛 5) - Write notes to Flomo
javascriptmcpmcp-flomomcp-servermcp-server-flomonpm install chatmcp/mcp-server-flomo - perplexity-mcp-zerver 📘 🏠 📇 (⭐ 51, 🍴 15) - MCP web search using perplexity without any API KEYS
typescriptmcpmcp-serverperplexitypuppeteernpm install wysh3/perplexity-mcp-server - dataforseo-mcp-server 📘 🏠 📇 (⭐ 50, 🍴 20, 🐛 5) - A comprehensive stdio MCP server for DataForSEO API
typescriptmcpserverapinpm install Skobyn/dataforseo-mcp-server - mcp-server 📘 🏠 (⭐ 50, 🍴 11) - Upstash Model Context Server
typescriptserverpythonmcpnpm install upstash/mcp-server-upstash - mcp-server-tmdb 📜 🏠 📇 (⭐ 50, 🍴 16, 🐛 3) - MCP Server with TMDB
javascriptmcpserverapidatabasenpm install Laksh-star/mcp-server-tmdb - minimax-mcp-tools 📘 🏠 📇 (⭐ 50, 🍴 12) - Async MCP server with Minimax API integration for image generation and text-to-speech
typescriptmcpserverapinpm install PsychArch/minimax-mcp-tools - google-calendar-mcp 📘 🏠 (⭐ 49, 🍴 6, 🐛 1) - Google Calendar MCP server for Claude Desktop integration
javascriptmcpgotypescriptservernpm install thisnick/google-calendar-mcp - McpDocServer 📜 🏠 (⭐ 49, 🍴 7, 🐛 1) - 一个基于MCP协议的开发文档服务器,专为各类开发框架文档设计
javascriptmcpnpm install ruan11223344/McpDocServer - octagon-deep-research-mcp 📜 🏠 (⭐ 49, 🍴 8, 🐛 1) - The Octagon Deep Research MCP server provides specialized AI-powered comprehensive research and analysis capabilities by integrating with advanced deep research agents. No rate limits, faster than ChatGPT Deep Research, more thorough than Grok DeepSearch or Perplexity Deep Research.
javascriptmcpserveraigonpm install OctagonAI/octagon-deep-research-mcp - quran-mcp-server 📘 🏠 📇 (⭐ 49, 🍴 11, 🐛 6) - Quran.com API integration for verse search, translation and tafsir
typescriptapiresthttpgitnpm install djalal/quran-mcp-server - replicate-flux-mcp 📘 🏠 📇 (⭐ 49, 🍴 11, 🐛 1) - MCP for Replicate Flux Model - A powerful tool for generating customized images and SVG assets that match specific coding vibes and aesthetic styles. Streamline your visual asset creation process with AI-powered design generation tailored for developers.
typescriptai-image-generationimage-mcpreplicate-mcpsvg-generatornpm install awkoy/replicate-flux-mcp - linux-do-mcp 📜 🏠 (⭐ 48, 🍴 4, 🐛 3) - A MCP Server For LINUX DO community
javascriptmcpmcp-servermodelpredictivecontrolservernpm install Pleasurecruise/linux-do-mcp - binance-mcp 📘 🏠 (⭐ 47, 🍴 18, 🐛 4) - binance-mcp (TypeScript-based)
typescriptmcpjavascriptservernpm install TermiX-official/binance-mcp - mailtrap-mcp 📘 🏠 📇 (⭐ 47, 🍴 10, 🐛 6) - Official mailtrap.io MCP server
typescriptmcpserveraiapinpm install railsware/mailtrap-mcp - mcp-wordpress 📜 🏠 📇 (⭐ 47, 🍴 5, 🐛 7) - MCP Server to manage a Wordpress CMS system.
typescriptmcpserverpythonapinpm install sharmashivanand/mcp-wordpress - AzureDevOps-MCP 📘 🏠 (⭐ 46, 🍴 20, 🐛 2) - TypeScript-based
typescriptnpm install RyanCardin15/azuredevops-mcp - gdrive-mcp-server 📜 🏠 (⭐ 46, 🍴 28, 🐛 7) - Efficient implementation of the Google Drive MCP server
javascriptmcpservergopythonnpm install felores/gdrive-mcp-server - simulator-mcp-server 📜 🏠 (⭐ 46, 🍴 9, 🐛 6) - Node.js-based
javascripthttpgitgithubnpm install JoshuaRileyDev/simulator-mcp-server - generator-mcp 📜 🏠 (⭐ 45, 🍴 9, 🐛 2) - Yeoman Generator to quickly create a new MCP Server
javascriptmcpservernpm install formulahendry/generator-mcp - MCP_Atom_of_Thoughts 📜 🏠 (⭐ 45, 🍴 10, 🐛 1) - Atom of Thoughts (AoT) MCP is a server that decomposes complex problems into independent atomic units of thought, using the dependencies between these units to deliver more robust reasoning and validated insights.
javascriptclaudemcpmcp-serverservernpm install kbsooo/MCP_Atom_of_Thoughts - mcp-server-drupal 📘 🏠 (⭐ 45, 🍴 6, 🐛 3) - TS based companion MCP server for the Drupal MCP module that works with the STDIO transport.
typescriptdenodrupalmcpmcp-servernpm install Omedia/mcp-server-drupal - Homeassistant-server-mcp 📜 🏠 (⭐ 44, 🍴 8, 🐛 2) - A Model Context Protocol (MCP) server for interacting with Home Assistant. This server provides tools to control and monitor your Home Assistant devices through MCP-enabled applications.
javascriptmcpservernpm install hekmon8/Homeassistant-server-mcp - mcp-canvas-lms 📘 🏠 (⭐ 44, 🍴 18, 🐛 3) - Version 2.2 - 54 tools available - an MCP server for interacting with the Canvas LMS API. This server allows you to manage courses, assignments, enrollments, and grades within Canvas.
typescriptcanvas-lmscanvas-lms-apicanvas-lms-gradesmcpnpm install DMontgomery40/mcp-canvas-lms - mcp-duckdb-memory-server 📘 🏠 (⭐ 44, 🍴 10, 🐛 7) - MCP Memory Server with DuckDB backend
typescriptduckdbmcpmcp-servermodel-context-protocolnpm install izumisy/mcp-duckdb-memory-server - mcp-hub-mcp 📘 🏠 (⭐ 44, 🍴 12, 🐛 2) - TypeScript-based
typescriptnpm install warpdev/mcp-hub-mcp - mcp-jina-reader 📘 🏠 ☁️ (⭐ 44, 🍴 10, 🐛 1) - Jina Reader MCP Server
typescriptmcpserverremotehttpnpm install wong2/mcp-jina-reader - obs-mcp 📘 🏠 (⭐ 44, 🍴 9, 🐛 1) - An MCP server for OBS
typescriptmcpservernpm install royshil/obs-mcp - mcp-google-search 📜 🏠 📇 (⭐ 43, 🍴 16, 🐛 1) - Node.js-based
javascriptapihttpgitgithubnpm install adenot/mcp-google-search - mcp-toolbox-sdk-js 📘 🏠 (⭐ 43, 🍴 8, 🐛 5) - Javascript SDK for interacting with the MCP Toolbox for Databases.
typescriptdatabasesgenailangchainlangchain-jsnpm install googleapis/mcp-toolbox-sdk-js - memory-bank-mcp 📘 🏠 (⭐ 43, 🍴 14, 🐛 1) - MCP Server para gerenciar o Memory Bank
typescriptmcpservernpm install movibe/memory-bank-mcp - otelcol-mcp 📘 🏠 (⭐ 43, 🍴 1) - The OTEL MCP Server (TypeScript-based)
typescriptmcpservernpm install mottibec/otelcol-mcp - codacy-mcp-server 📘 🏠 (⭐ 42, 🍴 14, 🐛 2) - Codacy's MCP Server implementation
typescriptmcpservernpm install codacy/codacy-mcp-server - frame0-mcp-server 📜 🏠 (⭐ 42, 🍴 6, 🐛 4) - Node.js-based
javascriptnpm install niklauslee/frame0-mcp-server - mcp-docs-service 📘 🏠 (⭐ 42, 🍴 8, 🐛 3) - MCP Documentation Management Service - A Model Context Protocol implementation for documentation management
typescriptmcpdocumentationnpm install alekspetrov/mcp-docs-service - mcp-memory 📜 🏠 (⭐ 42, 🍴 4, 🐛 2) - MCP Memory Server with PostgreSQL and pgvector for long-term memory capabilities
typescriptmcpserverjavascriptpostgresnpm install samwang0723/mcp-memory - mcp-server-tavily 🐍 🏠 📇 (⭐ 42, 🍴 11, 🐛 1) - Taivily APIを利用するMCP Serverです。Officialが提供される前に開発しました
apihttpaigitgithubpip install git+https://github.com/Tomatio13/mcp-server-tavily - salesforce-mcp-server 📘 🏠 📇 (⭐ 42, 🍴 13, 🐛 2) - Model Context Protocol server for Salesforce REST API integration
typescriptserverapirestmcpnpm install kablewy/salesforce-mcp-server - shell-command-mcp 📘 🏠 (⭐ 42, 🍴 2, 🐛 2) - MCP server for executing shell commands.
typescriptmcpservernpm install egoist/shell-command-mcp - veyrax-mcp 📘 🏠 📇 (⭐ 42, 🍴 20, 🐛 1) - TypeScript-based
typescriptapihttpgitgithubnpm install VeyraX/veyrax-mcp - flightradar24-mcp-server 📜 🏠 (⭐ 41, 🍴 7, 🐛 4) - Model Context Protocol server for Flight Tracking
javascriptserverhttpgitgithubnpm install sunsetcoder/flightradar24-mcp-server - mcp-atlassian-server 📘 🏠 (⭐ 41, 🍴 11, 🐛 1) - MCP server connecting AI assistants with Jira & Confluence for smart project management.
typescriptai-agentsatlassianatlassian-confluenceatlassian-jiranpm install phuc-nt/mcp-atlassian-server - mcp-openapi-schema 📜 🏠 📇 (⭐ 41, 🍴 10, 🐛 3) - OpenAPI Schema Model Context Protocol Server
javascriptserverapihttpllmnpm install hannesj/mcp-openapi-schema - scrapeless-mcp-server 📘 🏠 📇 (⭐ 41, 🍴 10, 🐛 3) - Scrapeless Mcp Server
apiwebhttpaigitnpm install scrapeless-ai/scrapeless-mcp-server - todoist-mcp-server 📘 🏠 📇 (⭐ 41, 🍴 14, 🐛 4) - Full implementation of Todoist Rest API & support Todoist Sync API for MCP server
typescriptmcpserverapirestnpm install stanislavlysenko0912/todoist-mcp-server - whois-mcp 📜 🏠 📇 (⭐ 41, 🍴 15, 🐛 2) - MCP Server for whois lookups.
javascriptclaudecursormcpmcp-servernpm install bharathvaj-ganesan/whois-mcp - ashra-mcp 📘 🏠 (⭐ 40, 🍴 8, 🐛 2) - A Model Context Protocol server for Ashra
typescriptserverwebhttpjsonnpm install getrupt/ashra-mcp - context-optimizer-mcp-server 📘 🏠 (⭐ 40, 🍴 2, 🐛 52) - A Model Context Protocol (MCP) server that provides context optimization tools for AI coding assistants including GitHub Copilot, Cursor AI, Claude Desktop, and other MCP-compatible assistants enabling them to extract targeted information rather than processing large terminal outputs and files wasting their context.
typescriptclaude-codecursor-idegithub-copilotmcp-servernpm install malaksedarous/context-optimizer-mcp-server - excel-mcp-server 📘 🏠 (⭐ 40, 🍴 7, 🐛 3) - Excel数据处理微服务 (TypeScript-based)
typescriptnpm install zhiwei5576/excel-mcp-server - feishu-mcp-server 📘 🏠 (⭐ 40, 🍴 9, 🐛 2) - MCP server provides feishu related operations
typescriptmcpservernpm install sdd330/feishu-mcp-server - matlab-mcp-server 📜 🏠 (⭐ 40, 🍴 14) - The MATLAB MCP server provides AI users with powerful scientific computing and data analysis capabilities. It allows users to execute MATLAB code directly in conversations, generate MATLAB scripts from natural language descriptions, and access MATLAB documentation.
javascriptmcpserveraidocumentationnpm install WilliamCloudQi/matlab-mcp-server - mcp-graphql-schema 📜 🏠 (⭐ 40, 🍴 7, 🐛 2) - GraphQL Schema Model Context Protocol Server
javascriptservergraphqlhttpllmnpm install hannesj/mcp-graphql-schema - ntfy-mcp 📜 🏠 (⭐ 40, 🍴 4, 🐛 2) - Node.js-based
javascripthttpgitgithubnpm install teddyzxcv/ntfy-mcp - Serper-search-mcp 📘 🏠 (⭐ 40, 🍴 15, 🐛 7) - Un-official Serper Google search server for Cline and other MCP clients
typescriptmcpservergonpm install NightTrek/Serper-search-mcp - dify-mcp-server 📜 🏠 (⭐ 40, 🍴 11, 🐛 1) - A Model Context Protocol server for Dify
javascriptservernpm install AI-FE/dify-mcp-server - algorand-mcp 📘 🏠 (⭐ 39, 🍴 10, 🐛 2) - Algorand Model Context Protocol (Server & Client)
typescriptalgorandmcpmcp-clientmcp-servernpm install GoPlausible/algorand-mcp - bear-mcp-server 📜 🏠 (⭐ 39, 🍴 5, 🐛 2) - MCP Server integration for Bear note app
javascriptmcpserveraihttpnpm install akseyh/bear-mcp-server - code-research-mcp-server 📜 🏠 (⭐ 39, 🍴 7) - Node.js-based
javascriptnpm install nahmanmate/code-research-mcp-server - locallama-mcp 📘 🏠 📇 (⭐ 39, 🍴 11, 🐛 1) - An MCP Server that works with Roo Code/Cline.Bot/Claude Desktop to optimize costs by intelligently routing coding tasks between local LLMs free APIs and paid APIs.
typescriptclinebotmcp-serverroocodevscodenpm install Heratiki/locallama-mcp - mcp-server 📜 🏠 (⭐ 39, 🍴 8, 🐛 1) - Inkdrop Model Context Protocol Server
javascriptserverpythonhuaweicloudmcpnpm install inkdropapp/mcp-server - ns-mcp-server 📘 🏠 📇 (⭐ 39, 🍴 10, 🐛 2) - A Model Context Protocol (MCP) server that provides access to NS (Dutch Railways) travel information through Claude AI. This server enables Claude to fetch real-time train travel information and disruptions using the official Dutch NS API.
typescriptmcpserverapiainpm install r-huijts/ns-mcp-server - pinecone-mcp 📘 🏠 (⭐ 39, 🍴 10, 🐛 3) - Connect your Pinecone projects to Cursor, Claude, and other AI assistants
typescriptaihttpgitgithubnpm install pinecone-io/pinecone-mcp - mcp-client-server-host-demo 📘 🏠 (⭐ 39, 🍴 3) - A quick pokemon demo to showcase MCP server, client, and host
typescriptmcpservernpm install danwritecode/mcp-client-server-host-demo - gotohuman-mcp-server 📜 🏠 (⭐ 38, 🍴 9, 🐛 1) - Node.js-based
javascriptwebfilehttpainpm install gotohuman/gotohuman-mcp-server - Image-Generation-MCP-Server 📜 🏠 (⭐ 38, 🍴 8, 🐛 4) - This MCP server provides image generation capabilities using the Replicate Flux model.
javascriptmcpserverhttpgitnpm install GongRzhe/Image-Generation-MCP-Server - mcp-communicator-telegram 📜 🏠 (⭐ 38, 🍴 15, 🐛 5) - An MCP server that enables communication with users through Telegram. This server provides a tool to ask questions to users and receive their responses via a Telegram bot.
javascriptmcpservernpm install qpd-v/mcp-communicator-telegram - mcp-figma 📘 🏠 📇 (⭐ 38, 🍴 8, 🐛 2) - Figma MCP Server with full API functionality
typescriptmcpservernodeapinpm install moonray/mcp-figma - react-mcp 📜 🏠 (⭐ 38, 🍴 6, 🐛 1) - react-mcp integrates with Claude Desktop, enabling the creation and modification of React apps based on user prompts
javascriptmcpreactnpm install Streen9/react-mcp - remote-mcp-functions-typescript 🏠 (⭐ 38, 🍴 17, 🐛 4) - This is a quickstart template to easily build and deploy a custom remote MCP server to the cloud using Azure functions. You can clone/restore/run on your local machine with debugging, and azd up to have it in the cloud in a couple minutes. The MCP server is secured by design.
bicepmcpserverrestazuregit clone https://github.com/Azure-Samples/remote-mcp-functions-typescript - tradingview-chart-mcp 🐍 🏠 (⭐ 38, 🍴 9, 🐛 2) - Python-based
httpmlgitgithubpythonpip install git+https://github.com/ertugrul59/tradingview-chart-mcp - typespec-mcp 📘 🏠 📇 (⭐ 38, 🍴 12, 🐛 9) - Create an MCP Server for your API using the TypeSpec MCP Server
typescriptmcpserverapinpm install bterlson/typespec-mcp - wolframalpha-llm-mcp 📘 🏠 📇 (⭐ 38, 🍴 12, 🐛 2) - An MCP Server for WolframAlpha's LLM API, able to return structured knowledge & solve math
typescriptmcpserverapillmnpm install Garoth/wolframalpha-llm-mcp - yingdao_mcp_server 📘 🏠 (⭐ 38, 🍴 7, 🐛 4) - 影刀RPA MCP Server (TypeScript-based)
httpaigitgithubtypescriptnpm install ying-dao/yingdao_mcp_server - clarity-mcp-server 📘 🏠 📇 (⭐ 37, 🍴 10, 🐛 6) - A Model Context Protocol server for Microsoft Clarity data export API
typescriptanalyticsmcpserverapinpm install microsoft/clarity-mcp-server - hdw-mcp-server 📜 🏠 📇 (⭐ 37, 🍴 10, 🐛 2) - A Model Context Protocol (MCP) server that provides comprehensive access to LinkedIn data and functionalities using the HorizonDataWave API, enabling not only data retrieval but also robust management of user accounts.
javascriptmcpserverapifilenpm install horizondatawave/hdw-mcp-server - mcp_ctl 📜 🏠 (⭐ 37, 🍴 6, 🐛 5) - A package manager to manage all your mcp servers across platforms
javascriptcligithubmcpmodel-context-protocolnpm install runablehq/mcp_ctl - mcp_rails_template 💎 🏠 📇 (⭐ 37, 🍴 6, 🐛 12) - A minimal Rails API template for creating MCP (Model Context Protocol) servers with robust tool execution capabilities and examples.
rubyagentsclaudemcp-serverrails-apigit clone https://github.com/seuros/mcp_rails_template - mcp-bridge-api 📘 🏠 📇 (⭐ 37, 🍴 4) - MCP Bridge is a lightweight, fast, and LLM-agnostic proxy for connecting to multiple Model Context Protocol (MCP) servers through a unified REST API. It enables secure tool execution across diverse environments like mobile, web, and edge devices. Designed for flexibility, scalability, and easy integration with any LLM backend.
typescriptmcpserverapiwebnpm install INQUIRELAB/mcp-bridge-api - mcp-servers-kagi 📘 🏠 📇 (⭐ 37, 🍴 9, 🐛 6) - A Model Context Protocol server implementation for Kagi's API
apihttpgitgithubtypescriptnpm install ac3xx/mcp-servers-kagi - mcp-starter-template 📜 🏠 (⭐ 37, 🍴 16, 🐛 6) - An opinionated starter template for making Model Context Protocol (MCP) servers
javascriptmcpservernpm install StevenStavrakis/mcp-starter-template - MCPApp 📜 🏠 (⭐ 37, 🍴 7) - This text introduces the Model Context Protocol (MCP) for AI interaction, exploring Google Apps Script (GAS) as a server option. It shows feasibility with a sample but notes the lack of a GAS SDK, aiming to encourage understanding and development.
javascriptgas-librarygoogle-apps-scriptgoogle-apps-script-librarymcpnpm install tanaikech/MCPApp - solana-dev-mcp 📘 🏠 (⭐ 37, 🍴 20, 🐛 6) - Solana Model Context Protocol (MCP) Demo
typescriptmcpmcp-serversolananpm install solana-foundation/solana-dev-mcp - ticktick-mcp-server 📘 🏠 (⭐ 37, 🍴 12, 🐛 4) - A Model Context Protocol (MCP) server designed to integrate with the TickTick task management platform, enabling intelligent context-aware task operations and automation.
typescriptartificial-intelligencemcpnodeservernpm install alexarevalo9/ticktick-mcp-server - cli-microsoft365-mcp-server 📘 🏠 (⭐ 36, 🍴 9, 🐛 14) - Manage Microsoft 365 using MCP server
typescripthacktoberfestmcpmicrosoft365servernpm install pnp/cli-microsoft365-mcp-server - honeycomb-mcp 📘 🏠 (⭐ 36, 🍴 7, 🐛 17) - Allows Honeycomb Enterprise customers to use AI to query and analyze their data, alerts, dashboards, and more; and cross-reference production behavior with the codebase.
typescriptaihttpgitgithubnpm install honeycombio/honeycomb-mcp - mcp-npx-fetch 📘 🏠 (⭐ 36, 🍴 9, 🐛 3) - A powerful MCP server for fetching and transforming web content into various formats (HTML, JSON, Markdown, Plain Text) with ease.
typescriptmcpserverwebainpm install tokenizin-agency/mcp-npx-fetch - mcp-shell 📜 🏠 (⭐ 36, 🍴 6, 🐛 5) - Execute a secure shell in Claude Desktop using the Model Context Protocol.
javascriptclaudefunction-callingshellgonpm install hdresearch/mcp-shell - esa-mcp-server 📘 🏠 📇 (⭐ 35, 🍴 5, 🐛 4) - esa の Model Context Protocol サーバー実装
typescriptjavascriptmcpserverapinpm install d-kimuson/esa-mcp-server - hn-server 📜 🏠 (⭐ 35, 🍴 8, 🐛 2) - Hacker news MCP server
javascriptmcpserverhttpmlnpm install pskill9/hn-server - Letta-MCP-server 📜 🏠 (⭐ 35, 🍴 11, 🐛 43) - MCP server to manage letta server and comunicate with agents
javascriptmcpservernpm install oculairmedia/Letta-MCP-server - mcp-recraft-server 📘 🏠 📇 (⭐ 35, 🍴 4, 🐛 1) - MCP (modelcontextprotocol) server implementation for Recraft API
typescriptmcpserverapihttpnpm install recraft-ai/mcp-recraft-server - meme-mcp 📜 🏠 📇 (⭐ 35, 🍴 8, 🐛 2) - A simple Model Context Protocol (MCP) server for generating memes using the ImgFlip API
javascriptmcpserverapinpm install haltakov/meme-mcp - puremd-mcp 📜 🏠 (⭐ 35, 🍴 3) - Unblock, scrape, and search tools for MCP clients
javascriptcdnmarkdownmarkdown-convertermcpnpm install puremd/puremd-mcp - mcp-langchain-ts-client 📘 🏠 (⭐ 35, 🍴 2, 🐛 1) - LangChain.js client for Model Context Protocol.
typescriptainpm install isaacwasserman/mcp-langchain-ts-client - mcp-summarization-functions 📘 🏠 (⭐ 35, 🍴 11, 🐛 3) - Provides summarised output from various actions that could otherwise eat up tokens and cause crashes for AI agents
typescriptclinemcpmcp-servermodel-context-protocolnpm install Braffolk/mcp-summarization-functions - mcp-auth-servers 📘 🏠 (⭐ 34, 🍴 5, 🐛 1) - 🔒 Reference MCP servers that demo how authentication works with the current Model Context Protocol spec.
typescriptmcpserverauthnpm install Azure-Samples/mcp-auth-servers - mcp-dnstwist 📜 🏠 (⭐ 34, 🍴 6, 🐛 6) - MCP server for dnstwist, a powerful DNS fuzzing tool that helps detect typosquatting, phishing, and corporate espionage.
javascriptmcpserverhttpgitnpm install BurtTheCoder/mcp-dnstwist - mcp-mermaid-validator 📜 🏠 (⭐ 34, 🍴 4) - A Model Context Protocol server that validates and renders Mermaid diagrams.
javascriptmcpmermaidmodel-context-protocolservernpm install rtuin/mcp-mermaid-validator - aws-athena-mcp 📜 🏠 (⭐ 33, 🍴 12, 🐛 1) - MCP server to run AWS Athena queries
javascriptmcpserverawshttpnpm install lishenxydlgzs/aws-athena-mcp - azure-devops-mcp-server 📘 🏠 (⭐ 33, 🍴 15, 🐛 4) - MCP Server for Cline to Access Azure devops
typescriptmcpserverazurehttpnpm install stefanskiasan/azure-devops-mcp-server - claude-mcp-think-tool 📜 🏠 (⭐ 33, 🍴 4) - MCP Think Tool Claude Desktop
javascriptmcpnpm install cgize/claude-mcp-think-tool - clickup-mcp-server 📘 🏠 (⭐ 33, 🍴 8) - TypeScript-based
typescriptmcpserverainpm install Leanware-io/clickup-mcp-server - mailgun-mcp-server 📜 🏠 📇 (⭐ 33, 🍴 14, 🐛 4) - Implementation of Model Context Protocol server for Mailgun APIs
javascriptserverapiaihttpnpm install mailgun/mailgun-mcp-server - mcp-redis-cloud 📘 🏠 (⭐ 33, 🍴 14, 🐛 1) - TypeScript-based
typescriptdatabasehttpredisgitnpm install redis/mcp-redis-cloud - opgg-mcp 📘 🏠 (⭐ 33, 🍴 9, 🐛 3) - TypeScript-based
typescripthttpgitgithubanalyticsnpm install opgginc/opgg-mcp - powertools-mcp 📘 🏠 (⭐ 33, 🍴 9, 🐛 13) - Powertools for AWS's official MCP Server
typescriptmcpserverawshttpnpm install aws-powertools/powertools-mcp - 1Panel-mcp 📜 🏠 (⭐ 33, 🍴 5, 🐛 3) - A MCP server for automated website deployment to 1Panel (Experimental)
javascriptmcpserverwebnpm install ruibaby/1panel-mcp - mcp-google-calendar 📜 🏠 (⭐ 33, 🍴 7) - A Model Context Protocol (MCP) server implementation for Google Calendar integration. Create and manage calendar events directly through Claude or other AI assistants.
javascriptmcpserveraigonpm install markelaugust74/mcp-google-calendar - mcp-rtfm 📜 🏠 (⭐ 33, 🍴 7, 🐛 3) - Ever been told to RTFM only to find there is no FM to R? MCP-RTFM helps you CREATE the F*ing Manual that people keep telling everyone to read! Transform your non-existent or unreadable docs into an intelligent, searchable knowledge base that actually answers those 'basic questions' before they're asked.
javascriptmcpnpm install ryanjoachim/mcp-rtfm - mcp-google-custom-search-server 📘 🏠 📇 (⭐ 32, 🍴 16, 🐛 3) - An mcp server for searching against google custom search api
typescriptmcpserverapiainpm install alexatnordnet/mcp-google-custom-search-server - mcp-ripgrep 📜 🏠 (⭐ 32, 🍴 8, 🐛 5) - An MCP server to wrap ripgrep
javascriptmcpservernpm install mcollina/mcp-ripgrep - mcp-todoist 📘 🏠 (⭐ 32, 🍴 5, 🐛 5) - MCP server that connects Claude to Todoist for natural language task and project management with bulk operations
typescriptmcpservernpm install greirson/mcp-todoist - instagram-engagement-mcp 📜 🏠 (⭐ 31, 🍴 6, 🐛 2) - 📢 Instagram MCP Server – A powerful Model Context Protocol (MCP) server for tracking Instagram engagement, generating leads, and analyzing audience feedback.
javascriptmcpservernpm install Bob-lance/instagram-engagement-mcp - mcp-browser-kit 📘 🏠 (⭐ 31, 🍴 5, 🐛 2) - An MCP Server that enables AI assistants to interact with your local browsers.
typescriptmcpserverailocalnpm install ndthanhdev/mcp-browser-kit - MCP-Microsoft-Office 📜 🏠 (⭐ 31, 🍴 6, 🐛 3) - an local MCP server you can run on your env, connecting you to Microsoft Graph, and the complete M365 eco system.
javascriptcalendarm365mcpmcp-servernpm install Aanerud/MCP-Microsoft-Office - mcp-server-ios-simulator 📘 🏠 (⭐ 31, 🍴 5, 🐛 1) - Model Context Protocol (MCP) implementation for iOS simulators
typescriptmcpnpm install atom2ueki/mcp-server-ios-simulator - okta-mcp-server 🐍 🏠 📇 (⭐ 31, 🍴 4) - The Okta MCP Server is a groundbreaking tool built by the team at Fctr that enables AI models to interact directly with your Okta environment using the Model Context Protocol (MCP). Built specifically for IAM engineers, security teams, and Okta administrators, it implements the MCP specification to help work with Okta enitities
typescriptmcpserverpythonagentic-ainpm install kapilduraphe/okta-mcp-server - wweb-mcp 📘 🏠 (⭐ 31, 🍴 9) - WhatsApp Web MCP Server
typescriptmcpwhatsappserverwebnpm install pnizer/wweb-mcp - linkedin-mcp-server 📘 🏠 📇 (⭐ 31, 🍴 3) - An MCP Server for Linkedin API
typescriptmcpserverapiclaude-ainpm install fredericbarthelet/linkedin-mcp-server - bruno-mcp 📜 🏠 📇 (⭐ 30, 🍴 7) - MCP Server for running Bruno Collections
javascriptmcpserverapihttpnpm install hungthai1401/bruno-mcp - figma-mcp-server 📘 🏠 (⭐ 30, 🍴 16, 🐛 3) - Claude MCP Server to work with figma
typescriptmcpservernpm install karthiks3000/figma-mcp-server - nmap-mcp-server 📜 🏠 (⭐ 30, 🍴 7, 🐛 2) - A Model Context Protocol (MCP) server that enables AI assistants to perform network scanning operations using NMAP
javascriptmcpserverainpm install PhialsBasement/nmap-mcp-server - server-hyperliquid 📘 🏠 (⭐ 30, 🍴 12, 🐛 4) - MCP Hyperliquid (https://app.hyperliquid.xyz) server
typescriptmcpserverhttpgitnpm install mektigboy/server-hyperliquid - spline-mcp-server 📜 🏠 📇 (⭐ 30, 🍴 7, 🐛 2) - An MCP server for working with Spline 3D design tool API
javascriptmcpserverapinpm install aydinfer/spline-mcp-server - todo-list-mcp 📘 🏠 (⭐ 30, 🍴 7) - An MCP server for managing todos within LLMs, created for educational purposes
typescriptmcpserverllmnpm install RegiByte/todo-list-mcp - mcp-tung-shing 📘 🏠 (⭐ 30, 🍴 10, 🐛 4) - 中国传统黄历 MCP 服务 | Chinese Traditional Almanac MCP Service
typescriptlunar-calendarmcpmcp-servernpm install baranwang/mcp-tung-shing - unplugin-mcp 📘 🏠 (⭐ 30, 🍴 1, 🐛 1) - A unified plugin for developers integrating MCP servers into modern JavaScript build tools, including Webpack, Rollup, Vite, and more.
typescriptmcpmcp-servermodelcontextprotocolrollupnpm install situ2001/unplugin-mcp - workers-mcp-demo 📘 🏠 (⭐ 30, 🍴 6, 🐛 1) - cloudflare workers MCP server
typescriptmcpservernpm install akazwz/workers-mcp-demo - a11ymcp 📜 🏠 📇 (⭐ 29, 🍴 5) - Verified MCP Server for Web Accessibility Testing (2000+ Downloads)
apiwebhttpllmgitnpm install ronantakizawa/a11ymcp - actual-mcp 📘 🏠 📇 (⭐ 29, 🍴 14, 🐛 2) - Model Context Protocol for Actual Budget API
typescriptapinpm install s-stefanov/actual-mcp - astra-db-mcp 📘 🏠 (⭐ 29, 🍴 19, 🐛 4) - An MCP server for Astra DB workloads
typescriptmcpserverdatabasehttpnpm install datastax/astra-db-mcp - BestReads-MCP-Server 📘 🏠 (⭐ 29, 🍴 2) - Remote MCP Server built using Cloudflare Workers.
typescriptmcpservernpm install dinasaur404/BestReads-MCP-Server - bsky-mcp-server 📘 🏠 (⭐ 29, 🍴 10, 🐛 6) - Bluesky MCP (Model Context Protocol) Server
typescriptmcpservernpm install brianellin/bsky-mcp-server - demo-mcp-server-client-implementation 📘 🏠 📇 (⭐ 29, 🍴 8, 🐛 1) - A demo implementation of a MCP server (consuming a dummy API) and basic client.
typescriptmcpserverapinpm install mschwarzmueller/demo-mcp-server-client-implementation - firefly-iii-mcp 📘 🏠 (⭐ 29, 🍴 4, 🐛 2) - MCP Server for Firefly III
typescriptmcpservernpm install etnperlong/firefly-iii-mcp - kuzu-mcp-server 📜 🏠 (⭐ 29, 🍴 11) - A Model Context Protocol server that provides access to Kuzu databases
javascriptserverdatabasehttpllmnpm install kuzudb/kuzu-mcp-server - mcpFirebird 📘 🏠 (⭐ 29, 🍴 9, 🐛 1) - Implementation of Anthropic's MCP protocol for Firebird databases.
typescriptmcpdatabasenpm install PuroDelphi/mcpFirebird - nostr-mcp-server 📘 🏠 (⭐ 29, 🍴 12, 🐛 5) - A Model Context Protocol (MCP) server that provides Nostr capabilities to LLMs like Claude.
typescriptmcpnostrserverllmnpm install AustinKelsay/nostr-mcp-server - REDIS-MCP-Server 📜 🏠 (⭐ 29, 🍴 8, 🐛 3) - A Redis MCP server (pushed to https://github.com/modelcontextprotocol/servers/tree/main/src/redis) implementation for interacting with Redis databases. This server enables LLMs to interact with Redis key-value stores through a set of standardized tools.
javascriptmcpserverdatabaseainpm install GongRzhe/REDIS-MCP-Server - excalidraw-mcp 📜 🏠 (⭐ 28, 🍴 15, 🐛 3) - Model Context Protocol (MCP) server for Excalidraw - Work in Progress
javascriptmcpservernpm install i-tozer/excalidraw-mcp - feuse-mcp 📘 🏠 📇 (⭐ 28, 🍴 5, 🐛 4) - Frontend Useful MCP Tools - Essential utilities for web developers to automate API integration and code generation
typescriptd2cfastmcpfigma-to-codemcpnpm install Panzer-Jack/feuse-mcp - mcp-xmind 📜 🏠 (⭐ 28, 🍴 6, 🐛 5) - Node.js-based
javascriptfilehttpaigitnpm install apeyroux/mcp-xmind - shodan-mcp-server 📜 🏠 📇 (⭐ 28, 🍴 5) - A Model Context Protocol server that provides access to Shodan API functionality
javascriptcyreslabmcpmcp-serversecurity-toolsnpm install Cyreslab-AI/shodan-mcp-server - stackoverflow-mcp 📘 🏠 (⭐ 28, 🍴 4, 🐛 3) - A Model Context Protocol server for querying Stack Overflow to help AI models find programming solutions
typescriptserverainpm install gscalzo/stackoverflow-mcp - trpc-mcp 📘 🏠 (⭐ 28, 🍴 6, 🐛 2) - Serve tRPC routes as an MCP server
typescriptmcpservernpm install Jacse/trpc-mcp - uniswap-trader-mcp 📜 🏠 (⭐ 28, 🍴 10, 🐛 2) - An MCP server for AI agents to automate token swaps on Uniswap DEX across multiple blockchains.
javascriptmcpserveraihttpnpm install kukapay/uniswap-trader-mcp - mcp-edit-file-lines 📘 🏠 (⭐ 28, 🍴 4, 🐛 5) - MCP Server to make line-based edits to a file.
typescriptmcpservernpm install oakenai/mcp-edit-file-lines - activitywatch-mcp-server 📘 🏠 (⭐ 27, 🍴 10, 🐛 1) - Model Context Protocol server for ActivityWatch time tracking data
typescriptactivitywatchmcpmcp-serverservernpm install 8bitgentleman/activitywatch-mcp-server - frontend-review-mcp 📜 🏠 (⭐ 27, 🍴 10, 🐛 2) - MCP server that visually reviews your agent's design edits
javascriptcursorfrontendmcpscreenshotnpm install zueai/frontend-review-mcp - mcp-server-nationalparks 📘 🏠 📇 (⭐ 27, 🍴 9, 🐛 5) - TypeScript-based
typescripthttpaigitgithubnpm install KyrieTangSheng/mcp-server-nationalparks - mcp-server-text-editor 📘 🏠 (⭐ 27, 🍴 6, 🐛 7) - An open source implementation of the Claude built-in text editor tool
typescriptai-toolsclaudemcpmodel-context-protocolnpm install bhouston/mcp-server-text-editor - Memgpt-MCP-Server 📜 🏠 (⭐ 27, 🍴 5, 🐛 2) - A Model Context Protocol (MCP) server that provides persistent memory and multi-model LLM support.
javascriptmcpserverllmnpm install Vic563/Memgpt-MCP-Server - sketchfab-mcp-server 📜 🏠 (⭐ 27, 🍴 7, 🐛 3) - This is an MCP (Model Context Protocol) Server for discovering and downloading 3D models
javascriptmcpservernpm install gregkop/sketchfab-mcp-server - apisix-mcp 📘 🏠 📇 (⭐ 26, 🍴 10, 🐛 2) - APISIX Model Context Protocol (MCP) server is used to bridge large language models (LLMs) with the APISIX Admin API.
typescriptapi-managementapisixmcpmcp-servernpm install api7/apisix-mcp - appium-mcp 📘 🏠 (⭐ 26, 🍴 1, 🐛 1) - AI-powered mobile automation with Model Context Protocol (MCP) integration. Seamlessly control Android & iOS devices through Appium with intelligent visual element detection and recovery. Built for AI agents like Claude to perform complex mobile testing workflows.
typescriptmcpaimltestingnpm install Rsec08/appium-mcp - excel-reader-mcp 📜 🏠 (⭐ 26, 🍴 6) - A Model Context Protocol (MCP) server for reading Excel files with automatic chunking and pagination support. Built with SheetJS and TypeScript.
javascriptmcpservernpm install ArchimedesCrypto/excel-reader-mcp - gemini-context-mcp-server 📘 🏠 (⭐ 26, 🍴 7, 🐛 3) - MCP server for Cursor that leverages Gemini's much larger context window to enhance the capabilities of the AI tools
typescriptmcpserverainpm install ogoldberg/gemini-context-mcp-server - influxdb-mcp-server 📜 🏠 📇 (⭐ 26, 🍴 9, 🐛 8) - An MCP Server for querying InfluxDB
javascriptmcpserverapihttpnpm install idoru/influxdb-mcp-server - mcp-code-review-server 📜 🏠 (⭐ 26, 🍴 21, 🐛 3) - A MCP server for code reviews
javascriptmcpservernpm install crazyrabbitLTC/mcp-code-review-server - mcp-image-compression 📘 🏠 (⭐ 26, 🍴 6, 🐛 2) - A high-performance image compression microservice based on MCP (Modal Context Protocol)
typescriptmcplocalhttpgitnpm install InhiblabCore/mcp-image-compression - mcp-server-dumplingai 📜 🏠 📇 (⭐ 26, 🍴 4, 🐛 7) - MCP (Model Context Protocol) server for Dumpling AI
apiwebhttpaigitnpm install Dumpling-AI/mcp-server-dumplingai - mcp-server-kibana 📘 🏠 (⭐ 26, 🍴 10) - MCP server for Kibana, Access search and manage Kibana in MCP Client.
typescriptmcpservernpm install TocharianOU/mcp-server-kibana - mcp-server-taskwarrior 📜 🏠 (⭐ 26, 🍴 6, 🐛 3) - MCP Server for TaskWarrior!
javascriptmcpserverlocalhttpnpm install awwaiid/mcp-server-taskwarrior - mcp-sitecore-server 📘 🏠 (⭐ 26, 🍴 10, 🐛 3) - Model Context Protocol server for Sitecore
typescriptservernpm install antonytm/mcp-sitecore-server - mcp-ssh 📜 🏠 (⭐ 26, 🍴 4) - A Model Context Protocol (MCP) server for managing and controlling SSH connections.
javascriptlinuxmcpsshservernpm install AiondaDotCom/mcp-ssh - nchan-mcp-transport 📘 🏠 (⭐ 26, 🍴 4, 🐛 4) - The best way to deploy mcp server. A high-performance WebSocket/SSE transport layer & gateway for Anthropic's MCP (Model Context Protocol) — powered by Nginx, Nchan, and FastAPI.
typescriptactionsclaude-plugin-backendfastapi-websocket-mcpgptsnpm install ConechoAI/nchan-mcp-transport - pushover-mcp 📘 🏠 (⭐ 26, 🍴 6, 🐛 5) - A MCP implementation for sending notifications via Pushover
typescriptmcpmcp-serverpush-notificationspushovernpm install ashiknesin/pushover-mcp - vsc-mcp 📘 🏠 (⭐ 26, 🍴 2, 🐛 2) - This project provides tools that expose Language Server Protocol (LSP) functionality as MCP (Model Context Protocol) tools
typescriptclaude-ailspmcpmcp-servernpm install thomasgazzoni/vsc-mcp - bing-cn-mcp-server 📜 🏠 📇 (⭐ 25, 🍴 7, 🐛 3) - Node.js-based
apiwebhttpaimlnpm install yan5236/bing-cn-mcp-server - chrome-extension-bridge-mcp 📜 🏠 (⭐ 25, 🍴 4) - A chrome extension bridge that allows you to connect to a mcp server to use global window object.
javascriptchrome-extensionmcpmcp-servervibe-codingnpm install Oanakiaja/chrome-extension-bridge-mcp - coin-mcp-server 📘 🏠 📇 (⭐ 25, 🍴 11, 🐛 2) - use Bitget’s API to get cryptocurrency info
typescriptcryptocurrencymcp-serverapihttpnpm install pwh-pwh/coin-mcp-server - jina-mcp-tools 📜 🏠 📇 (⭐ 25, 🍴 5, 🐛 1) - A Model Context Protocol (MCP) server that integrates with Jina AI Search Foundation APIs.
javascriptmcpserverapiainpm install PsychArch/jina-mcp-tools - mcp-bundler 📘 🏠 (⭐ 25, 🍴 5, 🐛 1) - A microservice for bundling MCP servers from GitHub repositories and preparing it for deployment.
typescriptbundlebundlermcpmcp-clientnpm install wrtnlabs/mcp-bundler - mcp-etherscan-server 📘 🏠 📇 (⭐ 25, 🍴 22, 🐛 4) - An MCP (Model Context Protocol) server that provides Ethereum blockchain data tools via Etherscan's API. Features include checking ETH balances, viewing transaction history, tracking ERC20 transfers, fetching contract ABIs, monitoring gas prices, and resolving ENS names.
typescriptmcpserverapiainpm install crazyrabbitLTC/mcp-etherscan-server - mcp-server-leetcode 📘 🏠 (⭐ 25, 🍴 8, 🐛 3) - A Model Context Protocol (MCP) server for LeetCode that provides access to problems, user data, and contest information through GraphQL
typescriptmcpservergraphqlhttpnpm install doggybee/mcp-server-leetcode - google-workspace-mcp-server 📜 🏠 (⭐ 25, 🍴 17, 🐛 6) - A Model Context Protocol server for Google Workspace integration (Gmail and Calendar)
javascriptserveraigonpm install epaproditus/google-workspace-mcp-server - MistTrackMCP 📘 🏠 📇 (⭐ 25, 🍴 3) - The MistTrack MCP server allows Claude AI to directly access blockchain data provided by the MistTrack API, offering address analysis, risk assessment, transaction tracking, and fund flow visualization capabilities, with support for multi-layer recursive transaction analysis.
typescriptmcpserverapiainpm install slowmist/MistTrackMCP - mcp-gemini-tutorial 📘 🏠 (⭐ 25, 🍴 2) - Building MCP Servers with Google Gemini
typescriptmcpservergonpm install GuiBibeau/mcp-gemini-tutorial - starwind-ui-mcp 📘 🏠 (⭐ 25, 🍴 16) - Local MCP server implementation for Starwind UI that you can use with Cursor, Windsurf, and other AI tools
typescriptmcpserverainpm install Boston343/starwind-ui-mcp - electron-mcp-server 📘 🏠 📇 (⭐ 24, 🍴 8, 🐛 2) - 🚀 A powerful MCP server for debugging Electron applications with deep Chrome DevTools Protocol integration. Control, monitor, and debug Electron apps through a standardized API.
typescriptmcpserverapinpm install amafjarkasi/electron-mcp-server - gyazo-mcp-server 📘 🏠 (⭐ 24, 🍴 8, 🐛 6) - Official Model Context Protocol server for Gyazo
typescriptservernpm install yuiseki/gyazo-mcp-server - image-gen-mcp 📜 🏠 📇 (⭐ 24, 🍴 5, 🐛 2) - A MCP server that provides text-to-image generation capabilities using Stable Diffusion WebUI API (ForgeUI/AUTOMATIC-1111)
javascriptmcpserverapiwebnpm install Ichigo3766/image-gen-mcp - maven-mcp-server 📜 🏠 (⭐ 24, 🍴 6, 🐛 1) - An MCP (Model Context Protocol) server that provides tools for checking Maven dependency versions.
javascriptmcpserverhttpgitnpm install Bigsy/maven-mcp-server - mcp-database-server 📜 🏠 (⭐ 24, 🍴 10, 🐛 4) - Store and load JSON documents from LLM tool use
javascriptllmjsondatabasehttpnpm install fireproof-storage/mcp-database-server - mcp-gsheets 📘 🏠 📇 (⭐ 24, 🍴 7, 🐛 1) - MCP server for Google Sheets - Read, write and manipulate spreadsheets through Claude Desktop
typescriptautomationgoogle-sheets-apimcpnodejsnpm install freema/mcp-gsheets - mcp-server-esa 📘 🏠 (⭐ 24, 🍴 4, 🐛 2) - TypeScript-based
typescriptnpm install aliyun/mcp-server-esa - mcp-stytch-consumer-todo-list 📘 🏠 (⭐ 24, 🍴 10, 🐛 2) - Workers + Stytch TODO App MCP Server
typescriptcloudflarecloudflare-workercloudflare-workersmcpnpm install stytchauth/mcp-stytch-consumer-todo-list - orchestrator-server 📜 🏠 (⭐ 24, 🍴 5, 🐛 3) - small MCP server for orchestrating tasks across LLM instances
javascriptmcpserverllmnpm install mokafari/orchestrator-server - jira-mcp-server 📜 🏠 📇 (⭐ 24, 🍴 6, 🐛 2) - A test of jira mcp server
javascriptmcpserverapihttpnpm install KS-GEN-AI/jira-mcp-server - aisdk-mcp-bridge 📘 🏠 (⭐ 23, 🍴 2) - Bridge package enabling seamless integration between Model Context Protocol (MCP) servers and AI SDK tools. Supports multiple server types, real-time communication, and TypeScript.
typescriptaisdkfunctioncallingmcpmcp-servernpm install vrknetha/aisdk-mcp-bridge - caldav-mcp 📘 🏠 (⭐ 23, 🍴 6, 🐛 3) - A CalDAV client using Model Context Protocol (MCP) to expose calendar operations as tools for AI assistants.
typescriptcaldavmcpmcp-serverainpm install dominik1001/caldav-mcp - framer-plugin-mcp 📜 🏠 (⭐ 23, 🍴 4, 🐛 4) - A Model Context Protocol (MCP) server for creating and managing Framer plugins with web3 capabilities
javascriptmcpserverwebnpm install Sheshiyer/framer-plugin-mcp - geminiserchMCP 📜 🏠 (⭐ 23, 🍴 3, 🐛 1) - Node.js-based
javascriptnpm install Lorhlona/geminiserchMCP - map-traveler-mcp 📘 🏠 📇 (⭐ 23, 🍴 9) - Virtual traveler library for MCP
typescriptmcpapihttpainpm install mfukushim/map-traveler-mcp - markdown-rules-mcp 📘 🏠 (⭐ 23, 🍴 2, 🐛 1) - TypeScript-based
typescriptnpm install valstro/markdown-rules-mcp - mcp-server 📘 🏠 (⭐ 23, 🐛 3) - PortOne MCP Server for Developers
typescriptmcpservernpm install portone-io/mcp-server - midi-mcp-server 📜 🏠 (⭐ 23, 🍴 5, 🐛 2) - MIDI MCP Server is a Model Context Protocol (MCP) server that enables AI models to generate MIDI files from text-based music data. This tool allows for programmatic creation of musical compositions through a standardized interface.
javascriptmcpserverainpm install tubone24/midi-mcp-server - opencti-mcp 📘 🏠 (⭐ 23, 🍴 12) - TypeScript-based
typescripthttpgitgithubnpm install Spathodea-Network/opencti-mcp - postmark-mcp 📜 🏠 (⭐ 23, 🍴 8, 🐛 1) - Experimental MCP server for Postmark, built by Postmark Labs. Designed for tinkering, testing, and teleporting transactional email into inboxes with speed and style.
javascriptmcpserveraitestingnpm install ActiveCampaign/postmark-mcp - Yuque-MCP-Server 📘 🏠 📇 (⭐ 23, 🍴 11, 🐛 4) - Yuque mcp server (TypeScript-based)
typescriptmcpyuqueyuque-mcpservernpm install HenryHaoson/Yuque-MCP-Server - mcp-cline-personas 📘 🏠 (⭐ 23, 🍴 4, 🐛 1) - An MCP server for managing
.clinerulesfiles using shared components and persona templates.typescriptmcpservernpm install bradfair/mcp-cline-personas - agentic-tools-mcp-companion 📘 🏠 (⭐ 22, 🍴 4, 🐛 3) - TypeScript-based
typescriptnpm install Pimzino/agentic-tools-mcp-companion - DeepResearchMCP 📘 🏠 (⭐ 22, 🍴 7, 🐛 3) - Deep Research MCP is an intelligent research assistant built on the Model Context Protocol (MCP) that performs comprehensive, multi-step research on any topic.
typescriptmcpnpm install ameeralns/DeepResearchMCP - langchain-mcp-tools-ts 📘 🏠 (⭐ 22, 🍴 7) - MCP to LangChain Tools Conversion Utility / TypeScript
typescriptlangchainlangchain-typescriptmcpmcp-clientnpm install hideya/langchain-mcp-tools-ts - mcp-file-merger 📜 🏠 (⭐ 22, 🍴 11, 🐛 1) - MCP server for merging multiple files into one
javascriptmcpserverfilehttpnpm install exoticknight/mcp-file-merger - mcp-media-processor 📜 🏠 (⭐ 22, 🍴 4, 🐛 3) - A Node.js server implementing Model Context Protocol (MCP) for media processing operations, providing powerful video and image manipulation capabilities.
javascriptmcpservernodenpm install maoxiaoke/mcp-media-processor - mcp-ollama-agent 📘 🏠 (⭐ 22, 🍴 7) - A TypeScript example showcasing the integration of Ollama with the Model Context Protocol (MCP) servers. This project provides an interactive command-line interface for an AI agent that can utilize the tools from multiple MCP Servers..
typescriptagentmcp-agentmcp-clientmcp-servernpm install ausboss/mcp-ollama-agent - MCP-server-Qwen_Max 📜 🏠 (⭐ 22, 🍴 6) - MCP server for Qwen Max model
javascriptmcpserverhttpgitnpm install 66julienmartin/MCP-server-Qwen_Max - near-mcp 📘 🏠 (⭐ 22, 🍴 11, 🐛 2) - An MCP server for the NEAR blockchain
typescriptmcpserverainpm install nearai/near-mcp - nuclei-mcp 🐹 🏠 (⭐ 22, 🍴 4, 🐛 1) - An implementation of a Model Context Protocol (MCP) for the Nuclei scanner. This tool enables context-aware vulnerability scanning by intelligently providing models and context to the scanning engine, allowing for more efficient and targeted template execution
javascriptgoaiintelligent-scanningnucleinpm install spritualkb/nuclei-mcp - php-mcp-server 🐘 🏠 (⭐ 22, 🍴 3) - 基于 PHP 实现的 MCP (Model Control Protocol) 服务器框架,通过注解优雅地定义 MCP 服务,支持 Tool、Prompt、Resource 三种处理器,支持Stdio、Sse 两种 transport。
phpmcpgit clone https://github.com/he426100/php-mcp-server - dexpaprika-mcp 📜 🏠 📇 (⭐ 21, 🍴 6, 🐛 3) - DexPaprika MCP server allows access real-time and historical data on crypto tokens, DEX trading activity, and liquidity across multiple blockchains. It enables natural language queries for exploring market trends, token performance, and DeFi analytics through a standardized interface.
javascriptclaude-integrationcrypto-analysis-toolcrypto-apicryptocurrencynpm install coinpaprika/dexpaprika-mcp - github-enterprise-mcp 📘 🏠 📇 (⭐ 21, 🍴 6) - github-enterprise-mcp
typescriptmcphttpgitgithubnpm install ddukbg/github-enterprise-mcp - jupiter-mcp 📜 🏠 📇 (⭐ 21, 🍴 9, 🐛 4) - An MCP server for executing token swaps on the Solana blockchain using Jupiter's new Ultra API.
javascriptmcpserverapiainpm install kukapay/jupiter-mcp - mcp-frontend-testing 📘 🏠 (⭐ 21, 🍴 7, 🐛 1) - Frontend testing tools for Model Context Protocol
typescripttestingnpm install StudentOfJS/mcp-frontend-testing - mcp-limitless 📘 🏠 📇 (⭐ 21, 🍴 5, 🐛 3) - Advanced MCP Server with AI-powered Limitless API features: natural time queries, meeting detection, action item extraction, daily summaries, and speaker analytics
typescriptai-toolsclaude-mcpmcpmcp-servernpm install 199-biotechnologies/mcp-limitless-enhanced - mcp-screenshot 📜 🏠 (⭐ 21, 🍴 6, 🐛 2) - Repository for MCP screenshot functionality
javascriptmcpnpm install kazuph/mcp-screenshot - mcp-server-ticketmaster 📘 🏠 📇 (⭐ 21, 🍴 10, 🐛 2) - A Ticketmaster MCP server that provides query capabilites from the Discovery API
typescriptmcpserverapihttpnpm install delorenj/mcp-server-ticketmaster - octomind-mcp 📘 🏠 (⭐ 21, 🍴 7, 🐛 5) - An MCP server for octomind tools, resources and prompts
typescriptmcpserverhttpainpm install OctoMind-dev/octomind-mcp - searxng-mcp 📜 🏠 (⭐ 21, 🍴 6, 🐛 1) - A Model Context Protocol (MCP) server that enables AI assistants to perform web searches using SearXNG, a privacy-respecting metasearch engine.
javascriptmcpserverwebainpm install tisDDM/searxng-mcp - taskflow-mcp 📘 🏠 (⭐ 21, 🍴 7) - A task management Model Context Protocol (MCP) server that helps AI assistants break down user requests into manageable tasks with subtasks, dependencies, and notes. Enforces a structured workflow with user approval steps.
typescriptai-assistantclaudecursordependencies-managernpm install pinkpixel-dev/taskflow-mcp - mcp-korean-spell 📘 🏠 (⭐ 21, 🍴 2, 🐛 2) - MCP(Model Context Protocol) server designed for Korean spell checking
typescriptmcpmcp-serverservernpm install winterjung/mcp-korean-spell - slack-mcp-server 📘 🏠 (⭐ 21, 🍴 7, 🐛 2) - A Model Context Protocol Server for Interacting with Slack
typescriptservernpm install AVIMBU/slack-mcp-server - mcp-server-amazon-bedrock 📜 🏠 (⭐ 21, 🍴 11, 🐛 1) - Model Context Procotol(MCP) server for using Amazon Bedrock Nova Canvas to generate images
javascriptamazon-bedrockamazon-novaclaudemodel-context-protocolnpm install zxkane/mcp-server-amazon-bedrock - 302_sandbox_mcp 📜 🏠 (⭐ 20, 🍴 2, 🐛 2) - 302 Sandbox MCP (Node.js-based)
javascriptmcpnpm install 302ai/302_sandbox_mcp - Elysia-mcp 📘 🏠 (⭐ 20, 🍴 2) - Model Context Protocol (MCP) Server for Bun and Elysia
typescriptmcpservernpm install keithagroves/Elysia-mcp - mcp-ai-agent 📘 🏠 (⭐ 20, 🍴 6) - A TypeScript library that enables AI agents to leverage MCP (Model Context Protocol) servers for enhanced capabilities. This library integrates with the AI SDK to provide a seamless way to connect to MCP servers and use their tools in AI-powered applications.
typescriptagentic-aiai-agentautogencrewainpm install fkesheh/mcp-ai-agent - mcp-design-system-extractor 📘 🏠 (⭐ 20, 🍴 7) - MCP (Model Context Protocol) server that enables AI assistants to interact with Storybook design systems. Extract component HTML, analyze styles, and help with design system adoption and refactoring.
typescriptmcpserveraimlnpm install freema/mcp-design-system-extractor - Jira-Context-MCP 📘 🏠 (⭐ 20, 🍴 12, 🐛 2) - MCP server to provide Jira Tickets information to AI coding agents like Cursor
typescriptmcpserveraihttpnpm install rahulthedevil/Jira-Context-MCP - mcp-file-preview 📜 🏠 (⭐ 20, 🍴 8, 🐛 1) - MCP server for HTML file preview and analysis - Has been weird with OS but good on Cline so WIP
javascriptagenticclinecssfile-previewnpm install seanivore/mcp-file-preview - mcp-googletasks 📘 🏠 📇 (⭐ 20, 🍴 10) - This Model Context Protocol (MCP) server provides a bridge between Claude and Google Tasks, allowing you to manage your task lists and tasks directly through Claude.
typescriptmcpservergoapinpm install arpitbatra123/mcp-googletasks - mcp-server-searxng 📜 🏠 (⭐ 20, 🍴 6, 🐛 1) - An MCP server implementation that integrates with SearXNG, providing privacy-focused meta search capabilities.
javascriptmcpservernpm install kevinwatt/mcp-server-searxng - mcp-twitter-server 📘 🏠 (⭐ 20, 🍴 13, 🐛 4) - Model Context Protocol Server for Accessing twitter
typescriptservernpm install crazyrabbitLTC/mcp-twitter-server - MCPRules 📜 🏠 (⭐ 20, 🍴 8, 🐛 2) - A powerful Model Context Protocol (MCP) server that manages and serves programming guidelines and rules. This server integrates with development tools to provide consistent coding standards across projects.
javascriptmcpservernpm install bartwisch/MCPRules - readwise-mcp 📘 🏠 (⭐ 20, 🍴 7, 🐛 5) - MCP server for Readwise
typescriptmcpservernpm install IAmAlexander/readwise-mcp - runpod-mcp 📜 🏠 (⭐ 20, 🍴 6, 🐛 2) - Node.js-based
javascriptnpm install runpod/runpod-mcp-ts - ShareMCP 🏠 (⭐ 20, 🍴 3) - Share MCP 是一个专注于 Model Context Protocol (MCP) 的导航站点。它提供了丰富的 MCP 相关资源、工具和服务的分类展示,帮助开发者快速找到所需的 MCP 解决方案。
vueagentsmcpmcp-servergit clone https://github.com/Ameprism/ShareMCP - terminal-mcp-server 📘 🏠 (⭐ 20, 🍴 6, 🐛 3) - Make LLM can control your PC or Server with ssh or terminal.
typescriptserverllmnpm install weidwonder/terminal-mcp-server - think-mcp-server 📘 🏠 (⭐ 20, 🍴 3, 🐛 6) - A minimal MCP Server based on the Anthropic's "think" tool research
typescriptmcpservernpm install marcopesani/think-mcp-server - webflow-mcp-server 📘 🏠 📇 (⭐ 20, 🍴 10, 🐛 2) - Webflow MCP server (TypeScript-based)
typescriptmcpserverwebapinpm install kapilduraphe/webflow-mcp-server - batchdata-mcp-real-estate 📘 🏠 📇 (⭐ 19, 🍴 3) - Model Context Protocol (MCP) server for BatchData.io property and address APIs - Real estate data integration for Claude and other AI assistants
typescriptmcpserverapiainpm install zellerhaus/batchdata-mcp-real-estate - descope-mcp-server-stdio 📘 🏠 (⭐ 19, 🍴 6, 🐛 6) - TypeScript-based
typescripthttpgitgithubnpm install descope-sample-apps/descope-mcp-server - devtools-mcp 📘 🏠 (⭐ 19, 🍴 9, 🐛 3) - A MCP server that provides Chrome DevTools Protocol access to LLMs
typescriptmcpserverllmnpm install stefanli/devtools-mcp - flyonui-mcp 📜 🏠 (⭐ 19, 🍴 4, 🐛 2) - MCP server for flyonUI
javascriptmcpserverhttpgitnpm install themeselection/flyonui-mcp - mcp-deepseek-demo 📘 🏠 (⭐ 19, 🍴 8) - deepseek 结合 mcp 场景,最小用例,包括 client and server
typescriptmcpservernpm install Ulanxx/mcp-deepseek-demo - mcp-evolution-whatsapp-api 📘 🏠 📇 (⭐ 19, 🍴 12, 🐛 3) - MCP server for evolution, the non official api for whatsapp
typescriptmcpserverapinpm install aiteks-ltda/mcp-evolution-whatsapp-api - MCP-Github-Mapper 📘 🏠 (⭐ 19, 🍴 8) - MCP GitHub Mapper is a MCP tool that will map any repository remotely and import the map directly into your code editor.
typescriptclinemcpmcp-serverroocodenpm install dazeb/MCP-Github-Mapper - MCP-Server-Pentest 📜 🏠 (⭐ 19, 🍴 4, 🐛 1) - Node.js-based
javascriptnpm install 9olidity/MCP-Server-Pentest - mcp-weather 📘 🏠 📇 (⭐ 19, 🍴 9, 🐛 1) - A Model Context Protocol (MCP) server that provides hourly and daily weather forecasts using the AccuWeather API.
typescriptmcpserverapiainpm install wizcas/mcp-weather - mcpsharepoint 📘 🏠 (⭐ 19, 🍴 6, 🐛 5) - Model Context Protocol server that provides access to Organisational SharePoint.
typescriptservernpm install BrianCusack/mcpsharepoint - tempo-mcp-server 📘 🏠 (⭐ 19, 🍴 10, 🐛 2) - MCP server for managing Tempo worklogs in Jira
typescriptautomationcursorjirajsnpm install ivelin-web/tempo-mcp-server - meeting-mcp 📘 🏠 (⭐ 19, 🍴 6, 🐛 2) - Model Context Protocol server for AI assistants to create meeting bots, search transcripts, and manage meeting recordings.
typescriptserverainpm install Meeting-Baas/meeting-mcp - todoist-mcp-server-extended 📜 🏠 📇 (⭐ 19, 🍴 6, 🐛 3) - Todoist MCP Server Extended - Enabling natural language management of todoist via Claude, MCP and todoist REST APIv2. Featuring LLM optimized Tools including batch operations and robust error handling.
javascriptmcpserverapillmnpm install Chrusic/todoist-mcp-server-extended - anti-bullshit-mcp-server 📜 🏠 (⭐ 19, 🍴 4, 🐛 2) - MCP server for analyzing claims, validating sources, and detecting manipulation using multiple epistemological frameworks
javascriptmcpserverainpm install bmorphism/anti-bullshit-mcp-server - metabase-mcp-server 📜 🏠 (⭐ 19, 🍴 5, 🐛 1) - A Model Context Protocol server that integrates AI assistants with Metabase analytics platform
javascriptserverainpm install hyeongjun-dev/metabase-mcp-server - claude-ts-mcps 📘 🏠 (⭐ 19, 🍴 9, 🐛 2) - TypeScript-based
typescriptnpm install ukkz/claude-ts-mcps - orca-mcp-server 📘 🏠 (⭐ 19, 🍴 5) - MCP server dedicated to the generation and management of input files for ORCA quantum chemical calculations.
typescriptmcpservernpm install PhelanShao/orca-mcp-server - alibabacloud-devops-mcp-server 📘 🏠 📇 (⭐ 18, 🍴 10, 🐛 2) - Yunxiao MCP Server provides AI assistants with the ability to interact with the Yunxiao platform. It provides a set of tools that interact with Yunxiao's API, allowing AI assistants to manage Codeup repository, Project, Pipeline, Packages etc.
typescriptalibabacloud-devopsdevops-mcpmcpservernpm install aliyun/alibabacloud-devops-mcp-server - dbx-mcp-server 📘 🏠 (⭐ 18, 🍴 10, 🐛 2) - MCP Server for Dropbox
typescriptmcpservernpm install amgadabdelhafez/DBX-MCP-Server - filesystem-mcp-server 📘 🏠 (⭐ 18, 🍴 15, 🐛 3) - A Model Context Protocol (MCP) server that provides filesystem operations for Claude AI
javascriptmcpserveraifilenpm install ai-yliu/filesystem-mcp-server - laravel-mcp 🐘 🏠 (⭐ 18, 🍴 1, 🐛 3) - A package for developing MCP Servers with Laravel.
phpmcpservergit clone https://github.com/innoge/laravel-mcp - maestro-mcp-server 📜 🏠 📇 (⭐ 18, 🐛 1) - Maestro MCP Server for Bitcoin
javascriptbitcoinblockchainmaestromcpnpm install maestro-org/maestro-mcp - mcp-server-semgrep 📜 🏠 (⭐ 18, 🍴 4, 🐛 1) - MCP Server Semgrep is a Model Context Protocol compliant server that integrates the powerful Semgrep static analysis tool with AI assistants like Anthropic Claude. It enables advanced code analysis, security vulnerability detection, and code quality improvements directly through a conversational interface.
javascriptanthropic-claudemodelcontextprotocolsemgrepmcpnpm install Szowesgad/mcp-server-semgrep - mcp-task-manager-server 📘 🏠 (⭐ 18, 🍴 5) - A local Model Context Protocol (MCP) server providing backend tools for client-driven project and task management using a SQLite database.
typescriptclaudeclinemcpmodelcontextprotocolnpm install bsmi021/mcp-task-manager-server - onyx-mcp-server 📘 🏠 (⭐ 18, 🍴 8, 🐛 2) - TypeScript-based
typescriptnpm install lupuletic/onyx-mcp-server - whimsical-mcp-server 📘 🏠 (⭐ 18, 🍴 6, 🐛 5) - MCP server for creating whimsical boards from an LLM context
typescriptmcpserverllmnpm install BrockReece/whimsical-mcp-server - xero-mcp 📘 🏠 (⭐ 18, 🍴 7, 🐛 1) - A Model Context Protocol server allows Clients to interact with Xero
typescriptserverhttpmlgitnpm install john-zhang-dev/xero-mcp - create-mcp-ts 📜 🏠 (⭐ 18, 🍴 5, 🐛 3) - Create a new MCP server in TypeScript, batteries included.
javascriptmcpserverhttpgitnpm install stephencme/create-mcp-ts - linear-remote-mcp 📘 🏠 (⭐ 18, 🍴 3) - Remote Model Context Protocol (MCP) server for Linear.
typescriptmcpservernpm install martinsione/linear-remote-mcp - ado-mcp 📘 🏠 (⭐ 17, 🍴 8, 🐛 2) - Azure DevOps MCP Server
typescriptmcpserverazurehttpnpm install aaronsb/ado-mcp - azure-onenote-mcp-server 📘 🏠 (⭐ 17, 🍴 6, 🐛 1) - TypeScript-based
typescriptnpm install ZubeidHendricks/azure-onenote-mcp-server - dexscreener-mcp-server 📜 🏠 (⭐ 17, 🍴 10, 🐛 2) - Node.js-based
javascriptnpm install openSVM/dexscreener-mcp-server - FalkorDB-MCPServer 📘 🏠 (⭐ 17, 🍴 5, 🐛 3) - FalkorDB-MCPServer is an MCP (Model Context Protocol) server that connects LLMs to FalkorDB
typescriptfalkordbgraphdatabasemcp-servermcpnpm install FalkorDB/FalkorDB-MCPServer - mcp-advisor 📜 🏠 (⭐ 17, 🍴 2, 🐛 3) - MCP Server to assist LLMs and humans on Model Context Protocol spec compliance and understanding
javascriptmcpserverllmnpm install olaservo/mcp-advisor - mcp-free-usdc-transfer 📜 🏠 (⭐ 17, 🍴 7, 🐛 4) - MCP (Model Context Protocol) server - free usdc transfer powered by Coinbase CDP
javascriptclaudecoinbasemagnetmodelcontextprotocolnpm install magnetai/mcp-free-usdc-transfer - mcp-searxng-public 📜 🏠 (⭐ 17, 🍴 3) - An MCP server that queries public SearXNG instances, parsing HTML contents into a JSON result
javascriptmcpservermljsonnpm install pwilkin/mcp-searxng-public - mcp-server-giphy 📘 🏠 📇 (⭐ 17, 🍴 4, 🐛 2) - An implementation of Giphy integration with Model Context Protocol
typescriptgiphygiphy-apimcp-servermodel-context-protocolnpm install magarcia/mcp-server-giphy - mcp-sqlite-bun-server 📘 🏠 (⭐ 17, 🍴 7, 🐛 2) - TypeScript-based
typescriptnpm install jacksteamdev/mcp-sqlite-bun-server - mixpanel-mcp 📘 🏠 📇 (⭐ 17, 🍴 12, 🐛 6) - MCP Server for Mixpanel API (talk to your Mixpanel data)
typescriptmcpserverapinpm install dragonkhoi/mixpanel-mcp - vercel-api-mcp 📘 🏠 📇 (⭐ 17, 🍴 7, 🐛 1) - Lightweight MCP server to give your Cursor Agent access to the Vercel API.
typescriptmcpvercelvercel-apiservernpm install zueai/vercel-api-mcp - WebSearch-MCP 📜 🏠 📇 (⭐ 17, 🍴 5) - [Self-hosted] A Model Context Protocol (MCP) server implementation that provides a web search capability over stdio transport. This server integrates with a WebSearch Crawler API to retrieve search results.
webhttpgitgithubjavascriptnpm install mnhlt/WebSearch-MCP - openapi2mcptools 📘 🏠 📇 (⭐ 17, 🍴 6, 🐛 2) - OpenAPI specifications => MCP (Model Context Protocol) tools
typescriptmcpmcp-servermcp-toolsmodelcontextprotocolnpm install 2013xile/openapi2mcptools - lightdash-mcp-server 📘 🏠 (⭐ 17, 🍴 6, 🐛 1) - A MCP(Model Context Protocol) server that accesses to Lightdash
typescriptlightdashmcpmcp-serversmodel-context-protocolnpm install syucream/lightdash-mcp-server - agent-twitter-client-mcp 📘 🏠 (⭐ 16, 🍴 9, 🐛 2) - A Model Context Protocol (MCP) server that integrates with X using the @elizaOS
agent-twitter-clientpackage, allowing AI models to interact with Twitter without direct API access.typescriptagent-twitter-clientgrokgrok-apigrok3npm install ryanmac/agent-twitter-client-mcp - codex-mcp 📘 🏠 📇 (⭐ 16, 🍴 3, 🐛 2) - A Model Context Protocol server for the Codex API
typescriptserverapihttpainpm install Codex-Data/codex-mcp - goalstory-mcp 📘 🏠 (⭐ 16, 🍴 3, 🐛 1) - TypeScript-based
typescripthttpgitgithubnpm install hichana/goalstory-mcp - grok-mcp 📜 🏠 📇 (⭐ 16, 🍴 7, 🐛 4) - MCP server for Grok AI API integration
javascriptmcpserverapiainpm install Bob-lance/grok-mcp - lighthouse-mcp-server 📘 🏠 (⭐ 16, 🍴 2, 🐛 2) - MCP server that enables AI agents to perform comprehensive web audits using Google Lighthouse with 13+ tools for performance, accessibility, SEO, and security analysis.
typescriptlighthouselighthouse-auditslighthouse-scoremcpnpm install danielsogl/lighthouse-mcp-server - mcp-postgres-full-access 📘 🏠 (⭐ 16, 🍴 7, 🐛 5) - Full access postgres mcp server
typescriptmcpserverpostgresnpm install syahiidkamil/mcp-postgres-full-access - mcp-shodan 📘 🏠 (⭐ 16, 🍴 12, 🐛 1) - The Shodan MCP Server by ADEO Cybersecurity Services provides cybersecurity professionals with streamlined access to Shodan's powerful reconnaissance capabilities through an intuitive Model Context Protocol interface. It enables efficient asset discovery, vulnerability assessment, and security monitoring through 11 consolidated analysis prompts.
typescriptmcpserveraimlnpm install ADEOSec/mcp-shodan - mcp-stdio-to-streamable-http-adapter 📜 🏠 (⭐ 16, 🍴 6, 🐛 2) - Proxy through a STDIO MCP Server to interact with Streamable HTTP MCP Servers
javascriptmcpserverhttpgitnpm install pyroprompts/mcp-stdio-to-streamable-http-adapter - mcp-vibecoder 📘 🏠 (⭐ 16, 🍴 8, 🐛 3) - A MCP server to help with Vibecoding
typescriptmcpservernpm install crazyrabbitLTC/mcp-vibecoder - meta-mcp-server 📜 🏠 (⭐ 16, 🍴 5, 🐛 3) - Node.js-based
javascriptmcpservernpm install infinitimeless/meta-mcp-server - moneybird-mcp-server 📜 🏠 (⭐ 16, 🍴 6, 🐛 2) - Moneybird MCP Server - AI-powered bookkeeping
javascriptclaudemcpmcp-servermoneybirdnpm install vanderheijden86/moneybird-mcp-server - mysql-mcp 📜 🏠 (⭐ 16, 🍴 11, 🐛 4) - An MCP server implementation that integrates with MySQL databases, providing secure database access capabilities for LLMs.
javascriptmcpserverdatabasellmnpm install kevinwatt/mysql-mcp - n8n_MCP_server_complete 📘 🏠 (⭐ 16, 🍴 5) - Complete MCP server for n8n workflow management in Cursor
typescriptmcpservernpm install dopehunter/n8n_MCP_server_complete - nile-mcp-server 📘 🏠 (⭐ 16, 🍴 8, 🐛 4) - MCP server for Nile Database - Manage and query databases, tenants, users, auth using LLMs
typescriptmcpserverdatabasellmnpm install niledatabase/nile-mcp-server - powerplatform-mcp 📜 🏠 (⭐ 16, 🍴 12, 🐛 5) - PowerPlatform Model Context Protocol server
javascriptservernpm install michsob/powerplatform-mcp - protonmail-mcp 📜 🏠 (⭐ 16, 🍴 4, 🐛 1) - This MCP server provides email sending functionality using Protonmail's SMTP service. It allows both Claude Desktop and Cline VSCode extension to send emails on your behalf using your Protonmail credentials.
javascriptmcpmodelcontextprotocolprotonmailservernpm install amotivv/protonmail-mcp - retellai-mcp-server 📘 🏠 (⭐ 16, 🍴 11, 🐛 3) - MCP server for retellai
typescriptmcpserverainpm install abhaybabbar/retellai-mcp-server - say-mcp-server 📜 🏠 (⭐ 16, 🍴 9, 🐛 2) - MCP server for macOS text-to-speech functionality
javascriptmcpservernpm install bmorphism/say-mcp-server - TranscriptionTools-MCP 📘 🏠 (⭐ 16, 🍴 6, 🐛 1) - An MCP server providing intelligent transcript processing capabilities, featuring natural formatting, contextual repair, and smart summarization powered by Deep Thinking LLMs.
typescriptmcpserveraillmnpm install MushroomFleet/TranscriptionTools-MCP - mcp-server-prometheus 📜 🏠 (⭐ 16, 🍴 7, 🐛 3) - MCP server for interacting with Prometheus
javascriptmcpmcp-servermodelcontextprotocolservernpm install loglmhq/mcp-server-prometheus - harvest-mcp-server 🐍 🏠 (⭐ 15, 🍴 6) - MCP Server for Harvest
javascriptmcpserverpythonnpm install adrian-dotco/harvest-mcp-server - hn-mcp 📜 🏠 (⭐ 15, 🍴 3) - Hacker News MCP Server
javascriptmcpservernpm install devabdultech/hn-mcp - mattermost-mcp 📘 🏠 (⭐ 15, 🍴 8, 🐛 4) - Mattermost MCP server to enable Claude to interact with Mattermost Workspaces
typescriptmcpservernpm install pvev/mattermost-mcp - mcp-neurolora 📘 🏠 (⭐ 15, 🍴 7, 🐛 5) - An intelligent MCP server that provides tools for collecting and documenting code from directories
typescriptmcpservernpm install aindreyway/mcp-neurolora - rollbar-mcp-server 📘 🏠 (⭐ 15, 🍴 4, 🐛 3) - Pre-release - Model Context Protocol server for Rollbar
typescriptmcpmcp-clientmcp-servermcp-serversnpm install rollbar/rollbar-mcp-server - three-js-mcp 📜 🏠 (⭐ 15, 🍴 6, 🐛 1) - MCP server for controlling ThreeJs source code, only basic function
javascriptmcpservernpm install locchung/three-js-mcp - confluence-cloud-mcp 📘 🏠 (⭐ 15, 🍴 8, 🐛 6) - A Model Context Protocol (MCP) server that enables AI assistants to manage Confluence Cloud spaces, pages, and content through a standardized interface.
typescriptmcpserverainpm install aaronsb/confluence-cloud-mcp - mcp-neo4j-memory-server 📘 🏠 (⭐ 15, 🍴 4, 🐛 4) - MCP Memory Server with Neo4j backend for AI knowledge graph storage
typescriptmcpserverainpm install JovanHsu/mcp-neo4j-memory-server - mcp-test-runner 📘 🏠 (⭐ 15, 🍴 5, 🐛 7) - TypeScript-based
typescriptnpm install privsim/mcp-test-runner - token-minter-mcp 📜 🏠 (⭐ 15, 🍴 10, 🐛 4) - An MCP server providing tools for AI agents to mint ERC-20 tokens across multiple blockchains.
javascriptmcpserveraihttpnpm install kukapay/token-minter-mcp - mcp-github-notifications 📘 🏠 📇 (⭐ 15, 🍴 5, 🐛 4) - An MCP server for the github notifications API for the OSS maintainer
typescriptmcpserverapiainpm install mcollina/mcp-github-notifications - bsv-mcp 📘 🏠 (⭐ 14, 🍴 7, 🐛 2) - An MCP Server for Bitcoin SV
typescriptmcpservernpm install b-open-io/bsv-mcp - clickup-mcp-server 📘 🏠 (⭐ 14, 🍴 9, 🐛 6) - A Model Context Protocol server implementation for ClickUp integration, enabling AI assistants to interact with ClickUp workspaces.
typescriptserverainpm install Nazruden/clickup-mcp-server - claude-server 📜 🏠 (⭐ 14, 🍴 10, 🐛 5) - Claude Server is an MCP implementation that enhances Claude's capabilities by providing sophisticated context management across sessions, enabling persistent knowledge organization through hierarchical project contexts and continuous conversation threads stored in a well-structured ~/.claude directory.
javascriptclaudecontextmcpmodel-context-protocolnpm install davidteren/claude-server - fiscal-data-mcp 📘 🏠 (⭐ 14, 🍴 4, 🐛 2) - mcp server connected to us treasury data, built with mcp-framework
typescriptmcpservernpm install QuantGeekDev/fiscal-data-mcp - gemini-mcp-server 📜 🏠 (⭐ 14, 🍴 3, 🐛 3) - A Model Context Protocol (MCP) server that enables Claude Desktop to interact with Google's Gemini AI - featuring 7 tools with Smart Tool Intelligence that learns from your usage patterns
typescriptmcpservergojavascriptnpm install georgejeffers/gemini-mcp-server - gong-mcp 📜 🏠 (⭐ 14, 🍴 11, 🐛 8) - Simple Gong MCP server
javascriptmcpservergonpm install kenazk/gong-mcp - Langflow-DOC-QA-SERVER 📜 🏠 (⭐ 14, 🍴 9) - A Model Context Protocol server for document Q&A powered by Langflow . It demonstrates core MCP concepts by providing a simple interface to query documents through a Langflow backend.
javascriptmcpserverhttpgitnpm install GongRzhe/Langflow-DOC-QA-SERVER - markdown2pdf-mcp 📜 🏠 (⭐ 14, 🍴 11, 🐛 2) - MCP Server for converting markdown to PDF
javascriptmcpserveragentagentic-ainpm install 2b3pro/markdown2pdf-mcp - mcp-hello-world 📜 🏠 (⭐ 14) - A simple Hello World MCP server for CI/CD test
javascriptmcpserverhttpgitnpm install lobehub/mcp-hello-world - mcp-money 📜 🏠 (⭐ 14, 🍴 1) - MCP server to give nutsack wallets to agents, an important milestone in the path towardsskynet
javascriptmcpservernpm install pablof7z/mcp-money - mcp-paperswithcode 🐍 🏠 📇 (⭐ 14, 🍴 5, 🐛 3) - An unofficial MCP interface to interact with the PapersWithCode API
apihttpgitgithubpythonpip install git+https://github.com/hbg/mcp-paperswithcode - mcp-perforce 📘 🏠 (⭐ 14, 🍴 1, 🐛 2) - MCP Perforce Server (TypeScript-based)
typescriptmcpservernpm install Cocoon-AI/mcp-perforce - mcp-rss-crawler 📘 🏠 (⭐ 14, 🍴 4, 🐛 2) - RSS Crawler MCP Server
typescriptmcpservernpm install mshk/mcp-rss-crawler - mcp-streamable-http-typescript-server 📘 🏠 (⭐ 14, 🍴 5, 🐛 1) - Starter for MCP Server with a Streamable HTTP Transport
typescriptmcpserverhttpnpm install ferrants/mcp-streamable-http-typescript-server - metatrader-mcp 📘 🏠 (⭐ 14, 🍴 2) - A MCP-Server to control Metatrader5 for EA optimization
typescriptmcpservernpm install chymian/metatrader-mcp - npm-search-mcp-server 📜 🏠 (⭐ 14, 🍴 5, 🐛 1) - MCP server for searching npm packages
javascriptclaudemcpmcp-servermodel-context-protocolnpm install btwiuse/npm-search-mcp-server - opencage-geocoding-mcp 📜 🏠 📇 (⭐ 14, 🍴 1) - MCP server for querying the OpenCage geocoding API from within LLMs
javascriptmcpserverapillmnpm install OpenCageData/opencage-geocoding-mcp - package-documentation-mcp 📜 🏠 (⭐ 14, 🍴 4, 🐛 1) - MCP Server to retrieve documentation for a package
javascriptmcpserverdocumentationnpm install cdugo/package-documentation-mcp - placid-mcp-server 📘 🏠 (⭐ 14, 🍴 6, 🐛 1) - Generate image and video creatives using Placid.app templates in MCP compatible hosts
typescriptmcphttpgitgithubnpm install felores/placid-mcp-server - triliumnext-mcp 📘 🏠 (⭐ 14, 🍴 4, 🐛 1) - MCP server for TriliumNext Notes
typescriptmcpservernpm install tan-yong-sheng/triliumnext-mcp - withseismic-mcp 📘 🏠 (⭐ 14, 🍴 1, 🐛 1) - Withseismic MCP Server - Model Control Protocol, the ://WITHSEISMIC way
typescriptmcpservernpm install dougwithseismic/withseismic-mcp - limitless-mcp-server 📘 🏠 📇 (⭐ 14, 🍴 3, 🐛 2) - A Model Context Protocol server, client and interactive mode for Limitless API
typescriptserverapinpm install manueltarouca/limitless-mcp-server - mcp-terragrunt-docs 📘 🏠 (⭐ 14, 🍴 2, 🐛 3) - Deno/TypeScript MCP Server providing context related to Terragrunt documentation.
typescriptmcpserverdocumentationhttpnpm install Excoriate/mcp-terragrunt-docs - babashka-mcp-server 📜 🏠 (⭐ 14, 🍴 4, 🐛 4) - A Model Context Protocol server for interacting with Babashka, a native Clojure interpreter for scripting
javascriptservernpm install bmorphism/babashka-mcp-server - attio-mcp-server 📜 🏠 (⭐ 13, 🍴 20, 🐛 4) - Node.js-based
javascripttypescriptmcpserverhttpnpm install hmk/attio-mcp-server - balldontlie-mcp 📜 🏠 📇 (⭐ 13, 🍴 10, 🐛 1) - An MCP Server implementation that integrates the Balldontlie API, to provide information about players, teams and games for the NBA, NFL and MLB
javascriptmcp-servermlbmodel-context-protocolnbanpm install mikechao/balldontlie-mcp - dependency-mcp 📜 🏠 (⭐ 13, 🍴 2, 🐛 3) - A Model Context Protocol (MCP) server for analyzing code dependencies
javascriptmcpservernpm install mkearl/dependency-mcp - ffmpeg-mcp 📘 🏠 (⭐ 13, 🍴 3) - An MCP server for FFmpeg
typescriptcodeccompressioncontentconversionnpm install ZizoTheDev/ffmpeg-mcp - linkedin-mcp-runner 📜 🏠 (⭐ 13, 🍴 3, 🐛 1) - Node.js-based
javascripthttpgitgithubnpm install ertiqah/linkedin-mcp-runner - mcp-dynamics365-server 📘 🏠 (⭐ 13, 🍴 7, 🐛 2) - MCP Server for Microsoft Dynamics 365
typescriptmcpservernpm install srikanth-paladugula/mcp-dynamics365-server - mcp-google-workspace 📘 🏠 (⭐ 13, 🍴 9, 🐛 5) - MCP Server for Gmail and Calendar
typescriptmcpserverainpm install j3k0/mcp-google-workspace - mcp-micromanage-your-agent 📘 🏠 (⭐ 13, 🍴 2, 🐛 1) - A Micromanagement Tool for Development Workflows: Helps coding agent plan, track, and visualize sequential development tasks with detailed commit-level granularity. Features interactive visualization, automated status tracking, and structured workflow management.
typescriptcursormcpmcp-serverproductivitynpm install yodakeisuke/mcp-micromanage-your-agent - mcp-pyodide 📘 🏠 (⭐ 13, 🍴 5) - A Pyodide server implementation for the Model Context Protocol (MCP).
typescriptmcpservernpm install yonaka15/mcp-pyodide - mcp-qdrant-memory 📘 🏠 (⭐ 13, 🍴 18, 🐛 4) - MCP server providing a knowledge graph implementation with semantic search capabilities powered by Qdrant vector database
typescriptmcpserverdatabasenpm install delorenj/mcp-qdrant-memory - Mcp-Reasoning-Server 📘 🏠 (⭐ 13, 🍴 4, 🐛 2) - This is a very basic implementation of an Mcp-Reasoning-Server for Cursor AI .
typescriptmcpserverainpm install AzDeltaQQ/Mcp-Reasoning-Server - mcp-server-helius 📘 🏠 (⭐ 13, 🍴 11, 🐛 3) - TypeScript-based
typescriptnpm install dcSpark/mcp-server-helius - mcp-server-salesforce 📘 🏠 (⭐ 13, 🍴 13, 🐛 1) - An MCP (Model Context Protocol) server implementation that integrates Claude with Salesforce, enabling natural language interactions with your Salesforce data and metadata. This server allows Claude to query, modify, and manage your Salesforce objects and records using everyday language.
typescriptmcpmcp-serversalesforceservernpm install SurajAdsul/mcp-server-salesforce - mcp-sunsama 📘 🏠 (⭐ 13, 🍴 1) - TypeScript-based
typescriptnpm install robertn702/mcp-sunsama - mcp-typesense-server 📘 🏠 (⭐ 13, 🍴 9, 🐛 2) - TypeScript-based
typescripthttpaillmgitnpm install suhail-ak-s/mcp-typesense-server - mcp-web-search-tool 📘 🏠 (⭐ 13, 🍴 2, 🐛 2) - A MCP server providing real-time web search capabilities to any AI model.
typescriptagentclaudeclaude-aimcpnpm install gabrimatic/mcp-web-search-tool - my-bear-mcp-server 📜 🏠 (⭐ 13, 🍴 4, 🐛 4) - Node.js-based
javascriptnpm install bart6114/my-bear-mcp-server - roblox-studio-mcp-server-updated 📜 🏠 (⭐ 13, 🍴 3) - Updated version of the Roblox Studio MCP Server with improvements
javascriptmcpservernpm install dmae97/roblox-studio-mcp-server-updated - web-mcp 📘 🏠 (⭐ 13, 🍴 2, 🐛 2) - WEB MCP - One-Click Browser Empowerment
typescriptmcpserveragentainpm install zgagnon/web-mcp - youtube-music-mcp-server 📜 🏠 (⭐ 13, 🍴 4, 🐛 4) - This is a MCP (Model Context Protocol) server that you can use with Cline through Visual Studio Code and ask songs to be played using Youtube Music
javascriptmcpservernpm install mondweep/youtube-music-mcp-server - mcp-config-editor 📘 🏠 (⭐ 13, 🍴 1, 🐛 1) - A simple GUI for managing MCP servers, for easy toggle mcp servers.
typescriptanthropic-claudemodel-context-protocoltauri-appmcpnpm install kaichen/mcp-config-editor - mcp-time-php 🐘 🏠 (⭐ 13, 🍴 1) - A PHP sample implementation of an MCP (Model Context Protocol) server for retrieving time information.
phpclaudemcpmcp-serverzedgit clone https://github.com/uzulla/mcp-time-php - supabase-mcp-server 📘 🏠 (⭐ 13, 🐛 2) - TypeScript-based
typescriptnpm install Quegenx/supabase-mcp-server - Zonos-TTS-MCP 📘 🏠 (⭐ 13, 🍴 8, 🐛 1) - MCP server that allows Claude to have a voice.
typescriptmcpservernpm install PhialsBasement/Zonos-TTS-MCP - mcp-devtools 📘 🏠 (⭐ 13, 🍴 2) - MCP DevTools: A suite of Model Context Protocol servers enabling AI assistants to interact with developer tools and services
typescriptai-integrationautomationclaudecoding-assistantnpm install DXHeroes/mcp-devtools - mcp-ossinsight 📜 🏠 (⭐ 13, 🍴 3) - An MCP server based on OSSInsight.io, providing data analysis for GitHub individuals and repositories, as well as in-depth insights into the open source ecosystem.
javascriptmcpmcp-serverossinsightservernpm install damonxue/mcp-ossinsight - beyond-mcp-server 📘 🏠 (⭐ 12, 🍴 8, 🐛 4) - An Extensible Model Context Protocol (MCP) server
typescriptmcpservernpm install Beyond-Network-AI/beyond-mcp-server - brave-search-mcp-sse 📘 🏠 (⭐ 12, 🍴 10, 🐛 2) - Stream Brave Search (web & local) results via a Model Context Protocol (MCP) / Server-Sent Events (SSE) interface. Acts as a centralized, observable tool provider for AI models, deployable via Docker or Helm.
typescriptmcpserverwebainpm install Shoofio/brave-search-mcp-sse - cal-mcp 📘 🏠 (⭐ 12, 🍴 3, 🐛 1) - 用于计算数学表达式的MCP (TypeScript-based)
typescriptmcp-servermcphttpgitnpm install pwh-pwh/cal-mcp - code-context-mcp 📘 🏠 (⭐ 12, 🍴 4, 🐛 3) - A Model Context Protocol (MCP) server for providing code context from git repositories
typescriptmcpservernpm install fkesheh/code-context-mcp - financial-analysis-mcp-server 📘 🏠 📇 (⭐ 12, 🍴 3) - An Anthropic Model Context Protocol (MCP) server for financial analysis with alphavantage.com and financialmodellingprep.com API integration.
typescriptmcpserverapinpm install kablewy/financial-analysis-mcp-server - bybit-mcp 📘 🏠 (⭐ 12, 🍴 7, 🐛 1) - Ollama MCP server for bybit
typescriptmcpservernpm install sammcj/bybit-mcp - Calendar-Autoauth-MCP-Server 📜 🏠 (⭐ 12, 🍴 6, 🐛 6) - A Model Context Protocol (MCP) server for Google Calendar integration in Cluade Desktop with auto authentication support. This server enables AI assistants to manage Google Calendar events through natural language interactions.
javascriptmcpserveraiauthnpm install GongRzhe/Calendar-Autoauth-MCP-Server - confluence-mcp-server 📜 🏠 📇 (⭐ 12, 🍴 5, 🐛 1) - A test of confluence mcp server
javascriptmcpservertypescriptpythonnpm install KS-GEN-AI/confluence-mcp-server - DeepLucid3D-MCP 📘 🏠 (⭐ 12, 🍴 3, 🐛 3) - Unified Cognitive Processing Framework - MCP server for Cline and more
typescriptmcpservernpm install MushroomFleet/DeepLucid3D-MCP - deno2-playwright-mcp-server 📘 🏠 (⭐ 12, 🍴 4) - A Model Context Protocol server that provides browser automation capabilities using Playwright and Deno 2.
typescriptservernpm install jakedahn/deno2-playwright-mcp-server - firefly-mcp 📘 🏠 (⭐ 12, 🍴 5, 🐛 4) - Firefly MCP (TypeScript-based)
typescriptmcphttpaigitnpm install gofireflyio/firefly-mcp - mcp-appstore 📘 🏠 (⭐ 12, 🍴 5, 🐛 2) - This is an MCP server that provides tools to LLMs for searching and analyzing apps from both Google Play Store and Apple App Store – perfect for ASO.
typescriptapp-store-scraperappstoreasogoogle-playnpm install appreply-co/mcp-appstore - mcp-client-langchain-ts 📘 🏠 (⭐ 12, 🍴 2, 🐛 1) - Simple MCP Client CLI Implementation Using LangChain ReAct Agent / TypeScript
typescriptlangchainlangchain-typescriptmcpmcp-clientnpm install hideya/mcp-client-langchain-ts - http-4-mcp 📜 🏠 📇 (⭐ 12, 🍴 4, 🐛 1) - HTTP-4-MCP configuration tool allows you to easily convert HTTP API to MCP tool without writing code. With simple interface operations, you can quickly configure an mcp-server.
javascriptmcpserverapihttpnpm install Tght1211/http-4-mcp - MCP-Facebook 📘 🏠 (⭐ 12, 🍴 6, 🐛 2) - MCP server pro zadávání a vyhodnocování reklamních kampaní na Facebooku pomocí Claude AI
typescriptmcpserverainpm install Tisik79/MCP-Facebook - mcp-lambda-sam 📘 🏠 (⭐ 12, 🍴 4, 🐛 3) - An AWS Serverless Application Model that operates as an MCP server via serverless AWS resources
typescriptmcpserverawsnpm install markvp/mcp-lambda-layer - mcp-manager-desktop 📘 🏠 (⭐ 12, 🍴 6, 🐛 1) - WIP: A MCP server to search, install, uninstall all your MCP servers or services for your Claude App (or more)
typescriptmcpservernpm install MCP-Club/mcp-manager-desktop - mcp-n8n-server 📜 🏠 📇 (⭐ 12, 🍴 3) - MCP server for n8n API integration - Connect Claude AI to n8n workflows
javascriptmcpserverapiainpm install ahmadsoliman/mcp-n8n-server - mcp-screenshot-server 📜 🏠 📇 (⭐ 12, 🍴 10, 🐛 4) - A MCP server for capturing screenshots
javascriptmcpserverapiainpm install sethbang/mcp-screenshot-server - novita-mcp-server 📜 🏠 (⭐ 12, 🍴 7, 🐛 3) - The Model Context Protocol (MCP) server that provides seamless interaction with Novita AI platform resources
javascriptclaude-desktopcursormcp-servermcpnpm install novitalabs/novita-mcp-server - perplexity-mcp-server 📘 🏠 📇 (⭐ 12, 🍴 2, 🐛 2) - A Perplexity API MCP server that unlocks Perplexity's search-augmented AI capabilities for LLM agents. Features robust error handling, secure input validation, and transparent reasoning with the showThinking parameter.
typescriptllm-agentmcpmcp-servermodel-context-protocolnpm install cyanheads/perplexity-mcp-server - ScreenshotMCP 📜 🏠 (⭐ 12, 🍴 1, 🐛 1) - A Model Context Protocol MCP server for capturing website screenshots with full page, element, and device size features.
javascriptmcpserverwebnpm install upnorthmedia/ScreenshotMCP - server-google-jobs 📜 🏠 📇 (⭐ 12, 🍴 8, 🐛 2) - 【Every star you give feeds a hungry developer's motivation!⭐️】A Model Context Protocol (MCP) server implementation that provides Google Jobs search capabilities via SerpAPI integration. Features multi-language support, comprehensive search parameters, and smart error handling.
javascriptgoogle-jobsjob-searchmcp-servernodejsnpm install ChanMeng666/server-google-jobs - skrape-mcp 📜 🏠 (⭐ 12, 🍴 9) - MCP Server for skrape.ai, lets you input any URL and it returns clean markdown for the LLM
javascripthtml-to-markdownmcpmcp-serverscrapenpm install skrapeai/skrape-mcp - smar-mcp 📘 🏠 (⭐ 12, 🍴 9, 🐛 46) - Smartsheet MCP Server
typescriptmcpservernpm install smartsheet-platform/smar-mcp - trusted-mcp-server 📘 🏠 (⭐ 12, 🍴 1, 🐛 2) - First Trusted MCP server running on AWS Nitro Enclave Trusted Execution Environment
typescriptmcpmcp-serverteetrustednpm install 0xfreysa/trusted-mcp-server - mapbox-mcp-server 📘 🏠 📇 (⭐ 12, 🍴 10, 🐛 6) - MCP Server for the Mapbox API.
typescriptmcpserverapinpm install AidenYangX/mapbox-mcp-server - render-mcp 📘 🏠 (⭐ 12, 🍴 5, 🐛 3) - An unofficial MCP server for Render to help developers ship code faster via Cline, Cursor, and Windsurf
typescriptdeploymentllmopsmcprendernpm install niyogi/render-mcp - sensei-mcp 📘 🏠 (⭐ 12, 🍴 5, 🐛 2) - Sensei MCP is a Model Context Protocol (MCP) server that provides expert guidance for Dojo and Cairo development on Starknet.
typescriptmcpserverainpm install dojoengine/sensei-mcp - valtown-mcp-server 📘 🏠 (⭐ 12, 🍴 4) - ValTown MCP Server - Execute ValTown functions from AI assistants
typescriptmcpserverainpm install PrashamTrivedi/valtown-mcp-server - mcp-kibela 📘 🏠 (⭐ 12, 🍴 6, 🐛 2) - MCP server implementation that enables AI assistants to search and reference Kibela content
typescriptmcpserveraihttpnpm install kj455/mcp-kibela - mcp-server 📘 🏠 (⭐ 12, 🍴 1, 🐛 16) - D-Zero frontend coding MCP server
typescriptmcpservernpm install Changerawr/mcp-server - Augmented-Nature-UniProt-MCP-Server 📜 🏠 (⭐ 11, 🍴 5, 🐛 2) - A comprehensive Model Context Protocol (MCP) server providing advanced access to the UniProt protein database.
javascriptbioinformaticsdrug-designdrug-discoverymcp-servernpm install Augmented-Nature/Augmented-Nature-UniProt-MCP-Server - azure-resource-graph-mcp-server 📘 🏠 (⭐ 11, 🍴 6, 🐛 1) - Model Context Protocol (MCP) server that provides access to Azure Resource Graph queries. It allows you to retrieve information about Azure resources across your subscriptions using Resource Graph queries.
typescriptmcpserverazurehttpnpm install hardik-id/azure-resource-graph-mcp-server - bun-mcp-sse-transport 📘 🏠 (⭐ 11, 🍴 3, 🐛 2) - Bun Server Transport implementation for MCP - MCP SSE
typescriptbunmcpmcp-serverservernpm install tigranbs/bun-mcp-sse-transport - claude-mcp-trello 📜 🏠 (⭐ 11, 🍴 7, 🐛 1) - A Model Context Protocol (MCP) server that provides tools for interacting with Trello boards.
javascriptmcpservernpm install hrs-asano/claude-mcp-trello - CyberMCP 📘 🏠 📇 (⭐ 11, 🍴 8, 🐛 2) - CyberMCP is a Model Context Protocol (MCP) server designed for testing backend APIs for security vulnerabilities. It provides a set of specialized tools and resources that can be used by LLMs to identify common security issues in APIs.
typescriptmcpserverapillmnpm install ricauts/CyberMCP - dbt-semantic-layer-mcp-server 📘 🏠 (⭐ 11, 🍴 3, 🐛 2) - MCP Server for querying DBT Semantic Layer
typescriptmcpservernpm install TommyBez/dbt-semantic-layer-mcp-server - dokploy-mcp 📘 🏠 (⭐ 11) - Dokploy MCP Server exposes Dokploy functionalities as tools consumable via the Model Context Protocol (MCP)
typescriptmcpservernpm install andradehenrique/dokploy-mcp - exploitdb-mcp-server 📘 🏠 (⭐ 11, 🍴 1, 🐛 2) - TypeScript-based
typescriptcybersecuritycyreslabmcpmcp-servernpm install Cyreslab-AI/exploitdb-mcp-server - gel-mcp-server 📘 🏠 (⭐ 11, 🍴 5, 🐛 4) - MCP Server enabling LLM Agents to interact with Gel databases
typescriptmcpserverdatabasellmnpm install christian561/gel-mcp-server - genesys-cloud-mcp-server 📘 🏠 📇 (⭐ 11, 🍴 4, 🐛 1) - Model Context Protocol (MCP) server for Genesys Cloud’s Platform API
typescriptgenesys-cloudmcp-servermcpservernpm install MakingChatbots/genesys-cloud-mcp-server - knowledgegraph-mcp 📘 🏠 (⭐ 11, 🍴 3) - MCP server for enabling persistent knowledge storage for Claude through a knowledge graph with multiple storage backends and fuzzy search
typescriptclaudecursorgraphknowledgenpm install n-r-w/knowledgegraph-mcp - langchain-mcp-tools-ts-usage 📘 🏠 (⭐ 11, 🍴 2) - MCP Tools Usage From LangChain ReAct Agent / Example in TypeScript
typescriptlangchainlangchain-typescriptmcpmcp-clientnpm install hideya/langchain-mcp-tools-ts-usage - mac-shell-mcp 📜 🏠 (⭐ 11, 🍴 8, 🐛 3) - An MCP (Model Context Protocol) server for executing macOS terminal commands with ZSH shell. This server provides a secure way to execute shell commands with built-in whitelisting and approval mechanisms.
javascriptmacmcpzshservernpm install cfdude/mac-shell-mcp - mcp-atproto-docs 📘 🏠 (⭐ 11, 🍴 2, 🐛 1) - A MCP server to query and generate answers based on the ATproto documentation available online
typescriptmcpserveraidocumentationnpm install immber/mcp-atproto-docs - mcp-dexscreener 📜 🏠 📇 (⭐ 11, 🍴 4, 🐛 2) - Dexscreener API's MCP server - let your AI agent check any on-chain price using Dexscreener's free and open API
javascriptmcpserverapiainpm install janswist/mcp-dexscreener - mcp-gitlab 📘 🏠 (⭐ 11, 🍴 12, 🐛 2) - TypeScript-based
typescriptnpm install rifqi96/mcp-gitlab - mcp-magic-ui 📘 🏠 (⭐ 11, 🍴 3, 🐛 2) - An MCP (Model Context Protocol) server for accessing and searching Magic UI components
typescriptmcpservernpm install idcdev/mcp-magic-ui - chatgpt-mcp-server 📘 🏠 (⭐ 11, 🍴 4, 🐛 4) - A Model Context Protocol server for Docker management through ChatGPT
typescriptserverdockernpm install Toowiredd/chatgpt-mcp-server - mcp-server-kakao-map 📘 🏠 (⭐ 11, 🍴 3, 🐛 2) - kakao map mcp server
typescriptkakaomcp-servermcpservernpm install cgoinglove/mcp-server-kakao-map - mcp-server-weather-js 📜 🏠 (⭐ 11, 🍴 7, 🐛 2) - Simple Weather MCP Server Example
javascriptmcpmcp-servermodelcontextprotocolnodejsnpm install hideya/weather-mcp-server - mcp-starter 📘 🏠 (⭐ 11, 🍴 5) - A start template for a typescript mcp server
typescriptmcpservernpm install MatthewDailey/mcp-starter - mcp-turso-cloud 📘 🏠 (⭐ 11, 🍴 4, 🐛 8) - 🗂️ A Model Context Protocol (MCP) server that provides integration with Turso databases for LLMs. This server implements a two-level authentication system to handle both organization-level and database-level operations, making it easy to manage and query Turso databases directly from LLMs.
typescriptmcpmodel-context-protocoltursoturso-dbnpm install spences10/mcp-turso-cloud - mcp-test-client 📘 🏠 (⭐ 11, 🍴 1) - MCP Test Client is a TypeScript testing utility for Model Context Protocol (MCP) servers.
typescriptmcpservertestingnpm install crazyrabbitLTC/mcp-test-client - mcp-youtube-sheets 📜 🏠 (⭐ 11, 🍴 5, 🐛 3) - Node.js-based
javascriptnpm install Rickyyy1116/mcp-youtube-sheets - playwright-mcp-server 📘 🏠 (⭐ 11, 🍴 3) - This is an experimental project to integrate Playwright with MCP. My plan is to conduct in-depth research, understand the intricacies of the integration, and review the best articles on the web to create the optimal version of a project using both technologies.
typescriptmcpwebnpm install JoanEsquivel/playwright-mcp-server - unleash-mcp 📘 🏠 (⭐ 11, 🍴 1) - A Model Context Protocol (MCP) server implementation that integrates with Unleash Feature Toggle system.
typescriptmcpserverhttpllmnpm install cuongtl1992/unleash-mcp - vision-agent-mcp 📘 🏠 (⭐ 11, 🍴 4, 🐛 2) - MCP Server for Vision Agent Tools
typescriptmcpserverhttpainpm install landing-ai/vision-agent-mcp - dynamodb-mcp-server 📜 🏠 (⭐ 11, 🍴 8, 🐛 6) - Model Context Protocol server for managing Amazon DynamoDB resources
javascriptservernpm install imankamyabi/dynamodb-mcp-server - emcp 📘 🏠 (⭐ 11, 🍴 2) - A framework for building simple MCP servers with custom middleware
typescriptmcpmodel-context-protocolservernpm install joeymeere/emcp - mcp-perplexity-server 📜 🏠 📇 (⭐ 11, 🍴 4) - A Model Context Protocol (MCP) server for intelligent code analysis and debugging using Perplexity AI’s API, seamlessly integrated with the Claude desktop client.
javascriptmcpmcp-serverperplexityperplexity-mcp-servernpm install PoliTwit1984/mcp-perplexity-server - notionMCP 📜 🏠 (⭐ 11, 🍴 6, 🐛 2) - Node based Notion MCP server
javascriptmcpservernodenpm install Sjotie/notionMCP - oorlogsbronnen-mcp 📘 🏠 📇 (⭐ 11, 🍴 4, 🐛 2) - MCP server for accessing Dutch World War II archives through the Oorlogsbronnen API. Provides structured access to historical records, photographs, and documents from 1940-1945 Netherlands.
typescriptmcpserverapihttpnpm install r-huijts/oorlogsbronnen-mcp - prompt-engineer-mcp-server 📜 🏠 (⭐ 11, 🍴 5, 🐛 3) - Write 10x better prompts using Prompt Engineer MCP server.
javascriptcursor-aimodel-context-protocolsmitherymcpnpm install hireshBrem/prompt-engineer-mcp-server - riza-mcp 📜 🏠 (⭐ 11, 🍴 6, 🐛 3) - Node.js-based
javascripthttpllmgitgithubnpm install riza-io/riza-mcp - ultimate-android-mcp 🐍 🏠 (⭐ 11) - Feature rich Model Context Protocol (MCP) Server to let LLMs automate connected Android devices/emulators.
httpllmgitgithubpythonpip install git+https://github.com/oddlyspaced/ultimate-android-mcp - unichat-ts-mcp-server 📘 🏠 (⭐ 11, 🍴 6, 🐛 1) - TypeScript-based
typescriptnpm install amidabuddha/unichat-ts-mcp-server - unstuckmcp 📘 🏠 (⭐ 11, 🍴 1) - MCP Server to ask humans for help
typescriptmcpservernpm install dtdannen/unstuckmcp - zip-mcp 📘 🏠 (⭐ 11, 🍴 2, 🐛 3) - An MCP tool that provides AI with the ability to compress and decompress local files.
typescriptclaudecompressioncursorlocalnpm install 7gugu/zip-mcp - headless-editor-mcp 📘 🏠 (⭐ 11, 🍴 3) - Headless Editor MCP Server for intelligent code editing
typescriptmcpservernpm install oakenai/headless-editor-mcp - box-mcp-server 📜 🏠 (⭐ 10, 🍴 9, 🐛 2) - A Box model context protocol server to search, read and access files
javascriptserverfilehttpgitnpm install hmk/box-mcp-server - cairo-coder-mcp 📜 🏠 (⭐ 10, 🍴 4, 🐛 4) - Node.js-based
javascriptnpm install kasarlabs/cairo-coder-mcp - dalle-mcp 📘 🏠 (⭐ 10, 🍴 8, 🐛 3) - Uses DALL-E to generate/edit images, an MCP (Model Context Protocol) server
typescriptmcpservernpm install Garoth/dalle-mcp - deep-research-mcp 📜 🏠 (⭐ 10, 🍴 2, 🐛 2) - A Model Context Protocol (MCP) compliant server designed for comprehensive web research. It uses Tavily's Search and Crawl APIs to gather detailed information on a given topic, then structures this data in a format perfect for LLMs to create high-quality markdown documents.
javascriptagentagentic-aiai-researchaiagentnpm install ali-kh7/deep-research-mcp - eth-mcp 📜 🏠 (⭐ 10, 🍴 7, 🐛 2) - an MCP for querying the EVM
javascriptmcpnpm install 0xKoda/eth-mcp - freepik-mcp 📜 🏠 📇 (⭐ 10, 🍴 2) - MCP server for interacting with Freepik's API, including stock photos and Mystic AI image generation
javascriptmcpserverapiainpm install MCERQUA/freepik-mcp - hello-world-mcp-server 📘 🏠 (⭐ 10, 🍴 3) - Demostrate simple mcp server with typescript.
typescriptmcpserverjavascriptnpm install jageenshukla/hello-world-mcp-server - marimo-docs-mcp 📜 🏠 (⭐ 10, 🍴 2) - A Model Context Protocol (MCP) server that provides programmatic access to the Marimo Documentation.
javascriptmcpserverdocumentationnpm install StevenBtw/marimo-docs-mcp - mcp-apple-notes 📘 🏠 (⭐ 10, 🍴 6) - MCP server for apple notes
typescriptai-notesapple-notesclaudeclaude-desktopnpm install Siddhant-K-code/mcp-apple-notes - mcp-dingding-bot 📘 🏠 (⭐ 10, 🍴 3, 🐛 1) - MCP Server for send text/markdown message via dingding (aka dingtalk) group custom robot
typescriptdingding-robotdingtalkdingtalk-robotmcpnpm install Shawyeok/mcp-dingding-bot - mcp-documentation-server 📘 🏠 (⭐ 10, 🍴 2, 🐛 2) - MCP Documentation Server with AI Learning Capabilities
typescriptmcpserveraidocumentationnpm install mahawi1992/mcp-documentation-server - mcp-server-ftp 📜 🏠 (⭐ 10, 🍴 7) - Model Context Protocol server for FTP access
javascriptservernpm install alxspiker/mcp-server-ftp - mcp-youtube-music 📘 🏠 (⭐ 10, 🍴 2, 🐛 2) - 🎶 A simple MCP Server that search & plays youtube music tracks
typescriptmcpservernpm install instructa/mcp-youtube-music - mobsf-mcp-server 📘 🏠 📇 (⭐ 10, 🍴 3, 🐛 1) - This MCP server uses mobsf api's to scan and analyze the apk and ipa files.
typescriptmcpserverapihttpnpm install pullkitsan/mobsf-mcp-server - openfga-mcp 🐘 🏠 (⭐ 10, 🍴 3, 🐛 1) - Model Context Protocol server enabling querying and management of OpenFGA and Auth0 FGA authorization stores for automation, intelligent tooling, and natural language.
phpauthorizationautomationgenerative-aimcpgit clone https://github.com/evansims/openfga-mcp - openrouter-mcp-multimodal 📘 🏠 (⭐ 10, 🍴 2, 🐛 2) - MCP server for OpenRouter providing text chat and image analysis tools
typescriptmcpservernpm install stabgan/openrouter-mcp-multimodal - pentest-mcp 📘 🏠 (⭐ 10, 🍴 2) - NOT for educational purposes: An MCP server for professional penetration testers including nmap, go/dirbuster, nikto, JtR, wordlist building, and more.
typescriptcybersecuritydirbustergobusterjohn-the-rippernpm install Karthikathangarasu/pentest-mcp - RestCsvMcpServer 📘 🏠 (⭐ 10, 🍴 3, 🐛 3) - MCP Server for RestCSV, Generated using MCPGen
typescriptmcpserverrestfilenpm install JordanDalton/RestCsvMcpServer - Simple-Memory-Extension-MCP-Server 📘 🏠 (⭐ 10, 🍴 2, 🐛 4) - An MCP server to extend the context of agents. Useful when coding big features or vibe coding and need to store/recall progress, key moments or changes or anything worth remembering. Simply ask the agent to store memories and recall whenever you want.
typescriptmcpservernpm install gmacev/Simple-Memory-Extension-MCP-Server - sms-mcp-server 📜 🏠 (⭐ 10, 🍴 7, 🐛 2) - A Model Context Protocol (MCP) server that enables Claude and other AI assistants to send SMS messages using Twilio.
javascriptmcpserverainpm install YiyangLi/sms-mcp-server - telegram-notification-mcp 📘 🏠 (⭐ 10, 🍴 2) - Simple MCP server to send you notifications on telegram
typescriptclaude-codecloudflare-agentsmcptelegramnpm install kstonekuan/telegram-notification-mcp - ynab-mcp 📜 🏠 (⭐ 10, 🍴 2, 🐛 3) - YNAB Model Context Protocol (MCP) server for Claude Code integration
javascriptmcpservernpm install mattweg/ynab-mcp - vector_mcp 💎 🏠 (⭐ 10) - A server implementation for the Model Context Protocol (MCP) in Ruby.
rubymcpmcp-sdkmcp-servermcp-serversgit clone https://github.com/sergiobayona/VectorMCP - cloudflare-browser-rendering-mcp 📘 🏠 (⭐ 10, 🍴 5, 🐛 2) - This MCP server provides tools for interacting with Cloudflare Browser Rendering, allowing you to fetch and process web content for use as context in LLMs directly from Cline or Claude Desktop.
typescriptmcpserverwebllmnpm install amotivv/cloudflare-browser-rendering-mcp - mcp-server 📘 🏠 📇 (⭐ 10, 🍴 6, 🐛 1) - MCP Server for Windsurf
typescriptmcpserveraijavascriptnpm install rad-security/mcp-server - mcp-server-dify 📜 🏠 (⭐ 10, 🍴 5, 🐛 2) - Sample MCP Server for Dify AI
javascriptmcpserverainpm install yuru-sha/mcp-server-dify - anitabi-mcp-server 📘 🏠 (⭐ 9, 🍴 2) - anitabi 巡礼地图的 MCP Server
typescriptmcpservernpm install QiYuOr2/anitabi-mcp-server - claude-mcp 📜 🏠 (⭐ 9, 🐛 2) - An MCP server that allows AI tools to interact with Claude Code programmatically with session continuity and async execution support.
javascriptmcpserveraitypescriptnpm install ebeloded/claude-mcp - DMontgomery40_mcp-3D-printer-server 📘 🏠 (⭐ 9, 🍴 2) - Mirror of https://github.com/DMontgomery40/mcp-3D-printer-server
typescriptmcpserverhttpgonpm install MCP-Mirror/DMontgomery40_mcp-3D-printer-server - evm-mcp-tools 📜 🏠 (⭐ 9, 🍴 4, 🐛 3) - Ethereum Tools for Claude - A comprehensive blockchain analysis toolkit that enables Claude AI to audit smart contracts, analyze wallets, track profitability, and fetch on-chain data using Model Context Protocol (MCP). Seamlessly integrates blockchain capabilities into Claude for Desktop.
javascriptmcpaimlnpm install 0xGval/evm-mcp-tools - kakao-navigation-mcp-server 📘 🏠 (⭐ 9, 🍴 2, 🐛 1) - Kakao Mobility MCP Server for directions and transit information
typescriptmcpservernpm install CaChiJ/kakao-navigation-mcp-server - lotus-wisdom-mcp 📜 🏠 (⭐ 9, 🍴 2, 🐛 2) - MCP server for structured problem-solving using the Lotus Sutra's wisdom framework. Beautiful visualizations, multiple thinking approaches, compatible with various MCP clients (e.g., Claude Desktop, Cursor, Cherry Studio).
javascriptlotus-sutramcpmcp-servermodelcontextprotocolnpm install linxule/lotus-wisdom-mcp - mcp-excalidraw 📘 🏠 (⭐ 9) - MCP server creating Excalidraw diagrams via Claude Desktop, Cursor, or other hosts with a live web app preview.
typescriptmcpserverwebnpm install al1y/excalidraw-mcp - mcp-odbc-server 📘 🏠 (⭐ 9, 🍴 3, 🐛 2) - Typescript based Model Context Procotol (MCP) Server for Open Database Connectivity (ODBC)
typescriptmcpserverdatabasehttpnpm install OpenLinkSoftware/mcp-odbc-server - mcp-qase 📜 🏠 (⭐ 9, 🍴 7, 🐛 2) - MCP Server for https://qase.io
javascriptmcpserverhttpnpm install rikuson/mcp-qase - mcp-server-miro 📘 🏠 (⭐ 9, 🍴 11) - Model Context Protocol (mcp) server for Miro
typescriptmcpservernpm install LuotoCompany/mcp-server-miro - mcp-servers 📜 🏠 (⭐ 9) - mcp服务聚合 (Node.js-based)
javascriptmcptypescriptserverpythonnpm install mcpchina/mcp-servers - mcp-testing-kit 📘 🏠 (⭐ 9, 🍴 1) - The testing library you need to test your MCP servers
typescriptmcpservertestingnpm install thoughtspot/mcp-therapy - mcp-tts-voicevox 📘 🏠 (⭐ 9, 🍴 3, 🐛 3) - VOICEVOX MCP Server (TypeScript-based)
typescriptmcpmcp-serverservernpm install kajidog/mcp-sound-voicevox - mcpet 📘 🏠 (⭐ 9, 🍴 3, 🐛 2) - This is a TypeScript-based Model Context Protocol (MCP) server that implements a virtual pet simulation system. It demonstrates core MCP concepts by providing tools for pet care and interaction.
typescriptgenerative-aimodelcontextprotocolmcpservernpm install shreyaskarnik/mcpet - meilisearch-ts-mcp 📘 🏠 (⭐ 9, 🍴 6, 🐛 3) - TypeScript-based
typescriptnpm install devlimelabs/meilisearch-ts-mcp - poke-mcp 📘 🏠 📇 (⭐ 9, 🍴 6) - A repo to play around with MCP (Model Context Protocol) and to query the PokeDex API
typescriptmcpapinpm install NaveenBandarage/poke-mcp - searchapi-mcp-server 📘 🏠 📇 (⭐ 9, 🍴 3, 🐛 13) - TypeScript Model Context Protocol (MCP) server boilerplate providing search API tools/resources. Includes CLI support and extensible structure for connecting AI systems (LLMs) to external data sources (Google, Bing, etc.) via SearchAPI.site
typescriptmcpserverapiainpm install mrgoonie/searchapi-mcp-server - productboard-mcp 📘 🏠 📇 (⭐ 9, 🍴 12, 🐛 4) - Integrate the Productboard API into agentic workflows via MCP
typescriptmcpapihttpgitnpm install kenjihikmatullah/productboard-mcp - social-media-mcp 📘 🏠 (⭐ 9, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server that connects to multiple social media platforms
typescriptmcpservernpm install tayler-id/social-media-mcp - task-mcp-server 📜 🏠 (⭐ 9, 🍴 5, 🐛 2) - A MCP Task Server (Node.js-based)
javascriptmcpservernpm install milkosten/task-mcp-server - twitter-X-mcp-server 📜 🏠 (⭐ 9, 🍴 5, 🐛 2) - X Tools for Claude MCP: A lightweight toolkit enabling Claude to search Twitter with natural language and display results based on user intent. Get raw tweet data or AI analysis—your choice. Supports advanced Twitter search operators with filters for users, dates, and engagement metrics. Seamlessly integrates with Claude Desktop via MCP.
javascriptmcptwitteraimlnpm install 0xGval/twitter-X-mcp-server - x-v2-server 📘 🏠 📇 (⭐ 9, 🍴 7, 🐛 2) - An MCP server implementation that provides tools for interacting with the Twitter/X API v2.
typescriptmcpserverapihttpnpm install NexusX-MCP/x-v2-server - mcp-api-expert 📜 🏠 📇 (⭐ 9, 🍴 7, 🐛 1) - MCP server that enables MCP to make REST API calls
javascriptmcpserverapirestnpm install jwaldor/mcp-api-expert - mcp-coingecko-server 📜 🏠 📇 (⭐ 9, 🍴 7, 🐛 5) - An Anthropic MCP server (with OpenAI Function calling compatibility) for the Coingecko Pro API
javascriptmcpserverapiainpm install crazyrabbitLTC/mcp-coingecko-server - spreadsheet-mcp 📘 🏠 📇 (⭐ 9) - A TypeScript-based Model Context Protocol (MCP) server for viewing, filtering, sorting, and updating CSV/XLSX spreadsheet files via LLM or API integration.
typescriptmcpserverapillmnpm install ZephyrDeng/spreadsheet-mcp - mcp-server-reposearch 📘 🏠 (⭐ 9, 🍴 3) - TypeScript-based
typescriptnpm install happyZYM/mcp-server-reposearch - mcp-tavily-search 📜 🏠 📇 (⭐ 9, 🍴 2) - 🔍 Model Context Protocol (MCP) tool for search using the Tavily API
javascriptclaude-desktopclinemcpmodel-context-protocolnpm install spences10/mcp-tavily-search - starknet-mcp 📘 🏠 (⭐ 9, 🍴 3) - Model context protocol server for Starknet RPC
typescriptservernpm install milancermak/starknet-mcp - anthropic-mcp-code-analyzer 📜 🏠 (⭐ 8, 🍴 2) - An MCP server for analyzing open source projects and assisting with codebase integration
javascriptmcpservernpm install kivo360/anthropic-mcp-code-analyzer - google-image-search-mcp 📘 🏠 (⭐ 8, 🍴 2) - An MCP server for Google Image Search integration
typescriptmcpservergonpm install Virul360/google-image-search-mcp - handwriting-ocr-mcp-server 📜 🏠 (⭐ 8, 🍴 3, 🐛 2) - Model Context Protocol (MCP) Server for Handwriting OCR
javascriptmcpservernpm install Handwriting-OCR/handwriting-ocr-mcp-server - linux-command-mcp 📘 🏠 (⭐ 8, 🍴 4) - MCP server and client for running Linux commands
typescriptmcpservernpm install xkiranj/linux-command-mcp - mcp-data-extractor 📜 🏠 (⭐ 8, 🍴 3, 🐛 1) - A model context protocol server to migrate data out of code (ts/js) into config (json)
javascriptdatajsjsonllmnpm install sammcj/mcp-data-extractor - cloudinary-mcp-server 📜 🏠 (⭐ 8, 🍴 8, 🐛 3) - MCP (Model Context Protocol) server for uploading media to Cloudinary using Claude Desktop
javascriptmcpserverhttpainpm install felores/cloudinary-mcp-server - figma-mcp-write-server 📘 🏠 (⭐ 8, 🐛 1) - A Model Context Protocol (MCP) server for writing to Figma files
typescriptmcpservernpm install oO/figma-mcp-write-server - mcp-ethers-server 📘 🏠 (⭐ 8, 🍴 10, 🐛 2) - A full implementation of Ethers as an AI tool for the model context protocol
typescriptainpm install crazyrabbitLTC/mcp-ethers-server - medium-mcp-server 📘 🏠 📇 (⭐ 8, 🍴 3, 🐛 1) - Model Context Protocol (MCP) server for Medium API integration
typescriptmcpserverapinpm install Dishant27/medium-mcp-server - mysql-query-mcp-server 📘 🏠 (⭐ 8, 🍴 3) - MySQL Query MCP server for AI assistants - execute read-only MySQL queries
typescriptmcpserveraimysqlnpm install devakone/mysql-query-mcp-server - neon-mcp 📘 🏠 📇 (⭐ 8, 🍴 4, 🐛 2) - Lightweight MCP server to give your Cursor Agent access to the Neon API
typescriptmcpserverapinpm install zueai/neon-mcp - datagouv-mcp-server 📘 🏠 📇 (⭐ 8, 🍴 2, 🐛 2) - MCP server for interacting with Data.gouv.fr API
typescriptmcpserverapigonpm install csonigo/datagouv-mcp-server - figma-to-vue-mcp 📘 🏠 (⭐ 8) - MCP server that generates Vue components from Figma designs following Hostinger's design system
typescriptmcpservervuenpm install Tomas-Jankauskas/figma-to-vue-mcp - glean-mcp-server 📜 🏠 📇 (⭐ 8, 🍴 5, 🐛 2) - Node.js-based
javascriptapihttpgitgithubnpm install longyi1207/glean-mcp-server - graphql-mcp 📜 🏠 (⭐ 8, 🍴 2, 🐛 7) - MCP server for dynamic graphql
javascriptmcpservergraphqlnpm install ctkadvisors/graphql-mcp - mcp-graphdb 📜 🏠 (⭐ 8, 🍴 7, 🐛 3) - A Model Context Protocol server that provides read only access to graphs in a certain repository in Ontotext GraphDB. This server enables LLMs to execute SPARQL queries.
javascriptserveraillmnpm install keonchennl/mcp-graphdb - patchright-mcp-lite 📘 🏠 (⭐ 8, 🍴 4, 🐛 4) - Patchright (Playwright patch) MCP server for lightweight models
typescriptmcpservernpm install dylangroos/patchright-mcp-lite - mcp-server-mysql 📜 🏠 (⭐ 8, 🍴 1, 🐛 1) - MCP Server for MySQL databases
javascriptmcpserverdatabasemysqlnpm install yuru-sha/mcp-server-mysql - nessus-mcp-server 📘 🏠 (⭐ 8, 🍴 2, 🐛 2) - TypeScript-based
typescriptnpm install Cyreslab-AI/nessus-mcp-server - nexus-mcp-claude-desktop-server 📘 🏠 (⭐ 8, 🍴 4, 🐛 3) - NEXUS MCP- Simple MCP server for Claude Desktop
typescriptmcpservernpm install wesnermichel/nexus-mcp-claude-desktop-server - obsidian-mcp-server 📘 🏠 (⭐ 8) - A MCP Server backend for Obsidian
typescriptmcpservernpm install Minhao-Zhang/obsidian-mcp-server - recraft-mcp-server 📘 🏠 (⭐ 8, 🍴 5, 🐛 1) - MCP Server implementation for recraft.ai using the Model Context Protocol SDK
typescriptmcpserverainpm install BartWaardenburg/recraft-mcp-server - sonic-pi-mcp 📘 🏠 (⭐ 8, 🍴 4, 🐛 5) - Model Context Protocol (MCP) server for controlling Sonic Pi through AI assistants
typescriptmcpserverainpm install abhishekjairath/sonic-pi-mcp - sushimcp 📘 🏠 (⭐ 8, 🍴 3, 🐛 4) - SushiMCP is a dev tools MCP that serves context on a roll.
typescriptllms-fullllms-minillms-txtllmstxtnpm install maverickg59/sushimcp - voyp-mcp 📜 🏠 (⭐ 8, 🍴 5, 🐛 2) - Node.js-based
javascripthttpgitgithubnpm install paulotaylor/voyp-mcp - youtube-watchlater-mcp 📜 🏠 (⭐ 8, 🍴 7, 🐛 2) - MCP server for accessing YouTube Watch Later playlist
javascriptmcpservernpm install rados10/youtube-watchlater-mcp - contentful-delivery-mcp 📘 🏠 📇 (⭐ 8, 🍴 3, 🐛 1) - Contentful MCP Server for Delivery API
typescriptmcpserverapinpm install mshaaban0/contentful-delivery-mcp - tft-mcp-server 📘 🏠 (⭐ 8, 🍴 5, 🐛 2) - TypeScript-based
typescripthttpaigitgithubnpm install GeLi2001/tft-mcp-server - mcp-server-notion 📘 🏠 (⭐ 8, 🍴 5) - A Model Context Protocol server wrapping the official Notion SDK
typescriptservernpm install ramidecodes/mcp-server-notion - autumn-mcp-server 📘 🏠 (⭐ 7, 🍴 3, 🐛 2) - A simple MCP server for https://useautumn.com
typescriptmcpserverhttpnpm install SirTenzin/autumn-mcp-server - audio-transcriber-mcp 📜 🏠 📇 (⭐ 7, 🍴 2) - A MCP server that provides audio transcription capabilities using OpenAI's Whisper API
javascriptmcpserverapiainpm install Ichigo3766/audio-transcriber-mcp - bitbucket-mcp-server 📘 🏠 📇 (⭐ 7, 🍴 4, 🐛 1) - MCP Server for interacting with BitBucket API
typescriptmcpserverapinpm install pdogra1299/bitbucket-mcp-server - coinstats-mcp 📘 🏠 📇 (⭐ 7, 🍴 5, 🐛 2) - TypeScript-based
typescriptapihttpgitgithubnpm install CoinStatsHQ/coinstats-mcp - cosense-mcp-server 📘 🏠 (⭐ 7, 🍴 8, 🐛 11) - A MCP Server for Cosense
javascripttypescriptmcpservernpm install funwarioisii/cosense-mcp-server - cursor-azure-devops-mcp 📘 🏠 (⭐ 7, 🍴 6, 🐛 1) - Azure DevOps Cursor IDE MCP server plugin
typescriptmcpserverazurenpm install maximtitovich/cursor-azure-devops-mcp - lucide-icons-mcp 📘 🏠 (⭐ 7, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server exposing Lucide icons as resources and tools for LLMs and agentic applications. Built with Bun and the MCP TypeScript SDK.
typescriptmcpserverllmnpm install SeeYangZhi/lucide-icons-mcp - mcp-bridge 📘 🏠 (⭐ 7, 🐛 1) - Mcp bridge to convert stdio servers to sse or streamable http
typescriptmcpserverhttpnpm install brrock/mcp-bridge - contextmanager 📘 🏠 (⭐ 7, 🍴 4, 🐛 1) - MCP Servers for persistent context across work sessions using knowledge graphs
typescriptmcpservergit clone https://github.com/tejpalvirk/contextmanager - docs-fetch-mcp 📘 🏠 (⭐ 7, 🍴 4, 🐛 5) - MCP server for fetching web page content with recursive exploration capability
typescriptmcpserverwebnpm install wolfyy970/docs-fetch-mcp - everything-search-server 📜 🏠 (⭐ 7, 🍴 6, 🐛 4) - MCP server for Everything Search integration
javascriptmcpservernpm install Alihkhawaher/everything-search-server - mcp-intercom 📘 🏠 (⭐ 7, 🍴 9, 🐛 5) - MCP server for Intercom chat integration
typescriptmcpservernpm install fabian1710/mcp-intercom - g2n-mcp-gcal-sse 📘 🏠 📇 (⭐ 7, 🍴 6, 🐛 2) - MCP server with SSE for Google Calendar API integration
typescriptmcpserverapigonpm install gabriel-g2n/g2n-mcp-gcal-sse - mcp-kibela-server 📘 🏠 📇 (⭐ 7, 🍴 6, 🐛 1) - MCP server implementation for Kibela API integration
typescriptkibelakibela-web-apimcpmodelcontextprotocolnpm install kiwamizamurai/mcp-kibela-server - mcp-lexware-office 📘 🏠 (⭐ 7, 🍴 4, 🐛 1) - MCP server to interact with Lexware Office
typescriptmcpservernpm install JannikWempe/mcp-lexware-office - mcp-rag-server 📘 🏠 (⭐ 7) - mcp-rag-server is a Model Context Protocol (MCP) server that enables Retrieval Augmented Generation (RAG) capabilities. It empowers Large Language Models (LLMs) to answer questions based on your document content by indexing and retrieving relevant information efficiently.
typescriptmcp-serverragmcpservernpm install kwanLeeFrmVi/mcp-rag-server - mcp-server-smtp 📘 🏠 (⭐ 7, 🍴 10, 🐛 2) - A Model Context Protocol server for SMTP email services
typescriptserverainpm install samihalawa/mcp-server-smtp - mcp-server-for-intercom 📘 🏠 (⭐ 7, 🍴 5, 🐛 1) - TypeScript-based
typescripthttpaigitgithubnpm install raoulbia-ai/mcp-server-for-intercom - mcp-stytch-b2b-okr-manager 📘 🏠 (⭐ 7, 🍴 2) - TypeScript-based
typescriptnpm install stytchauth/mcp-stytch-b2b-okr-manager - mcp-webdav-server 📘 🏠 (⭐ 7, 🍴 6, 🐛 5) - Model Context Protocol (MCP) server that enables CRUD operations on a WebDAV endpoint with basic authentication.
typescriptmcpserverwebauthnpm install LaubPlusCo/mpc-webdav-server - MotionMCP 📘 🏠 (⭐ 7, 🍴 3, 🐛 2) - MCP Server for Use Motion Task Management System
typescriptmcpservernpm install devondragon/MotionMCP - npm-sentinel-mcp 📘 🏠 (⭐ 7, 🍴 3, 🐛 2) - A powerful Model Context Protocol (MCP) server that revolutionizes NPM package analysis through AI.
typescriptmcpmcp-servernpmnpm-packagenpm install Nekzus/mcp-server - robot-mcp 📜 🏠 (⭐ 7, 🍴 1) - mcp server for johnny-five
javascriptmcpservernpm install monteslu/robot-mcp - super-shell-mcp 📜 🏠 (⭐ 7, 🍴 6, 🐛 2) - Super Shell MCP (Node.js-based)
javascriptbashmacmcp-servershellnpm install cfdude/super-shell-mcp - Reactome-MCP-Server 📜 🏠 (⭐ 7, 🍴 2) - Model Context Protocol server for accessing Reactome pathway and systems biology data.
javascriptserverreactnpm install Augmented-Nature/Reactome-MCP-Server - youtube_research_mcp 📜 🏠 (⭐ 7, 🍴 1) - Node.js-based
javascriptnpm install danhilse/youtube_research_mcp - zoom_transcript_mcp 📜 🏠 (⭐ 7, 🍴 5, 🐛 1) - An MCP server for interacting with Zoom Cloud Recording transcripts
javascriptmcpservernpm install forayconsulting/zoom_transcript_mcp - goplus-mcp 📘 🏠 (⭐ 7, 🐛 1) - Web3 Security MCP Server for AI Clients
typescriptmcpserverwebainpm install GoPlusSecurity/goplus-mcp - iodapp 📘 🏠 (⭐ 7, 🍴 1) - discover and install MCP servers
typescriptmcpservergit clone https://github.com/iodmcp/iodapp - mcp-fetch-node 📘 🏠 (⭐ 7, 🍴 1, 🐛 8) - A Model Context Protocol server that provides web content fetching capabilities.
typescriptfetchmcpmcp-serverservernpm install tgambet/mcp-fetch-node - mcp-server-google-analytics 📜 🏠 📇 (⭐ 7, 🍴 2, 🐛 2) - A MCP server for Google Analytics Data API
javascriptmcpserverapigonpm install eno-graph/mcp-server-google-analytics - ResearchMCP 📘 🏠 📇 (⭐ 7, 🍴 1, 🐛 16) - Multi-Search API Aggregator Server built with Deno + Hono
typescriptdenohonomcp-serverservernpm install riii111/ResearchMCP - sentry-mcp-stdio 📘 🏠 (⭐ 7, 🍴 8, 🐛 7) - Model Context Protocol (MCP) server for Sentry
typescripttag-non-productionmcpservernpm install getsentry/sentry-mcp-ts - systemprompt-mcp-reddit 📜 🏠 (⭐ 7, 🍴 5, 🐛 2) - An MCP Reddit server for post management in Reddit
javascriptmcpservernpm install Ejb503/systemprompt-mcp-reddit - tongchenglvxing-mcp-server 📜 🏠 (⭐ 7, 🍴 1, 🐛 1) - 非官方的同程旅行网的火车票MCP Server,目前仅支持火车票车次查询
javascriptmcpservernpm install wuchubuzai2018/tongchenglvxing-mcp-server - wikipedia-mcp-image-crawler 📜 🏠 (⭐ 7, 🍴 1) - A Wikipedia Image Search Tool. Follows Creative Commons Licences for images and uses them in your projects via Claude Desktop/Cline.
javascriptclaude-aiclinemcpmcp-servernpm install dazeb/wikipedia-mcp-image-crawler - mcp-server-playground 📜 🏠 (⭐ 7, 🍴 3) - MCP Server example with TypeScript
javascriptaiworkflowclaude-desktopcursor-idemcpnpm install psaboia/mcp-server-playground - MCPRepository 📘 🏠 (⭐ 7) - Open Source Repository for ModelContextProtocol MCP server
typescriptmcpmcp-servermodelcontextprotocolservernpm install jaimaann/MCPRepository - mongodb-mcp 📜 🏠 (⭐ 7, 🍴 3, 🐛 1) - MongoDB MCP Server (Node.js-based)
javascriptmcp-servermodel-context-protocolmcpservernpm install jonfreeland/mongodb-mcp - adonis-mcp 📘 🏠 (⭐ 6, 🍴 1, 🐛 2) - An AdonisJS package for building remote MCP servers
typescriptadonisjsmcp-servermodelcontextprotocolmcpnpm install 7nohe/adonis-mcp - agentops-mcp 📜 🏠 📇 (⭐ 6, 🍴 2, 🐛 2) - agentops mcp (Node.js-based)
javascriptmcpapihttpainpm install AgentOps-AI/agentops-mcp - code-explainer-mcp 📘 🏠 (⭐ 6, 🍴 3, 🐛 1) - A Cloudflare Worker that serves as an MCP (Model Context Protocol) server for code explanation. It analyzes and explains code with a comprehensive breakdown of structure and functionality.
typescriptmcpserverainpm install BillDuke13/code-explainer-mcp - DART-mcp-server 🐍 🏠 📇 (⭐ 6, 🐛 11) - 한국의 전자공시시스템 API를 활용하는 mcp 서버
javascriptserverpythonmcpapinpm install jmanhype/dart-mcp-server - db-timetable-mcp 📘 🏠 📇 (⭐ 6, 🍴 3, 🐛 5) - Ein Model Context Protocol (MCP) Server für die Deutsche Bahn Timetable API
typescriptmcpserverapinpm install jorekai/db-timetable-mcp - azure-ai-vision-face-mcp-server 📘 🏠 (⭐ 6, 🐛 1) - Hosts the Azure-Ai-Vision-Face Liveness Mcp-Server
typescriptmcpserveraiazurenpm install Azure-Samples/azure-ai-vision-face-mcp-server - discourse-mcp-server 📜 🏠 (⭐ 6, 🍴 3, 🐛 3) - Node.js-based
javascripthttpgitgithubnpm install AshDevFr/discourse-mcp-server - github-kanban-mcp-server 📘 🏠 (⭐ 6, 🍴 6, 🐛 2) - TypeScript-based
typescriptnpm install sunwood-ai-labs/github-kanban-mcp-server - json-mcp 📜 🏠 (⭐ 6, 🍴 2, 🐛 5) - JSON MCP Server (Node.js-based)
javascriptjsonmcpserverfilenpm install VadimNastoyashchy/json-mcp - KoboldCPP-MCP-Server 📜 🏠 (⭐ 6, 🍴 4) - AI to AI comms with koboldcpp from Claude/other MCP compatible apps
javascriptmcpainpm install PhialsBasement/KoboldCPP-MCP-Server - lspace-server 📘 🏠 (⭐ 6, 🍴 2, 🐛 1) - Lspace is an open source mcp server and standalone application that eliminates context-switching friction by letting you capture insights from any AI session and instantly make them available across all your tools - turning scattered conversations into persistent, searchable knowledge.
typescriptmcpserveraihttpnpm install Lspace-io/lspace-server - mcp-flowcore-platform 📘 🏠 (⭐ 6, 🍴 5, 🐛 3) - MCP server for managing and interacting with Flowcore Platform
typescriptflowcoremcpmcp-serverservernpm install flowcore-io/mcp-flowcore-platform - mcp-google-tasks 📜 🏠 (⭐ 6, 🍴 6, 🐛 3) - Node.js server implementing Model Context Protocol (MCP) for Google Tasks
javascriptmcpservernodegonpm install mstfe/mcp-google-tasks - mcp-runner 📘 🏠 (⭐ 6, 🍴 2) - A TypeScript SDK for running MCP (Model Context Protocol) servers with process reuse capabilities
typescriptmcpserverrustnpm install cookiecad/mcp-runner - mcp-server 🐘 🏠 (⭐ 6) - MCP Server to make Coding Assistant able to access errors and performance data directly from your monitoring tool.
phpmcpservermonitoringgit clone https://github.com/inspector-apm/mcp-server - perplexity-sonar-mcp 📜 🏠 📇 (⭐ 6) - MCP server for Perplexity API integration with Claude Desktop and other MCP clients
javascriptmcpserverapinpm install felores/perplexity-sonar-mcp - bazel-mcp-server 📜 🏠 (⭐ 6, 🍴 5, 🐛 5) - MCP server for Bazel
javascriptmcpservernpm install nacgarg/bazel-mcp-server - hubble-ai-mcp 📘 🏠 (⭐ 6, 🍴 4, 🐛 3) - Hubble-ai mcp server
typescriptmcpserverainpm install HubbleVision/hubble-ai-mcp - inoyu-mcp-unomi-server 📜 🏠 (⭐ 6, 🍴 9, 🐛 5) - An implementation of Anthropic's Model Context Protocol for the Apache Unomi CDP
javascriptfilehttpgitgithubnpm install sergehuber/inoyu-mcp-unomi-server - mcp-outlook 📘 🏠 📇 (⭐ 6, 🍴 2) - An MCP Server for Microsoft Outlook using GraphAPI
typescriptmcpserverapinpm install kacase/mcp-outlook - PhialsBasement_Pagespeed-MCP-Server 📜 🏠 (⭐ 6, 🍴 1) - Mirror of https://github.com/PhialsBasement/Pagespeed-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/PhialsBasement_Pagespeed-MCP-Server - pinax-mcp 📜 🏠 (⭐ 6, 🍴 2) - An MCP Client for connecting to MCP Server‐compatible services at https://thegraph.market.
javascriptmcpserverhttpnpm install pinax-network/pinax-mcp - polygon-mcp 📘 🏠 (⭐ 6, 🍴 6, 🐛 3) - TypeScript-based
typescriptnpm install Dablclub/polygon-mcp - qrcode-mcp 📘 🏠 (⭐ 6, 🍴 5, 🐛 2) - A Model Context Protocol (MCP) server for generating simple QR codes. Support custom QR code styles.
typescriptmcpservernpm install 1595901624/qrcode-mcp - schemaflow-mcp-server 📜 🏠 (⭐ 6, 🍴 3) - SchemaFlow MCP Server
javascriptmcpserverdatabasehttpnpm install CryptoRadi/schemaflow-mcp-server - stdout-mcp-server 📘 🏠 (⭐ 6, 🍴 5, 🐛 5) - An MCP server that any process can pipe stdout logs to including console logs from nodejs programs
typescriptmcpservernodenpm install amitdeshmukh/stdout-mcp-server - Windows-Command-Line-MCP-Server 📘 🏠 (⭐ 6, 🍴 6, 🐛 1) - This server creates a secure bridge between Claude and your computer's command-line functionality.
typescriptservernpm install alxspiker/Windows-Command-Line-MCP-Server - youtube-mcp-server 📜 🏠 📇 (⭐ 6) - Youtube mcp server (Node.js-based)
javascriptmcpapiservernpm install Nocodeboy/youtube-mcp-server - mcp-server-libsql 📘 🏠 (⭐ 6, 🍴 2) - Model Context Protocol server for libsql
typescriptservernpm install nicholasq/mcp-server-libsql - motion-mcp-server 📘 🏠 (⭐ 6, 🐛 5) - MCP Server for Motion Task Scheduling and Project Management App
typescriptmcpservernpm install christopher-czaban/motion-mcp-server - OpenTargets-MCP-Server 📜 🏠 (⭐ 6, 🍴 4, 🐛 1) - Unofficial Model Context Protocol server for accessing Open Targets platform data for gene-drug-disease associations research.
javascriptservernpm install Augmented-Nature/Augmented-Nature-OpenTargets-MCP-Server - nest-mcp-sse 📘 🏠 (⭐ 6, 🍴 1, 🐛 1) - 基于nest快速开发sse mcp server
typescriptmcpservernpm install HxinY499/nest-mcp-sse - Pagespeed-MCP-Server 📜 🏠 (⭐ 6, 🍴 7, 🐛 2) - Pull pagespeed data using this MCP server.
javascriptmcpservernpm install PhialsBasement/Pagespeed-MCP-Server - public-apis-mcp 📘 🏠 📇 (⭐ 6) - 让AI帮你挑选 Public APIs for free
typescriptmcpapiaipythonnpm install worryzyy/public-apis-mcp - search-stock-news-mcp 📘 🏠 📇 (⭐ 6, 🍴 4, 🐛 4) - Search Stock News MCP offers real-time stock news search with customizable filters via Tavily API, using type-safe operations and the Model Context Protocol (MCP).
typescriptmcpmcp-serverstockstock-newsnpm install Cognitive-Stack/search-stock-news-mcp - ts-mcp 📘 🏠 (⭐ 6, 🍴 2) - Super simple TanStack Start MCP server
typescriptmcpservernpm install jherr/ts-mcp - Youtube-Vision-MCP 📜 🏠 📇 (⭐ 6, 🍴 1, 🐛 2) - MCP (Model Context Protocol) server that utilizes the Google Gemini Vision API to interact with YouTube videos.
javascriptmcpserverapigonpm install minbang930/Youtube-Vision-MCP - mcp-memory-bank 📘 🏠 (⭐ 6, 🍴 1) - A powerful, production-ready context management system for Large Language Models (LLMs). Built with ChromaDB and modern embedding technologies, it provides persistent, project-specific memory capabilities that enhance your AI's understanding and response quality.
typescriptcontextmcpmcp-servermodelcontextprotocolnpm install bsmi021/mcp-memory-bank - mpc-tally-api-server 📘 🏠 📇 (⭐ 6, 🍴 9, 🐛 5) - A Model Context Protocol (MCP) server that enables AI agents to interact with the Tally API, providing access to DAO governance data, proposals, and metadata. Built with TypeScript and GraphQL, it offers a secure and efficient way to fetch and sort DAO information through standardized MCP functions.
typescriptmcpserverapiainpm install crazyrabbitLTC/mpc-tally-api-server - Openwebui-server 📜 🏠 (⭐ 6, 🍴 1, 🐛 1) - This server provides Model Context Protocol (MCP) services for OpenWebUI, enabling knowledge base integration and retrieval.
javascriptmcpserverwebnpm install Welkon/Openwebui-server - recall-mcp 📘 🏠 (⭐ 6, 🍴 3, 🐛 1) - A simple MCP server that exposes basic Recall functionality including listing buckets, getting account balances, creating objects, and more
typescriptmcpservernpm install recallnet/recall-mcp - stefans71_wordpress-mcp-server 📜 🏠 (⭐ 6, 🍴 5) - Mirror of https://github.com/stefans71/wordpress-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/stefans71_wordpress-mcp-server - mcp-server-v2ex 📘 🏠 (⭐ 6, 🍴 3, 🐛 2) - simple learn mcp server build with ts
typescriptmcpservernpm install funnythingfunnylove/mcp-server-v2ex - PayPal-MCP 📘 🏠 📇 (⭐ 6, 🍴 2, 🐛 1) - Serverless PayPal MCP integration on Cloudflare Workers. Handles API requests, auth, and secure payments with low latency via Cloudflare's edge. Ideal for webhooks, payment verification, and real-time transactions. Scalable, lightweight, and secure.
typescriptmcpserverapiwebnpm install arbuthnot-eth/PayPal-MCP - tailorkit-mcp 📘 🏠 (⭐ 6, 🍴 3, 🐛 1) - TailorKit MCP is a powerful product customization framework for e-commerce that enables merchants to create interactive personalization experiences. Features template management, layer control, and Shopify integration for offering customizable products with minimal development effort.
typescriptmcpmcp-serverainpm install sellersmith/tailorkit-mcp - whatsapp-mcp2 📘 🏠 (⭐ 6, 🍴 1, 🐛 3) - TypeScript-based
typescriptnpm install fyimail/whatsapp-mcp2 - aitable-mcp-server 📘 🏠 (⭐ 5, 🍴 1) - AITable.ai Model Context Protocol Server enables AI agents to connect and work with AITable datasheets.
typescriptserverainpm install apitable/aitable-mcp-server - browse-together-mcp 📘 🏠 (⭐ 5, 🍴 1, 🐛 1) - Co-browse with your AI as you edit code. A headed Playwright-controlled browser with accompanying MCP server.
typescriptmcpserverainpm install canadaduane/browse-together-mcp - 302_browser_use_mcp 📜 🏠 (⭐ 5, 🍴 6, 🐛 1) - 302 BrowserUse MCP (Node.js-based)
javascriptmcpnpm install 302ai/302_browser_use_mcp - adwords-mcp 📘 🏠 (⭐ 5, 🍴 4, 🐛 4) - A cringe-worthy MCP server that serves ads to developers in Cursor, Claude, and other clients
typescriptmcpservernpm install gregce/adwords-mcp - ai-meta-mcp-server 📜 🏠 (⭐ 5, 🍴 3) - A dynamic MCP server that allows AI to create and execute custom tools through a meta-function architecture
javascriptmcpserverainpm install alxspiker/ai-meta-mcp-server - apimatic-validator-mcp 📘 🏠 📇 (⭐ 5, 🍴 13, 🐛 2) - APIMatic Validator MCP Server for validating OpenAPI specs via APIMatic's API with MCP
typescriptmcpserverapifilenpm install apimatic/apimatic-validator-mcp - f1-mcp-server 📜 🏠 (⭐ 5, 🍴 3, 🐛 3) - Node.js-based
javascriptnpm install rakeshgangwar/f1-mcp-server - arxiv-search-MCP-Server 📜 🏠 (⭐ 5) - A Model Context Protocol server for searching academic papers on arXiv.
javascriptservernpm install win4r/arxiv-search-MCP-Server - chainlink-feeds-mcp 📜 🏠 (⭐ 5, 🍴 4, 🐛 2) - An MCP server that provides real-time access to Chainlink's decentralized on-chain price feeds.
javascriptmcpserveraihttpnpm install kukapay/chainlink-feeds-mcp - firebird-mcp-server 📘 🏠 (⭐ 5) - A Model Context Protocol (MCP) server for Firebird databases. Enables read-only SQL queries and schema exploration.
typescriptmcpserverdatabasenpm install stagsz/firebird-mcp-server - atomic-writer-mcp 📘 🏠 (⭐ 5) - 🔒 Atomic Writer MCP Server: A secure file operation service that prevents data loss through atomic transactions. Built for AI integrations, collaborative editing, and critical data management.
typescriptmcpserverainpm install vanzan01/atomic-writer-mcp - Clojars-MCP-Server 📜 🏠 (⭐ 5, 🍴 6, 🐛 2) - A Model Context Protocol (MCP) server that provides tools for fetching dependency information from Clojars, the Clojure community's artifact repository.
javascriptmcpserverhttpgitnpm install Bigsy/Clojars-MCP-Server - commercecloud-mcp-server 📘 🏠 (⭐ 5, 🍴 1) - 🤖 An MCP server that helps connect your AI applications with your Salesforce Commerce Cloud instance
typescriptmcpserverainpm install BrinsilElias/commercecloud-mcp-server - Frontapp-MCP 📘 🏠 (⭐ 5, 🍴 3, 🐛 1) - MCP server and client for Frontapp
typescriptmcpservernpm install zqushair/Frontapp-MCP - google-cloud-healthcare-api-mcp 📜 🏠 📇 (⭐ 5, 🍴 5) - MCP Server for Google Cloud Healthcare API
javascriptmcpserverapigonpm install Kartha-AI/google-cloud-healthcare-api-mcp - google-forms-mcp 📜 🏠 (⭐ 5, 🍴 3, 🐛 1) - Google Forms MCP Server
javascriptmcpservergonpm install matteoantoci/google-forms-mcp - google-research-mcp 📘 🏠 📇 (⭐ 5, 🍴 1, 🐛 30) - Power your AI agents with Google Search–enhanced research via an open-source MCP server. Includes tools for Google Search, YouTube/web scraping, LLM-driven synthesis, persistent caching, and dual transport (STDIO + HTTP SSE) for efficient, flexible integration.
typescriptmcpserverapiwebnpm install zoharbabin/google-research-mcp - hamibot-mcp-server 📜 🏠 📇 (⭐ 5, 🐛 1) - 用于与 Hamibot API 进行交互。它提供了一系列工具来管理和控制 Hamibot 设备及脚本
apihttpgitgithubjavascriptnpm install hamibot/hamibot-mcp-server - heremaps-mcp-server 📜 🏠 📇 (⭐ 5) - LLM MCP server using HereMaps API
javascriptmcpserverapillmnpm install limingchina/heremaps-mcp-server - laravel-artisan-mcp 🐍 🏠 (⭐ 5, 🍴 1, 🐛 2) - A Model Context Protocol (MCP) server that enables secure execution of Laravel Artisan commands through Claude and other MCP clients.
pythonartisanclaudelaravelmcppip install git+https://github.com/diggy/laravel-artisan-mcp - mateusribeirocampos_npm-mcp-server 📘 🏠 (⭐ 5, 🍴 2) - Mirror of https://github.com/mateusribeirocampos/npm-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/mateusribeirocampos_npm-mcp-server - mcp-agent-server 📘 🏠 (⭐ 5) - An innovative Model Context Protocol hub that seamlessly connects your client with intelligent agents, enabling powerful cross-platform communication across multiple MCP ecosystems
typescriptaidockermcpmlnpm install LeadBroaf/mcp-agent-server - mcp-figma-augmentcode-integration 📜 🏠 (⭐ 5, 🍴 2) - Example integration of a Figma MCP server with Augment Code, using Node.js and figma-js.
javascriptmcpservernodenpm install shedytee/mcp-figma-augmentcode-integration - mcp-find 📜 🏠 (⭐ 5) - Search for MCP Servers from the command line
javascriptmcp-servermodel-context-protocolmcpservernpm install mcprepository/mcp-find - mcp-server-lottiefiles 📘 🏠 (⭐ 5, 🍴 3, 🐛 3) - TypeScript-based
typescriptfilehttpgitgithubnpm install junmer/mcp-server-lottiefiles - mcp-salesforce-example 📜 🏠 (⭐ 5, 🍴 5, 🐛 2) - Node.js-based
javascripthttpgitgithubnpm install lciesielski/mcp-salesforce-example - mcp-server-unity 📜 🏠 (⭐ 5, 🍴 1) - Model Context Protocol (MCP) server for Unity - enables Claude to interact with Unity projects
javascriptmcpservernpm install zabaglione/mcp-server-unity - mcp-servers 📘 🏠 (⭐ 5, 🍴 1) - A monorepo containing Model Context Protocol servers for various use cases.
typescriptserverainpm install madisonbullard/shortcut-mcp-server - mcp-servers 📘 🏠 (⭐ 5, 🍴 1) - A monorepo containing Model Context Protocol servers for various use cases.
typescriptserverainpm install madisonbullard/mcp-servers - mcp-sumologic 📘 🏠 (⭐ 5, 🍴 5, 🐛 3) - MCP server for Sumologic
typescriptmcpservernpm install samwang0723/mcp-sumologic - mcp-ts-starter 📜 🏠 (⭐ 5, 🍴 2) - Typescript starter for MCP server with resource, prompt and tool
javascriptmcpservernpm install madhukarkumar/mcp-ts-starter - mcp-xrpl 📘 🏠 (⭐ 5, 🍴 3, 🐛 1) - TypeScript-based
typescripthttpgitgithubmonitoringnpm install RomThpt/mcp-xrpl - obsidian-github-mcp 📘 🏠 (⭐ 5, 🍴 3, 🐛 2) - MCP Server to search individual private Github Repositories
typescriptmcpservernpm install Hint-Services/mcp-private-github-search - Ollama-MCP-Bridge-WebUI 📘 🏠 (⭐ 5, 🍴 1) - A web interface connecting local Ollama LLMs to Model Context Protocol (MCP) servers. Enables open-source models to use file operations, web search, and reasoning tools similar to commercial AI assistants - all running privately on your own hardware.
typescriptmcpserverwebainpm install Rkm1999/Ollama-MCP-Bridge-WebUI - pangea-mcp-proxy 📜 🏠 (⭐ 5, 🍴 3, 🐛 2) - Protect any MCP server from malicious entities and confidential PII.
javascriptmcpservernpm install pangeacyber/pangea-mcp-proxy - schwab-mcp 📘 🏠 (⭐ 5, 🍴 6) - Schwab MCP server that enables AI assistants like Claude to retrieve and interact with your Schwab accounts and Schwab market data.
typescriptmcpserverainpm install sudowealth/schwab-mcp - sequa-mcp 📘 🏠 (⭐ 5, 🍴 3, 🐛 1) - TypeScript-based
typescripthttpaigitgithubnpm install sequa-ai/sequa-mcp - solana-mcp-explorer 📜 🏠 (⭐ 5, 🍴 2) - Explore all of the MCP Servers in the Solana ecosystem!
javascriptmcpservernpm install notorious-d-e-v/solana-mcp-explorer - qlik-mcp 📘 🏠 📇 (⭐ 5, 🍴 5) - An MCP server to run qlik
typescriptmcpserverapiauthnpm install jwaxman19/qlik-mcp - wisdomforge 📘 🏠 (⭐ 5, 🍴 2) - A powerful knowledge management system that forges wisdom from experiences, insights, and best practices. Built with Qdrant vector database for efficient knowledge storage and retrieval.
typescriptmcpmcp-servermodelcontextprotocolqdrantgit clone https://github.com/hadv/vito-mcp - js-mcp-server 📘 🏠 📇 (⭐ 5, 🍴 2) - Javascript version of the Linkup MCP server.
typescriptmcpserverapiwebnpm install LinkupPlatform/js-mcp-server - mcp-nodejs-server 📘 🏠 📇 (⭐ 5, 🍴 5, 🐛 5) - Integration layer between MCP Clients and Gentoro MCP Server implementation
typescriptmcpserverapihttpnpm install gentoro-GT/mcp-nodejs-server - genai-mcp 📘 🏠 (⭐ 5, 🍴 1) - Demo of GenAIScript's MCP Server capabilities
typescriptgenaiscriptmcpmcp-serverservernpm install rajyraman/genai-mcp - mcp-fortunecookie 📘 🏠 (⭐ 5, 🍴 1) - 🥠 Fortune Cookie MCP
typescriptmcpnpm install maxbogo/mcp-fortunecookie - mcp-postgres-server 📜 🏠 (⭐ 5, 🍴 1, 🐛 1) - MCP PostgreSQL Server
javascriptmcpserverpostgresnpm install antonorlov/mcp-postgres-server - reviewwebsite-mcp-server 📘 🏠 📇 (⭐ 5, 🍴 1, 🐛 11) - TypeScript Model Context Protocol (MCP) server for ReviewWebsite. Includes CLI support and extensible structure for connecting AI systems (LLMs) to ReviewWeb.site API
typescriptmcpserverapiwebnpm install mrgoonie/reviewwebsite-mcp-server - stock-market-server 📜 🏠 (⭐ 5, 🍴 5, 🐛 3) - Stock Market MCP Server
javascriptmcpservernpm install MCP-100/stock-market-server - typescript-mcp-demo 📘 🏠 (⭐ 5, 🍴 1, 🐛 1) - A typescript example for web app as the host connecting node mcp server
typescriptmcpserverwebnodenpm install jiangyan/typescript-mcp-demo - wopal-cn_mcp-hotnews-server 📜 🏠 (⭐ 5, 🍴 2, 🐛 2) - Mirror of https://github.com/wopal-cn/mcp-hotnews-server
javascriptmcpserverhttpnpm install MCP-Mirror/wopal-cn_mcp-hotnews-server - x-mcp-server 📘 🏠 (⭐ 5, 🍴 1) - This is an MCP server for the X Platform
typescriptmcpservernpm install siddheshutd/x-mcp-server - zabbix-ai-mcp 📜 🏠 (⭐ 5) - Node.js-based
javascriptnpm install kairogyn/zabbix-ai-mcp - jsr-mcp 📘 🏠 (⭐ 5) - A Model Context Protocol (MCP) server that provides access to JSR (JavaScript Registry) module documentation.
typescriptmcpserverdocumentationnpm install sigmaSd/jsr-mcp - mcp-azure-tablestorage 📜 🏠 (⭐ 5, 🍴 6, 🐛 1) - A MCP Server to query a Azure Table Storage for local development
javascriptmcpmcp-serverserverazurenpm install dkmaker/mcp-azure-tablestorage - mcp-flux-schnell 📜 🏠 📇 (⭐ 5, 🍴 3, 🐛 2) - mcp server for cloudflare flux schnell worker api.
javascriptcloudflarecursorfluxfluxschnellnpm install bytefer/mcp-flux-schnell - mcp-linear-server 📘 🏠 (⭐ 5, 🐛 2) - A repository for MCP server to connect to Linear
typescriptmcpservernpm install skspade/mcp-linear-server - mcp-marketplace 📘 🏠 (⭐ 5, 🍴 2) - TypeScript-based
typescriptnpm install TP-Lab/mcp-marketplace - mcp-server-github-repo 📜 🏠 (⭐ 5, 🍴 3, 🐛 2) - MCP server for interacting with a github repo
javascriptmcpservernpm install loglmhq/mcp-server-github-repo - mcp-tts-say 📘 🏠 (⭐ 5, 🍴 2) - MCP Server Tool for Text To Speech
typescriptmcpservernpm install hirokidaichi/mcp-tts-say - open-digger-mcp-server 📜 🏠 (⭐ 5, 🍴 2) - MCP server of OpenDigger
javascriptmcpserverhttpgitnpm install X-lab2017/open-digger-mcp-server - sns-mcp-server 📘 🏠 (⭐ 5, 🍴 1, 🐛 1) - mcp server for sns (TypeScript-based)
typescriptmcpservernpm install baolongt/sns-mcp-server - super-win-cli-mcp-server 📘 🏠 (⭐ 5, 🍴 4, 🐛 4) - Enhanced MCP server with unrestricted system access capabilities
typescriptmcpserverrestnpm install delorenj/super-win-cli-mcp-server - ts-mcp-client-server 📘 🏠 (⭐ 5, 🐛 1) - MCP client and server with command line chat interface using Anthropic
typescriptmcpservernpm install oneness/ts-mcp-client-server - exa-mcp-server 🏠 📇 (⭐ 5, 🍴 2) - Claude can perform Web Search | Exa with MCP (Model Context Protocol)
mcpwebapihttpaigit clone https://github.com/theishangoswami/exa-mcp-server - glide-api-mcp-server 📜 🏠 📇 (⭐ 5, 🍴 7, 🐛 5) - Model Context Protocol (MCP) server for @glideapps API
javascriptglidemodel-context-protocolmcpservernpm install knmurphy/glide-api-mcp-server - mcp-remote-server 📘 🏠 (⭐ 5, 🍴 1, 🐛 1) - A declarative, composable model context protocol server that uses a remote config
typescriptservernpm install sirmews/mcp-remote-server - remote-mcp-server-demo 📘 🏠 (⭐ 5) - TypeScript-based
typescriptnpm install elithrar/remote-mcp-server-demo - aegntic-MCP 📘 🏠 (⭐ 4, 🍴 1, 🐛 1) - AegnticMCP automates the creation and management of MCP servers, ensuring they are stable, adaptable, and intelligent.
typescriptmcpservernpm install aegntic/aegnticMCP - adspirer-mcp-server 📜 🏠 (⭐ 4, 🍴 3, 🐛 5) - Model context Protocol (MCP) server for Adspirer
javascriptmcpservernpm install amekala/adspirer-mcp-server - alpha-ventage-mcp 📜 🏠 📇 (⭐ 4, 🍴 5, 🐛 1) - A simple MCP server that fetches real-time financial data from Alpha Vantage API. Get instant access to stock prices, crypto rates, and market indicators with easy-to-use commands.
javascriptmcpserverapinpm install deepsuthar496/alpha-ventage-mcp - bridge-rates-mcp 📜 🏠 (⭐ 4, 🍴 3, 🐛 2) - An MCP server that delivers real-time cross-chain bridge rates and optimal transfer routes to onchain AI agents.
javascriptmcpserveraihttpnpm install kukapay/bridge-rates-mcp - claude-chrome-mcp 📜 🏠 (⭐ 4, 🐛 2) - Developer tool suite enabling Claude Desktop, Claude Code, and other MCP hosts like Cursor, to interact with claude.ai in Chrome browsers.
javascriptchrome-extensionclaude-aimcp-servermcpnpm install durapensa/claude-chrome-mcp - fal-image-video-mcp 📜 🏠 (⭐ 4, 🍴 3, 🐛 1) - Instant MCP Server for Claude Desktop to Make Images and Videos using FAL
javascriptfalmcpmcp-servertypescriptnpm install RamboRogers/fal-image-video-mcp - fireflies-mcp 📜 🏠 (⭐ 4, 🍴 8, 🐛 4) - An MCP server for fireflies
javascriptmcpservernpm install Props-Labs/fireflies-mcp - flights-mcp-ts 📘 🏠 📇 (⭐ 4, 🍴 4, 🐛 2) - A TypeScript implementation of a flight & stay search MCP server that uses the Duffel API to search for flights. This MCP server provides tools to search for one-way, round-trip, and multi-city flights.
typescriptmcpserverapinpm install clockworked247/flights-mcp-ts - git-mcp-server 📘 🏠 (⭐ 4, 🍴 1) - MCP server to communicate with github repo without the need to run docker
typescriptmcpserverllmdockernpm install wty0512/git-mcp-server - google-sheets-mcp 📜 🏠 (⭐ 4, 🍴 1) - Google Sheets MCP Server 📊🤖
javascriptmcpservergonpm install D-unn/google-sheets-mcp - hexdocs-mcp 📘 🏠 (⭐ 4, 🍴 1, 🐛 1) - Unofficial, experimental MCP server for HexDocs
typescriptmcpservernpm install v0idpwn/hexdocs-mcp - jira-cli-mcp 📘 🏠 (⭐ 4, 🐛 1) - MCP server that wraps jira-cli to enable AI assistants to interact with Jira
typescriptmcpserverainpm install choplin/jira-cli-mcp - kite-mcp 📘 🏠 📇 (⭐ 4) - A Model Context Protocol (MCP) server for integrating with Zerodha Kite API. This server provides Claude with tools to interact with your Kite trading account. This is an unofficial integration with Zerodha Kite API. Use at your own risk. Always verify trades and orders before execution.
typescriptmcpserverapinpm install codeglyph/kite-mcp - kpu-mcp 📜 🏠 (⭐ 4, 🍴 2) - Node.js-based
javascripthttpgitgithubnpm install data-skunks/kpu-mcp - lerian-mcp-server 📜 🏠 📇 (⭐ 4, 🍴 1, 🐛 6) - A MCP server to support all Lerian's platforms. Enables AI assistants to interact with Midaz's core banking APIs for automated ledger operations, account management, and transaction processing. Features comprehensive API coverage, real-time data access, and robust error handling for building AI-powered intelligent fintech workflows
javascriptmcpserverapiainpm install lerianstudio/midaz-mcp-server - mcp-atlassian 📘 🏠 (⭐ 4, 🍴 5, 🐛 6) - MCP server for Atlassian (Confluence & Jira)
typescriptmcpservernpm install samwang0723/mcp-atlassian - mcp-devin 📜 🏠 (⭐ 4, 🍴 3, 🐛 2) - Node.js-based
javascriptnpm install kazuph/mcp-devin - mcp-idb 📜 🏠 (⭐ 4, 🍴 4, 🐛 2) - MCP server for fb-idb bridge.
javascriptmcpservernpm install noahlozevski/mcp-idb - mcp-installer 📘 🏠 (⭐ 4, 🍴 2) - MCP server that installs MCP Servers
typescriptmcpservernpm install bbangjooo/mcp-finder-mcp-server - mcp-harbor 📘 🏠 (⭐ 4, 🍴 3, 🐛 4) - A mcp server for harbor
typescriptmcpservernpm install nomagicln/mcp-harbor - mcp-obsidian-via-rest 📘 🏠 📇 (⭐ 4, 🐛 7) - MCP Server connected to Obsidian Vault with Local REST API. (re-write it completely with BUN to make it faster and more lightweight)
typescriptmcpmcp-serverobsidianobsidian-mdnpm install OleksandrKucherenko/mcp-obsidian-via-rest - mcp-pg-schema 📜 🏠 (⭐ 4, 🍴 6, 🐛 4) - MCP server for getting schema information from a PostgreSQL database
javascriptmcpserverdatabasepostgresnpm install vinsidious/mcp-pg-schema - MCP-Quickbase 📘 🏠 (⭐ 4, 🍴 3, 🐛 4) - TypeScript-based
typescriptnpm install danielbushman/Quickbase-MCP-connector - mcp-server-nodejs-api-docs 📜 🏠 📇 (⭐ 4, 🍴 1, 🐛 3) - MCP Server for the Node.js API documentation
javascriptmcpserverapinodenpm install snyk-labs/mcp-server-nodejs-api-docs - mcp-ts-simple-template 📘 🏠 (⭐ 4, 🍴 4, 🐛 3) - A lightweight, ready-to-use TypeScript template for building Model Context Protocol (MCP) servers. This template provides the essential scaffolding to create custom AI tools that can be seamlessly integrated with large language models.
typescriptmcpserveraimlnpm install ChenReuven/mcp-ts-simple-template - mcp-tunnel 📜 🏠 (⭐ 4, 🍴 1, 🐛 1) - MCP server for accessing VM command line with web tunneling
javascriptmcpserverwebnpm install leomercier/mcp-tunnel - medium-mcp-api 📜 🏠 📇 (⭐ 4, 🍴 2) - Microservice Communication Protocol (MCP) server for Medium's API to publish content and manage user accounts
javascriptmcpserverapinpm install jignesh88/medium-mcp-api - netlify-mcp 📜 🏠 (⭐ 4, 🍴 4, 🐛 3) - MCP server for Netlify integration - manage Netlify sites through Model Context Protocol
javascriptmcpservernpm install MCERQUA/netlify-mcp - onenote-mcp 📜 🏠 (⭐ 4, 🐛 1) - MCP server for browsing and interacting with OneNote web app using browser-use automation
javascriptmcpserverwebnpm install hwillGIT/onenote-mcp - quip-mcp-server 📜 🏠 (⭐ 4, 🍴 4, 🐛 3) - quip mcp server (Node.js-based)
javascriptmcpservernpm install AvinashBole/quip-mcp-server - resend-mcp 📜 🏠 📇 (⭐ 4, 🍴 5, 🐛 2) - A MCP server for Resend API. Let LLMs compose and send emails for you.
javascriptmcpserverapiainpm install Hawstein/resend-mcp - resumake-mcp 📜 🏠 (⭐ 4, 🍴 2) - MCP server for generating professional LaTeX resumes through Claude Desktop using natural language and resumake.io
javascriptmcpservernpm install AndreaCadonna/resumake-mcp - sentry-selfhosted-mcp 📜 🏠 (⭐ 4, 🍴 3) - An MCP server for self-hosted sentry.
javascriptmcpservernpm install ddfourtwo/sentry-selfhosted-mcp - ufn-mcp-server 📜 🏠 📇 (⭐ 4) - MCP Server for the UniFuncs API
javascriptmcpserverapinpm install UniFuncs/ufn-mcp-server - mcp_ 📘 🏠 (⭐ 4) - MCP Servers, in one place
typescriptmcpservernpm install Eric8900/mcp_ - mcp-imagegen 📘 🏠 (⭐ 4, 🍴 3, 🐛 1) - MCP Server for Generating images
typescriptmcpservernpm install GMKR/mcp-imagegen - MCP-JS-Server-Template 📜 🏠 (⭐ 4, 🍴 1) - Simplified MCP Server Template for Node.js
javascriptmcpservernodenpm install ryaker/MCP-JS-Server-Template - mcp-quanmiao-hotnews 📜 🏠 📇 (⭐ 4, 🍴 3, 🐛 2) - 全妙新闻播报MCP Server 是一个基于阿里云百炼API的新闻聚合服务,专注于实时获取热点新闻资讯。
javascriptmcpmcp-serverserverapinpm install iic-llm-solution/mcp-quanmiao-hotnews - pi-api-mcp-server 📜 🏠 📇 (⭐ 4, 🍴 6, 🐛 4) - MCP (Model Context Protocol) Server for the PI API
javascriptmcpserverapinpm install mingzilla/pi-api-mcp-server - shopify-mcp 📘 🏠 (⭐ 4, 🍴 2) - A Shopify MCP Server
typescriptmcpservernpm install codeyogi911/shopify-mcp - singlestore-mcp-server 📜 🏠 (⭐ 4, 🍴 3) - SingleStore MCP server implemented in TS
javascriptmcpservernpm install madhukarkumar/singlestore-mcp-server - usensedata-mcp-server-query-china-company 📜 🏠 📇 (⭐ 4, 🍴 1, 🐛 1) - 羽山数据API服务现已全面兼容MCP协议,打造数据服务MCP Server。usensedata-mcp-server-query-china-company项目为企业类数据查询服务server,用户可通过简单配置快速通过LLM使用羽山数据企业类数据服务。依赖MCP Typescript SDK,可在支持MCP协议的智能体助手中快速接入。
javascriptmcpserverapillmnpm install usensedata/usensedata-mcp-server-query-china-company - whodis-mcp-server 📘 🏠 (⭐ 4, 🍴 1, 🐛 13) - MCP Server for checking the availability of domain names using WHOIS lookups
typescriptmcpserverainpm install vinsidious/whodis-mcp-server - mcp-github-server-plus 📘 🏠 📇 (⭐ 4, 🍴 7, 🐛 1) - Model Context Protocol server for GitHub API integration
typescriptserverapinpm install PhialsBasement/mcp-github-server-plus - mcp-kroki 📜 🏠 (⭐ 4, 🍴 1) - MCP server to convert a diagram to picture using kroki.io
javascriptmcpservernpm install tkoba1974/mcp-kroki - mcp-ruby 💎 🏠 (⭐ 4, 🍴 1) - The Model Context Protocol is an open standard that enables developers to build secure, two-way connections between their data sources and AI-powered tools. The architecture is straightforward: developers can either expose their data through MCP servers or build AI applications (MCP clients) that connect to these servers.
rubymcpmcp-protocolmcp-rubymcp-servergit clone https://github.com/wilsonsilva/mcp-ruby - mcp-servers-jos 📘 🏠 (⭐ 4, 🍴 2) - MCP servers by JOS, starting from MCP Template https://github.com/josmithiii/mcp-template
typescriptmcpserverhttpnpm install josmithiii/mcp-servers-jos - mcp-terminal-server 📘 🏠 (⭐ 4, 🍴 2, 🐛 1) - Terminal server implementation for Model Context Protocol
typescriptservernpm install RichardTheuws/mcp-terminal-server - openai-image-gen-mcp 📜 🏠 📇 (⭐ 4, 🍴 1) - OpenAI Image Generation MCP that enables server to generate and edit images using OpenAI's gpt-image-1 api modes.
javascriptmcpserverapiainpm install jerryzhao173985/openai-image-gen-mcp - mcp-ruby-skeleton 💎 🏠 (⭐ 4, 🍴 2) - Experimental Ruby implementation of Model Context Protocol (MCP) - A starter server framework for trying out LLM integrations
rubymcpserverllmgit clone https://github.com/bash0C7/mcp-ruby-skeleton - mcp-server-iaptic 📘 🏠 (⭐ 4, 🍴 7, 🐛 3) - Model Context Protocol server for interacting with iaptic
typescriptserverhttpgitgithubnpm install iaptic/mcp-server-iaptic - mcp-telegram 📜 🏠 (⭐ 4, 🍴 2) - MCP Server for Telegram chatbot use.
typescriptmcpserverjavascriptnpm install tacticlaunch/mcp-telegram - mcp-weather 📘 🏠 (⭐ 4, 🍴 1) - mcp demo for https://modelcontextprotocol.io/quickstart/server
typescriptmcpserverhttpnpm install GreatAuk/mcp-weather - mcp-server-taiwan-weather 📘 🏠 📇 (⭐ 4) - 用於取得臺灣中央氣象署 API 資料的 Model Context Protocol (MCP) Server。
typescriptmcpserverapinpm install GoneTone/mcp-server-taiwan-weather - mcp-workers-ai 📜 🏠 (⭐ 4) - MCP servers sdk for Cloudflare Workers
javascriptmcpservernpm install xtuc/mcp-workers-ai - solana-docs-mcp-server 📜 🏠 (⭐ 4, 🍴 5, 🐛 8) - solana docs (Node.js-based)
javascriptmcpmcp-serversolanasolana-documentationnpm install aldrin-labs/solana-docs-mcp-server - starknet-mcp-server 📘 🏠 (⭐ 4, 🍴 4) - MCP server that provides LLM with tools for interacting with Starknet
typescriptagentblockchainmcpmcp-servernpm install mcpdotdirect/starknet-mcp-server - penumbra-mcp 📜 🏠 (⭐ 4, 🍴 6, 🐛 6) - MCP server for interacting with Penumbra blockchain - providing privacy-preserving tools for chain interaction
javascriptmcpserverainpm install bmorphism/penumbra-mcp - workos-mcp 📘 🏠 📇 (⭐ 4, 🍴 3, 🐛 2) - Lightweight MCP server to give your Cursor Agent access to the WorkOS API.
typescriptcursormcpworkosservernpm install zueai/workos-mcp - akirapapa-mcp-notion-server 📘 🏠 (⭐ 4, 🍴 2) - Notion MCPでブロックやトグルなどしようできるようにしたサーバー
typescriptmcpnpm install Akira-Papa/akirapapa-mcp-notion-server - mcp-function-app-tester 📜 🏠 📇 (⭐ 4, 🍴 6, 🐛 1) - A MCP Server to test local development of function app apis
javascriptmcpmcpe-serverserverapinpm install dkmaker/mcp-function-app-tester - analytical-mcp 📘 🏠 (⭐ 3) - Analytical MCP Server: Enhancing AI with Structured Problem-Solving Tools
typescriptmcpserverainpm install quanticsoul4772/analytical-mcp - apifox-mcp 📜 🏠 📇 (⭐ 3) - Apifox MCP Server是一个MCP工具,它使 AI 助手能够直接、实时地解析 Apifox 中的 API 定义,从而实现 TypeScript 类型、接口和调用函数的自动化生成
javascriptmcpserverapiainpm install Juzisuan965/apifox-mcp - boot-mcp 📘 🏠 (⭐ 3, 🍴 2) - A starter template for building Model Context Protocol (MCP) applications with TypeScript
typescriptbootmcpmcp-servernpm install kirklin/boot-mcp - canon-client 📘 🏠 (⭐ 3) - Client and MCP Server for Canon Cameras
typescriptmcpservergit clone https://github.com/ediardo/canon-mcp - deepsource-mcp-server 📘 🏠 (⭐ 3, 🍴 2, 🐛 3) - Model Context Protocol (MCP) server for DeepSource
typescriptdeepsourcemcpmcp-servermodel-context-protocolnpm install sapientpants/deepsource-mcp-server - actionkit-mcp-starter 📘 🏠 (⭐ 3, 🍴 1, 🐛 1) - Starter code for a MCP server powered by ActionKit
typescriptmcpservernpm install useparagon/actionkit-mcp-starter - AutoProbeMCP 📜 🏠 (⭐ 3, 🍴 3, 🐛 2) - Allow your Github Copilot Chat to navigate your frontend projects. Also compatible with Chat.fans Agents
javascriptnpm install Wladastic/mcp-browser-server - aws-strands-agents-mcp-demo 📜 🏠 (⭐ 3) - Model Context Protocol (MCP) Server and AWS Strands Agents Demonstration
javascriptmcpserverawsnpm install garystafford/aws-strands-agents-mcp-demo - azdo-mcp 📘 🏠 (⭐ 3, 🍴 4, 🐛 3) - TypeScript-based
typescriptnpm install mmruesch12/azdo-mcp - azure-log-analytics-mcp 📜 🏠 (⭐ 3) - MCP server for querying Azure Log Analytics using natural language
javascriptmcpserverazurenpm install MananShahTR/azure-log-analytics-mcp - bengaluru-bmtc-mcp 📜 🏠 (⭐ 3, 🍴 2, 🐛 1) - Bengaluru BMTC MCP Server
javascriptmcpservernpm install ajeetraina/bengaluru-bmtc-mcp - claudeus-plane-mcp 📘 🏠 (⭐ 3, 🍴 3, 🐛 1) - TypeScript-based
typescriptnpm install deus-h/claudeus-plane-mcp - dynamic-mcp-server 📘 🏠 (⭐ 3, 🍴 2) - A flexible and extensible framework for building Model Context Protocol (MCP) servers that conforms to the Model Context Protocol specification. This framework enables both static and dynamic tool registration, allowing tools to be defined at runtime as well as compile time.
typescriptmcpserverhttpnpm install scitara-cto/dynamic-mcp-server - example-mcp 📜 🏠 (⭐ 3, 🍴 3) - This repository contains example implementations of Model Context Protocol (MCP) servers that can be used with Cursor IDE to enhance AI capabilities with custom tools and data sources.
javascriptmcpserverainpm install dang-w/example-mcp - fal-mcp-server 📜 🏠 (⭐ 3, 🍴 1) - Model Context Protocol (MCP) server implementation for FAL.ai
javascriptmcpserverainpm install el-el-san/fal-mcp-server - GemForge-MCP 📘 🏠 (⭐ 3, 🍴 3, 🐛 1) - MCP server to empower your agent with enterprise-grade Gemini integration for codebase analysis, live search, text/PDF/image processing, and more on your favorite MCP clients.
typescriptagentic-aiai-agentsai-toolscoding-agentsnpm install PV-Bhat/GemForge-MCP - HenryHaoson_Yuque-MCP-Server 📘 🏠 (⭐ 3, 🍴 3) - Mirror of https://github.com/HenryHaoson/Yuque-MCP-Server
typescriptmcpserverhttpnpm install MCP-Mirror/HenryHaoson_Yuque-MCP-Server - ig-download-mcp-server 📜 🏠 (⭐ 3, 🍴 5, 🐛 3) - MCP service for downloading Instagram videos
javascriptmcpnpm install handoing/ig-download-mcp-server - internetdata-mcp 📘 🏠 (⭐ 3, 🍴 1, 🐛 1) - Updated MCP server based on TypeScript
typescriptmcpservernpm install lsd-so/internetdata-mcp - lightning-mcp 📘 🏠 (⭐ 3, 🍴 1, 🐛 2) - Ligthning Network MCP server.
typescriptmcpservernpm install AbdelStark/lightning-mcp - mcp-China-weather-server 📜 🏠 📇 (⭐ 3) - An MCP server for China weather queries based on the 高德 API.
javascriptmcpserverapinpm install Le-dawn/mcp-China-weather-server - MCP-Google-Maps 📘 🏠 (⭐ 3, 🍴 1) - MCP Google Maps server that can be used by claude, cursor, chatgpt, etc.
typescriptmcpservergonpm install ArtixZ/MCP-Google-Maps - mcp-server-rss3 📜 🏠 (⭐ 3, 🍴 4, 🐛 3) - rss3 + mcp server = 🪄✨
javascriptmcpservernpm install RSS3-Network/mcp-server-rss3 - mcp-status-invest 📘 🏠 📇 (⭐ 3, 🍴 2, 🐛 1) - MCP Status Invest: A Model Context Protocol (MCP) server for interacting with the Status Invest API. Provides tools for fetching stock data and indicators, with a layered architecture and data validation using Zod
typescriptmcpserverapinpm install newerton/mcp-status-invest - ns-private-access-mcp 📘 🏠 (⭐ 3, 🍴 5, 🐛 1) - TypeScript-based
typescripthttpaillmgitnpm install johnneerdael/netskope-mcp - mcp-alphavantage 📘 🏠 📇 (⭐ 3) - MCP server for interacting with the Alpha Vantage API, providing access to various financial data endpoints.
typescriptmcpserverapinpm install matteoantoci/mcp-alphavantage - mcp-fixer 📜 🏠 (⭐ 3, 🍴 1, 🐛 2) - Build-and-run diagnostics for Claude Desktop MCP servers in one command. MCP-Fixer runs 25 diagnostics on every MCP server, pinpoints port/path issues, and offers one-click fixes – no config.
javascriptmcpservernpm install Kajdep/mcp-fixer - mcp-ip-geolocator 📘 🏠 📇 (⭐ 3, 🍴 6, 🐛 3) - MCP server providing IP geolocation via IP-API.com. Free, no API key required.
typescriptmcpserverapinpm install tedlikeskix/mcp-ip-geolocator - mcp-momento 📜 🏠 (⭐ 3, 🍴 4, 🐛 2) - A model context protocol server for Momento
javascriptserverhttpgitgithubnpm install momentohq/mcp-momento - grype-mcp 📘 🏠 (⭐ 3) - MCP server for grype
typescriptgrypemcp-servermcpservernpm install ahmetak4n/grype-mcp - linear-mcp 📜 🏠 (⭐ 3, 🍴 8) - MCP server for Linear (https://linear.app), forked from ibraheem4/linear-mcp (https://github.com/ibraheem4/linear-mcp)
javascriptmcpserverhttpnpm install tiovikram/linear-mcp - linkding-mcp-server 📘 🏠 (⭐ 3, 🐛 1) - Unofficial linkding MCP server
typescriptmcpservernpm install uta8a/linkding-mcp-server - mcp-manager 🦀 🏠 (⭐ 3, 🍴 1) - A tool that allows calling different AI models with multiple sets of MCP servers
javascriptmcpserverrustainpm install silastorres14/mcp-manager - mcp-neo4j-memory-claude 📜 🏠 (⭐ 3, 🍴 1) - Node.js-based
javascriptnpm install Kinark/mcp-neo4j-memory-claude - mcp-php-server 🐘 🏠 (⭐ 3, 🐛 1) - A PHP Server Framework for Model Context Protocol (MCP)
phpmcpservergit clone https://github.com/james2037/mcp-php-server - omi-mcp 📘 🏠 (⭐ 3, 🍴 2) - mcp server for omi (TypeScript-based)
typescriptmcpservernpm install fourcolors/omi-mcp - mcp-sample-vsc-debug 📜 🏠 (⭐ 3, 🍴 1) - Create sample MCP server and able to debug in VSCode
javascriptmcpservernpm install swatDong/mcp-sample-vsc-debug - openapi-to-mcp-converter 📘 🏠 (⭐ 3, 🍴 1, 🐛 1) - A tool for automatically converting OpenAPI into Model Context Protocol (MCP) Server instance
typescriptjavascriptllmllm-toolsmcpnpm install zxypro1/openapi-mcp-converter - pulumi-mcp-server 📘 🏠 📇 (⭐ 3, 🍴 2) - TypeScript-based
typescriptapihttpgitgithubnpm install dogukanakkaya/pulumi-mcp-server - puppeteer-plus-martech-mcp 📜 🏠 (⭐ 3, 🍴 2, 🐛 2) - MCP server for marketing technology analysis with AI assistants. Enables Claude and other MCP clients to detect analytics tools, tag managers, and advertising pixels through conversational interfaces.
javascriptdigital-analyticsdigital-marketingmarketingmartechnpm install moonbirdai/puppeteer-plus-martech-mcp - read-docs-mcp 📜 🏠 (⭐ 3) - A mcp server that read a git repository docs
javascriptmcpservernpm install ZebraRoy/read-docs-mcp - twitch-mcp-smithery 📘 🏠 📇 (⭐ 3, 🐛 2) - A comprehensive Twitch MCP (Model Context Protocol) server providing chat moderation, stream management, and Twitch API integration for AI systems.
typescriptmcpserverapiainpm install Eclipse-XV/twitch-mcp-smithery - twitter-client-mcp 📘 🏠 (⭐ 3, 🍴 3) - A Model Context Protocol (MCP) server for secure Twitter client integration using the ElizaOS agent-twitter-client library
typescriptmcpservernpm install mzkrasner/twitter-client-mcp - Ultrahuman-MCP 📜 🏠 📇 (⭐ 3) - A simple MCP server using the Ultrahuman API to retrieve fitness data from your ring and query information about it from your favorite LLM
javascriptmcp-servermcpserverapinpm install Monasterolo21/Ultrahuman-MCP - redbook-mcp 📜 🏠 (⭐ 3) - 小红书内容发布 MCP 服务器,使用 Selenium WebDriver 进行浏览器自动化操作,支持发布图文笔记和视频笔记
httpgitgithubjavascriptmcpnpm install myzxlin/redbook-mcp - resource-hub-server 📜 🏠 (⭐ 3, 🍴 2, 🐛 1) - An MCP proxy server to connect to the resource hub
javascriptmcpservernpm install adamwattis/resource-hub-server - SB-MCP 📘 🏠 (⭐ 3, 🍴 3, 🐛 3) - Supabase Model Context Protocol (MCP) server for CRUD operations and Edge Functions
typescriptmcpservernpm install Cappahccino/SB-MCP - smartlead-mcp-server 📜 🏠 (⭐ 3, 🍴 1) - smaertlead mcp server for Campaign
javascriptmcpserverainpm install lkm1developer/smartlead-mcp-server - statistics-mcp 📘 🏠 (⭐ 3) - 基于 Model Context Protocol (MCP) 的服务器,提供对神岛平台用户数据、地图信息和统计数据的访问。
typescriptmcpnpm install box3lab/statistics-mcp - unsloth-mcp-server 📜 🏠 (⭐ 3, 🍴 5, 🐛 3) - An MCP server for Unsloth - a library that makes LLM fine-tuning 2x faster with 80% less memory
javascriptmcpserverllmnpm install OtotaO/unsloth-mcp-server - vb-gitlab-mcp 📜 🏠 (⭐ 3) - GitLab MCP(Model Context Protocol) Server, Can be used to do AI automated analysis of CodeReview
javascriptmcpserverainpm install lvzhengbin/vb-gitlab-mcp - verge-news-mcp 📘 🏠 (⭐ 3, 🍴 4, 🐛 1) - MCP server for The Verge news RSS feed
typescriptmcpservernpm install manimohans/verge-news-mcp - mcp-server-endoflife 📜 🏠 (⭐ 3, 🍴 3, 🐛 1) - A Model Context Protocol (MCP) server that enables AI assistants like Claude to check software end-of-life (EOL)
javascriptmcp-servermcpserverainpm install ducthinh993/mcp-server-endoflife - weather-mcp-server 📜 🏠 (⭐ 3, 🍴 2, 🐛 1) - A Model Context Protocol server that provides weather information
javascriptmcpservernpm install Yarflam/weather-mcp-server - website-generator-mcp-server 📜 🏠 (⭐ 3, 🍴 3, 🐛 3) - B12's model context protocol server for generating websites with AI
javascriptserverwebainpm install b12io/website-generator-mcp-server - cribl-mcp 📘 🏠 (⭐ 3, 🍴 3, 🐛 3) - Cribl MCP Server (TypeScript-based)
typescriptmcpservernpm install pebbletek/cribl-mcp - connpass-user-mcp-server 📘 🏠 📇 (⭐ 3, 🍴 2) - Model Context Protocol server that provides connpass users API v2
typescriptdenomcpmcp-serverservernpm install yamanoku/connpass-user-mcp-server - covid-mcp-server 📘 🏠 (⭐ 3, 🍴 1) - MCP server for fetching real-time COVID-19 data by country
typescriptmcpservernpm install aarushkx/covid-mcp-server - drone-ci-mcp 📘 🏠 (⭐ 3, 🍴 1) - MCP server to expose drone cicd server as tools
typescriptmcpservernpm install madappa-sharath/drone-ci-mcp - mcp-chat-adapter 📘 🏠 (⭐ 3, 🍴 2) - MCP server for using OpenAI compatible chat endpoints
typescriptmcpserverainpm install aiamblichus/mcp-chat-adapter - mcp-client-server 🐹 🏠 (⭐ 3) - Simplest example of MCP client-server architecture over HTTP using Python & Golang
javascriptmcpservergopythonnpm install logesh-kumar/mcp-client-server - MCP-OS 📜 🏠 (⭐ 3, 🐛 1) - MCP‑OS fetches just the MCPs your task needs, cutting prompt bloat and toggling servers on‑demand for a lean, secure toolset.
javascriptmcpservernpm install giao-123-sun/MCP-OS - mcp-pg-example 📜 🏠 (⭐ 3) - A Node.js application on Clever Cloud that uses an MCP server for PostgreSQL along with a language model to enable natural language querying of a PostgreSQL database
javascriptmcpserverdatabasepostgresnpm install CleverCloud/mcp-pg-example - mcp-server-router 📘 🏠 (⭐ 3, 🍴 5, 🐛 4) - mcprouter for remote mcp servers
typescriptmcpservernpm install chatmcp/mcp-server-router - mcp-smart-crawler 📜 🏠 (⭐ 3, 🍴 3, 🐛 1) - MCP Smart Crawler is a Model Context Protocol (MCP) server uses Playwright to crawl web content, extract metadata, and download resources such as videos and images.
javascriptmcpserverwebnpm install loo-y/mcp-smart-crawler - mcp-teamate 📘 🏠 (⭐ 3, 🍴 1, 🐛 1) - MCP server for AI cooperation
typescriptmcpserverainpm install aokihu/mcp-teamate - nps_mcp 📘 🏠 (⭐ 3, 🍴 5, 🐛 4) - Model Context Protocol (MCP) Server for National Park Services data
typescriptmcpservernpm install amysatterlee/nps_mcp - TimHolden_figma-mcp-server 📘 🏠 (⭐ 3, 🍴 2) - Mirror of https://github.com/TimHolden/figma-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/TimHolden_figma-mcp-server - orai-mcp 📘 🏠 (⭐ 3, 🍴 3, 🐛 2) - TypeScript-based
typescriptnpm install oraichain/orai-mcp - PicGoMCP 📜 🏠 (⭐ 3) - An MCP (Model Context Protocol) server that allows interaction with a running PicGo application to upload images.
javascriptmcpservergonpm install veithly/PicGoMCP - vapi-mcp 📘 🏠 📇 (⭐ 3, 🍴 4) - Vapi.ai MCP server & HTTP Server
typescriptmcpserverapiainpm install matthewdcage/vapi-mcp - deepl-mcp-server 📜 🏠 📇 (⭐ 3) - MCP Server for DeepL Translation API
javascriptdeeplgoogle-translatemcpmcp-servernpm install watchdealer-pavel/deepl-mcp-server - local-mcp-server-tutorial 📜 🏠 (⭐ 3) - ローカルMCPサーバー(stdio)を作成するためのチュートリアルです。
javascriptmcpnpm install 7nohe/local-mcp-server-tutorial - mcp-easy-copy 📜 🏠 (⭐ 3, 🍴 3) - A MCP server that lists all available MCP services for easy copying and usage
javascriptmcpserverainpm install fisheepx/mcp-easy-copy - latex-mathml-mcp-server 📜 🏠 (⭐ 3, 🍴 1, 🐛 3) - A Model Context Protocol (MCP) server that converts LaTeX mathematical expressions to MathML format.
javascriptmcpservermlnpm install HappyAny/latex-mathml-mcp-server - mcp-expert-server 📘 🏠 📇 (⭐ 3, 🍴 5, 🐛 4) - A MCP server that can create queries and fetch information from APi documentation.
typescriptmcpserverapidocumentationnpm install crazyrabbitLTC/mcp-expert-server - mcp-postman 📘 🏠 (⭐ 3, 🍴 1) - A Model Context Protocol (MCP) server built with Cloudflare Workers for integration with Claude and other AI assistants
typescriptmcpserverainpm install freebeiro/mcp-postman - simple-mcp-server 📘 🏠 (⭐ 3) - 示例,用极简代码,演示如何构建MCP Server。
typescriptdemodingding-botgaodemapmcp-servernpm install guog/simple-mcp-server - skynet-mcp 📘 🏠 (⭐ 3, 🍴 2, 🐛 2) - An MCP Server that acts as an agent and that can spawn more Agents, by using MCP.. MCP Inception!
typescriptmcpservernpm install ivo-toby/skynet-mcp - tugboat-mcp 📘 🏠 📇 (⭐ 3, 🍴 1, 🐛 8) - A Model Context Protocol (MCP) server for interacting with the Tugboat API.
typescriptmcpserverapinpm install Lullabot/tugboat-mcp - mcp-pubmed-server 📜 🏠 (⭐ 3, 🍴 2, 🐛 1) - PubMed MCP Server for accessing research papers
javascriptmcpservernpm install rikachu225/mcp-pubmed-server - actor-playwright-mcp 📘 🏠 (⭐ 2, 🍴 1) - Actor Playwright MCP server
typescriptmcpservernpm install apify/actor-playwright-mcp - apifox-mcp-server 📘 🏠 📇 (⭐ 2, 🍴 1, 🐛 1) - 基于MCP协议的获取ApiFox接口信息的服务
typescriptmcpapinpm install wangmhaha/apifox-mcp-server - browser-mcp-over-cdp 📘 🏠 (⭐ 2, 🐛 1) - MCP Server that manages a Chrome browser using the Chrome DevTools Protocol (CDP)
typescriptmcpservernpm install dumitrubogdanmihai/browser-mcp-over-cdp - ClaimsProcessingAssistant-MCP 📘 🏠 (⭐ 2) - This is a Model Context Protocol (MCP) server that provides claims processing capabilities through integration with a Supabase database. The server enables AI assistants to interact with insurance claim processing workflows and data through natural language.
typescriptclaims-processing-assistant-mcp-servermcpserverdatabasenpm install chbhargavareddy/ClaimsProcessingAssistant-MCP - claude-email-mcp 📜 🏠 📇 (⭐ 2, 🍴 1) - A Message Control Protocol (MCP) that allows Claude to send emails on your behalf using Amazon SES and read emails via Zoho Mail API.
javascriptmcpapiainpm install wesly-michel/claude-email-mcp - adamik-mcp-server 📘 🏠 (⭐ 2, 🍴 4, 🐛 1) - Adamik MCP (TypeScript-based)
typescriptmcpnpm install AdamikHQ/adamik-mcp-server - automcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 1) - Library for autogenerating MCP server and client code based on a specified YAML schema
typescriptmcpservermlnpm install beaukuhn/automcp - AidenYangX_mapbox-mcp-server 📘 🏠 (⭐ 2, 🍴 1) - Mirror of https://github.com/AidenYangX/mapbox-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/AidenYangX_mapbox-mcp-server - aws-ses-mcp 📘 🏠 (⭐ 2, 🍴 6, 🐛 2) - This is a simple Model Context Protocol (MCP) server that sends emails using AWS SES (Simple Email Service). Perfect for integrating with Cursor or Claude Desktop to compose and send emails directly without copy-pasting. The service supports both plain text and HTML emails with advanced features like CC, BCC, and reply-to functionality.
typescriptmcpserveraimlnpm install omd01/aws-ses-mcp - clj-kondo-MCP 📜 🏠 (⭐ 2, 🍴 4, 🐛 3) - Node.js-based
javascripthttpgitgithubnpm install Bigsy/clj-kondo-MCP - codebase-context-dumper 📜 🏠 (⭐ 2, 🍴 3) - A Model Context Protocol server to dump your codebase into your LLM model
javascriptserverllmgit clone https://github.com/lex-tools/codebase-context-dumper - cursor-mcp-manager 📘 🏠 (⭐ 2) - MCP workspace manager for Cursor. Easily install, configure, start, stop, and update MCP servers centrally for your cursor workspace.
typescriptmcpservernpm install zackiles/cursor-mcp-manager - df-mcp 📘 🏠 📇 (⭐ 2, 🍴 3, 🐛 2) - DreamFactory MCP Server enables AI assistants like Claude to directly query your databases through DreamFactory's auto-generated REST APIs.
typescriptmcpserverapidatabasenpm install dreamfactorysoftware/df-mcp - discord-mcp-server 📘 🏠 (⭐ 2) - TypeScript-based
typescriptnpm install mastra-ai/discord-mcp-server - element-plus-mcp 📘 🏠 (⭐ 2, 🍴 1) - element-plush mcp server
typescriptmcpservernpm install dweb-channel/element-plus-mcp - fm-mcp-servers 📜 🏠 (⭐ 2, 🍴 1) - MCP Servers for Advertising Report from FeedMob Dev Team
javascriptmcpservernpm install feed-mob/fm-mcp-servers - gezhe-ppt-mcp 📜 🏠 (⭐ 2, 🐛 1) - 歌者 PPT MCP,可以通过话题生成 PPT
javascriptmcpmcp-serverpptslidesnpm install deckflow/gezhe-ppt-mcp - git-forensics-mcp 📜 🏠 (⭐ 2, 🍴 3, 🐛 2) - An MCP server for deep git repository investigation and analysis. Provides detailed insights into repository history, branch relationships, and development patterns, focusing solely on git repository analysis rather than general GitHub or git operation.
javascriptmcpserverainpm install davidorex/git-forensics-mcp - kagi-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - Node implementation of a Kagi MCP server
javascriptmcpservernodenpm install elliottlawson/kagi-mcp-server - keycloak-mcp 📜 🏠 (⭐ 2, 🍴 1) - Keycloak MCP server (Node.js-based)
javascriptmcpservernpm install Octodet/keycloak-mcp - knotie-ai-mcp 📜 🏠 (⭐ 2) - The Model Context Protocol (MCP) server that enables AI agents like Claude Desktop to interact with the Knotie AI Pro platform for automated customer and voice AI agent management.
javascriptmcpserverainpm install avijeett007/knotie-ai-mcp - linea-mcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 8) - A Model Context Protocol (MCP) server that provides on-chain tools for AI applications to interact with the Linea blockchain.
typescriptconsensyslineamcpmcp-servernpm install qvkare/linea-mcp - louvre-mcp 📘 🏠 (⭐ 2, 🍴 2) - A Model Context Protocol (MCP) server for interacting with the Louvre museum's collection
typescriptmcpservernpm install oliviermichel/louvre-mcp - mcp-brex-server 📘 🏠 (⭐ 2, 🍴 2, 🐛 1) - A MCP server for interacting with Brex expense tracking platform
typescriptmcpservernpm install crazyrabbitLTC/mcp-brex-server - mcp-hooks 📘 🏠 (⭐ 2, 🐛 3) - A collection of tools and helpers for creating MCP servers and clients
typescriptmcpservernpm install civicteam/mcp-tools - mcp-image-server 📜 🏠 (⭐ 2) - A TypeScript-based MCP server for generating custom images and icons using AI (GPT Image 1). It supports output formats including .png, .svg, .ico, and others. Designed for seamless integration with Vibe Coding, enabling on-demand visual asset creation for your projects.
javascriptfavicon-generatorimage-generationmcpservernpm install ricardopera/mcp-image-server - mcp-JapaneseTextAnalyzer 📘 🏠 (⭐ 2, 🍴 3) - MCP server for analyzing Japanese text with morphological analysis
typescriptmcpservernpm install Mistizz/mcp-JapaneseTextAnalyzer - MCP-Quantum-Server 📜 🏠 (⭐ 2) - Seamlessly integrating APIs, advanced AI, and intelligent automation with Github & X, this state-of-the-art MCP framework revolutionizes server & client-side functionality. 🚀 With features like AI-powered Intelligent Notifications, it predicts critical updates and delivers custom alerts via email, ensuring smarter workflows.
javascriptai-poweredapi-integrationautomationclient-servernpm install UjjwalSaini07/MCP-Quantum-Server - mcp-server 📘 🏠 (⭐ 2, 🍴 3, 🐛 2) - mcp-server (TypeScript-based)
typescriptmcpservernpm install chenshuai2144/mcp-server - mcp-server-aoai-dalle3 📘 🏠 (⭐ 2, 🍴 1) - TypeScript-based
typescriptnpm install jacwu/mcp-server-azure-openai-dalle3 - mcp-server-azure-devops 📘 🏠 (⭐ 2) - MCP N8N Azure Devops
typescriptmcpazurenpm install ramosjuan24/mcp-server-azure-devops - mcp-server-flipt 📘 🏠 (⭐ 2, 🍴 6, 🐛 2) - TypeScript-based
typescripthttpaigitgithubnpm install flipt-io/mcp-server-flipt - mcp-server-jupiter 📘 🏠 (⭐ 2, 🍴 6, 🐛 1) - TypeScript-based
typescriptnpm install dcSpark/mcp-server-jupiter - mcp-server-mlflow 📘 🏠 (⭐ 2, 🍴 3, 🐛 1) - MCP server for accessing prompts stored in MLflow Prompt Registry
typescriptmcpservermlnpm install B-Step62/mcp-server-mlflow - mcp-server-server 📘 🏠 (⭐ 2, 🍴 2) - MCP server of servers
typescriptmcpservernpm install rgarcia/mcp-server-server - mcp-server-terrakube 📘 🏠 (⭐ 2, 🍴 2) - Model Context Protocol Server for Terrakube
typescriptservernpm install AzBuilder/mcp-server-terrakube - mcp-server-triplewhale 📘 🏠 (⭐ 2, 🍴 2, 🐛 3) - Triplewhale MCP Server
typescriptmcpservernpm install Triple-Whale/mcp-server-triplewhale - MCP-servers- 📜 🏠 (⭐ 2, 🍴 1) - This repo has my learnings on how to create an MCP-Server
javascriptmcpservernpm install KrishCodesw/MCP-servers- - MCP-TMDB 📘 🏠 📇 (⭐ 2, 🍴 5, 🐛 1) - Created an MCP Enabled Server connecting with TMDB API , Tested With MCP Inspector
typescriptmcpserverapinpm install ShubhanshuSondhiya/MCP-TMDB - mcp-wassenger 📘 🏠 (⭐ 2) - MCP connector for Wassenger WhatsApp API: Send messages, summarize conversations, automate anything on WhatsApp using text or voice from your favorite AI client like ChatGPT, Claude, Gemini, OpenAI and more 🎉
typescriptchatbotchatgptclaudemcpnpm install wassengerhq/mcp-wassenger - metatool-ai_mcp-server-metamcp 📘 🏠 (⭐ 2, 🍴 1) - Mirror of https://github.com/metatool-ai/mcp-server-metamcp
typescriptmcpserveraihttpnpm install MCP-Mirror/metatool-ai_mcp-server-metamcp - nylas-api-mcp 📘 🏠 📇 (⭐ 2, 🍴 2, 🐛 2) - Experimental - Model Context Protocol (MCP) server for the Nylas API
typescriptmcpserverapinpm install nylas-samples/nylas-api-mcp - octagon-stock-market-data-mcp 📜 🏠 (⭐ 2) - The Octagon Stock Market Data MCP server provides specialized AI-powered stock market data and valuation analysis capabilities by integrating with advanced stock data agents. Real-time market data, comprehensive technical indicators, and unlimited market intelligence.
javascriptmcpserveraigonpm install OctagonAI/octagon-stock-market-data-mcp - OpenFoodFacts-MCP 📘 🏠 📇 (⭐ 2, 🍴 1, 🐛 1) - OpenFoodFacts-MCP is a project for managing, processing, and analyzing food product data using Open Food Facts APIs.
typescriptfoodmcpmcp-servernutrition-informationnpm install JagjeevanAK/OpenFoodFacts-MCP - orshot-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - Orshot MCP Server (Node.js-based)
javascriptmcpserverhttpgitnpm install rishimohan/orshot-mcp-server - payai-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - Model Context Protocol server for the PayAI network! Plug PayAI into Claude Desktop, Cursor, or your favorite MCP Host!
javascriptmcpserverainpm install notorious-d-e-v/payai-mcp-server - playwright-trace-mcp 📘 🏠 (⭐ 2) - advanced playwright mcp by adding trace viewer function
webhttpllmgitgithubnpm install korwabs/playwright-trace-mcp - postman-weaviate-mcp-server 📜 🏠 (⭐ 2, 🍴 1, 🐛 2) - Weaviate MCP Server (Node.js-based)
javascriptmcpservernpm install agentesq/postman-weaviate-mcp-server - promptopia-mcp 📘 🏠 (⭐ 2, 🍴 2, 🐛 3) - TypeScript-based
typescriptnpm install lumile/promptopia-mcp - razorpay-mcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 1) - Unofficial Razorpay MCP server
typescriptmcpmcp-serverpayment-gatewayrazorpaynpm install LightHeads/razorpay-mcp - s3-mcp-server 📘 🏠 (⭐ 2, 🍴 2, 🐛 2) - ⚙️ A Model Context Protocol (MCP) server for accessing Amazon S3 buckets. This server provides seamless integration with S3 storage through MCP, allowing efficient handling of large files including PDFs through streaming capabilities.
typescriptmcpservermlnpm install Geun-Oh/s3-mcp-server - safe-mcp-server 📜 🏠 (⭐ 2, 🍴 5, 🐛 2) - An MCP server implementation for interacting with Safe (Gnosis Safe) smart contract wallets
javascriptethereummcpservernpm install 5ajaki/safe-mcp-server - server-dice-roll 📘 🏠 (⭐ 2, 🍴 1, 🐛 13) - MCP Server for simulating dice rolls
typescriptmcpservernpm install lpbayliss/server-dice-roll - solana-web3js-mcp-server 📘 🏠 (⭐ 2, 🍴 1, 🐛 10) - MCP server for Solana web3.js development and smart contract deployment
typescriptmcpserverwebnpm install FrankGenGo/solana-web3js-mcp-server - sonarr-mcp 📘 🏠 (⭐ 2) - Give your LLM access to Sonarr
typescriptmcpmcp-serversonarrsonarr-apinpm install jbydeley/sonarr-mcp - ssh-client-mcp-server 📜 🏠 (⭐ 2, 🐛 1) - MCP server exposing SSH control for Linux servers via Model Context Protocol.
javascriptmcpservernpm install jordanburke/ssh-client-mcp-server - Structurizr-DSL-Debug-MCP 📜 🏠 (⭐ 2, 🍴 1) - Mcp server to connect to structurizer dsl rendered in the browser and return error messages regarding parsing to Cursor IDE
javascriptmcpservernpm install ViperJuice/Structurizr-DSL-Debug-MCP - tenderly-mcp-server 📘 🏠 📇 (⭐ 2, 🍴 1, 🐛 1) - MCP Server for the Tenderly API
typescriptmcpserverapinpm install miljantekic/tenderly-mcp-server - time-tools-mcp-server 📘 🏠 (⭐ 2, 🍴 1) - MCP server to enable AI agents to perform time-related processing, such as retrieving the current time
typescriptmcpserverainpm install t-shiratori/time-tools-mcp-server - tengfone_supabase-nextjs-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - Mirror of https://github.com/tengfone/supabase-nextjs-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/tengfone_supabase-nextjs-mcp-server - token-revoke-mcp 📜 🏠 (⭐ 2, 🍴 6, 🐛 4) - An MCP server for checking and revoking ERC-20 token allowances across multiple blockchains.
javascriptmcpserveraihttpnpm install kukapay/token-revoke-mcp - TradingBalthazar_hyperliquid-mcp-server-v9 📜 🏠 (⭐ 2) - Mirror of https://github.com/TradingBalthazar/hyperliquid-mcp-server-v9
javascriptmcpserverhttpnpm install MCP-Mirror/TradingBalthazar_hyperliquid-mcp-server-v9 - trash-cleaner-mcp-server 📘 🏠 (⭐ 2) - A desktop MCP service that scans for and removes junk files to keep your system clean and optimized.
typescriptmcpnpm install dabing1022/trash-cleaner-mcp-server - usescraper-mcp-server 📜 🏠 📇 (⭐ 2, 🍴 4, 🐛 1) - MCP server for the useScraper API. This is a server that scrapes a URL to text or markdown
javascriptmcpserverapinpm install tanevanwifferen/usescraper-mcp-server - video-transcribe-mcp 📘 🏠 (⭐ 2) - An MCP server implementation that integrates with optivus, providing video transcribe capabilities (e.g. YouTube, Facebook, Tiktok, etc.) for LLMs
typescriptmcpserverllmnpm install demon24ru/video-transcribe-mcp - webex-mcp-server 📘 🏠 (⭐ 2, 🍴 1) - A NodeJS MCP server for interacting with Webex Spaces
typescriptmcpserverwebnodenpm install bharath063/webex-mcp-server - x-mcp 📘 🏠 📇 (⭐ 2, 🍴 1, 🐛 10) - An MCP Server to interact with X/Twitter besides the official API.
typescriptmcpserverapinpm install Barresider/x-mcp - yfinance-mcp-server 📜 🏠 (⭐ 2, 🍴 3) - Unofficial MCP server for Yahoo Finance stock data.
javascriptmcpservernpm install onori/yfinance-mcp-server - alpha_vantage_mcp 📜 🏠 (⭐ 2) - MCP Server for AlphaVantage
javascriptmcpservernpm install septemhill/alpha_vantage_mcp - codePromptManagerMCP 📘 🏠 (⭐ 2) - This helps you create a mcp server which your IDE can access to create and save prompts for you code base
typescriptmcpservernpm install vivek100/codePromptManagerMCP - codevideo-mcp 📘 🏠 (⭐ 2) - The MCP server for CodeVideo. Create software educational content using natural language.
typescriptmcpservernpm install codevideo/codevideo-mcp - commit-convention-mcp 📘 🏠 (⭐ 2) - An MCP server providing commit convention tools and resources.
typescriptmcpservernpm install myutex/commit-convention-mcp - context-continue-mcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 1) - MCP server code for context-mcp
typescriptmcpservernpm install core3-coder/context-continue-mcp - FREEZONEX_mcp-server-supos 📜 🏠 (⭐ 2) - Mirror of https://github.com/FREEZONEX/mcp-server-supos
javascriptmcpserverhttpnpm install MCP-Mirror/FREEZONEX_mcp-server-supos - mcp-explorer-ui 📘 🏠 (⭐ 2, 🍴 4) - an open-source web application for exploring and visualizing the MCP Servers
typescriptmcpserverwebnpm install barnuri/mcp-explorer-ui - mcp-server 📘 🏠 (⭐ 2) - Custom MCP for fun and profit!
typescriptmcpnpm install princefishthrower/mcp-server - mcp-server-brian 📘 🏠 (⭐ 2, 🍴 1) - A MCP server to retrieve transaction calldata from prompts using Brian
typescriptmcpservernpm install brian-knows/mcp-server-brian - mcp-server-adb 📜 🏠 (⭐ 2) - A Model Context Protocol server for Android Debug Bridge (ADB) control
javascriptservernpm install yava555/mcp-server-adb - mcp-server-cambridge-dict 📜 🏠 (⭐ 2, 🍴 1, 🐛 1) - 一个可以使用cambridge dictionary查询单词的mcp服务器
javascriptmcpnpm install meowrain/mcp-server-cambridge-dict - mcp-server-vscode-extensions 📘 🏠 (⭐ 2, 🍴 1) - MCP tool for automatically installing VS Code extensions in Cursor
typescriptmcpnpm install siliconuy/mcp-server-vscode-extensions - mcp-servers 📘 🏠 (⭐ 2, 🍴 1) - type safety mcp servers with deno.
typescriptmcpservernpm install esh2n/mcp-servers - mcp-taskwarrior 📜 🏠 (⭐ 2, 🍴 3) - A simple MCP Server for Taskwarrior
javascriptmcpservernpm install 0xbeedao/mcp-taskwarrior - okx-mcp-server 📜 🏠 (⭐ 2, 🍴 3, 🐛 2) - Node.js-based
javascriptnpm install badger3000/okx-mcp-server - OneNoteMCP 📘 🏠 (⭐ 2, 🍴 2) - MCP Server for accessing your OneNote
typescriptmcpservernpm install swax/OneNoteMCP - openalex-mcp-server 📘 🏠 📇 (⭐ 2) - An MCP (Model Context Protocol) server that connects to the OpenAlex API.
typescriptmcpserverapipythonnpm install dgitj/openalex-mcp-server - opera-omnia-mcp 📜 🏠 (⭐ 2, 🍴 2, 🐛 2) - The Opera Omnia MCP server provides programmatic access to the rich collection of JSON datasets from the Opera Omnia project. It enables developers, storytellers, and AI applications to easily access, combine, and generate creative content for games, interactive fiction, chatbots, and more.
javascriptmcpserveraijsonnpm install triptych/opera-omnia-mcp - phrases-MCP-server 📘 🏠 (⭐ 2, 🍴 2) - Un servidor MCP (Model Context Protocol) elegante y eficiente para gestionar frases inspiradoras. Diseñado para integrarse perfectamente con Claude for Desktop y otros clientes MCP.
typescriptmcpnpm install ronniemh/phrases-MCP-server - rezapex_shopify-mcp-server-main 📘 🏠 (⭐ 2, 🍴 2, 🐛 2) - Mirror of https://github.com/rezapex/shopify-mcp-server-main
typescriptmcpserveraihttpnpm install MCP-Mirror/rezapex_shopify-mcp-server-main - uniauto-mcp-server 📜 🏠 (⭐ 2, 🍴 1, 🐛 1) - Universal Test Automation MCP Server with self-healing capabilities and Smithery.ai integration
javascriptmcpserverainpm install samuelvinay91/uniauto-mcp-server - WordPress-to-MCP-Server 🐘 🏠 (⭐ 2, 🍴 1) - henjii instantly turns your WordPress site into a full-featured Model Context Protocol (MCP) server.
phpmcpservergit clone https://github.com/stuffyoushouldautomate/WordPress-to-MCP-Server - mcp-client-toolkit 📘 🏠 (⭐ 2) - TypeScript client library and utilities for remote Model Context Protocol (MCP) servers
typescriptmcpservernpm install tileshq/mcp-client-toolkit - mcp-for-wordpress 📘 🏠 (⭐ 2, 🍴 1) - MCP Server for WordPress
typescriptmcpservernpm install rizaardiyanto1412/mcp-for-wordpress - mcp-github 📘 🏠 (⭐ 2, 🍴 2, 🐛 2) - Github MCP Server (TypeScript-based)
typescriptmcpservernpm install MissionSquad/mcp-github - mcp-github-reader-prod 📜 🏠 (⭐ 2) - Bring github repos into context using this mcp server
javascriptmcp-servermcpservernpm install skydeckai/mcp-github-reader-prod - mcp-newsapi 📘 🏠 📇 (⭐ 2, 🍴 3) - An MCP server exposing News API endpoints for searching and retrieving news articles. Provides reliable, easy-to-use tools for integrating news data into applications and workflows, with robust error handling and secure API key management.
typescriptmcpserverapinpm install matteoantoci/mcp-newsapi - mcp-phenoage-clock 📜 🏠 (⭐ 2) - MCP server for calculating biological age using the Morgan Levine PhenoAge clock
javascriptai-toolsclaude-mcpmcpmcp-servernpm install 199-biotechnologies/mcp-phenoage-clock - create-advanced-mcp-server 📘 🏠 (⭐ 2, 🍴 1, 🐛 2) - A comprehensive architecture for building robust Model Context Protocol (MCP) servers with integrated web capabilities
typescriptclaude-aimcpmcp-servermcp-serversnpm install bsmi021/create-advanced-mcp-server - docs-to-mcp-cli 📘 🏠 (⭐ 2) - A CLI utility for turning your docs into a stdio MCP server
typescriptmcpservernpm install Tiberriver256/docs-to-mcp-cli - documentation-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - An MCP server for accessing updated documentation of popular libraries
javascriptmcpserverdocumentationnpm install SubaashNair/documentation-mcp-server - engine-openapi-mcp 📜 🏠 (⭐ 2, 🍴 1, 🐛 1) - 基于 Model Context Protocol (MCP) 的服务器,提供对神岛引擎开放接口整合工具。
javascriptmcpnpm install box3lab/engine-openapi-mcp - geo-mcp-server 📜 🏠 (⭐ 2, 🍴 3, 🐛 3) - Node.js-based
javascriptnpm install NodeGIS/geo-mcp-server - grain-mcp-server 🐍 🏠 📇 (⭐ 2, 🍴 1, 🐛 2) - MCP Server for Grain
apiresthttpaigitpip install git+https://github.com/eadm/grain-mcp-server - guardrails-mcp 📘 🏠 (⭐ 2, 🐛 2) - Enable AI assistants to explore and query your Turbot Guardrails data!
typescriptmcpmcp-serverturbot-guardrailsainpm install turbot/guardrails-mcp - image-creator-mcp 📜 🏠 (⭐ 2, 🍴 1) - Model Context Protocol (MCP) server enabling AI clients (Cline, Claude Desktop) to generate images using OpenAI (DALL-E 3, gpt-image-1) and save them directly to the user's project directory.
javascriptmcpserverainpm install dfeirstein/image-creator-mcp - marginalia-mcp-server 📜 🏠 (⭐ 2, 🍴 7, 🐛 2) - An MCP server implementation for managing marginalia and annotations
javascriptmcpservernpm install bmorphism/marginalia-mcp-server - mcp-with-d1-data 📘 🏠 (⭐ 2, 🍴 1) - Demo MCP Server build using Cloudflare MCPAgent Durable Objects and D1 database
typescriptcloudflarecloudflare-d1cloudflare-kvcloudflare-workersnpm install jubalm/mcp-with-d1-data - moleculer-mcp 📘 🏠 (⭐ 2) - A Model Context Protocol (MCP) server that exposes Moleculer.js actions as AI tools.
typescriptmcpserverainpm install alvaroinckot/moleculer-mcp - github-enterprice-mcp 📘 🏠 📇 (⭐ 2, 🍴 2, 🐛 1) - MCP Server for the GitHub Enterprise APIs, enabling file operations, repository management, search functionality, and more.
typescriptmcpserverapinpm install piyushgIITian/github-enterprice-mcp - ledger-mate-mcp-server-for-typescript 📜 🏠 (⭐ 2, 🍴 1, 🐛 1) - 小记 MCP Server for TypeScript
javascriptmcpservernpm install big-mouth-cn/ledger-mate-mcp-server-for-typescript - aapi-mcp-server 📘 🏠 📇 (⭐ 2, 🍴 2, 🐛 2) - Advanced API MCP Server
typescriptaapiblockchainmcpmcp-servernpm install Asphere-xyz/aapi-mcp-server - base-mcp-server 📘 🏠 (⭐ 2, 🍴 4, 🐛 2) - Base MCP (TypeScript-based)
typescriptmcpnpm install fakepixels/base-mcp-server - BC-MCP 📜 🏠 (⭐ 2, 🍴 2, 🐛 1) - An attempt at creating a BC MCP server
javascriptmcpservernpm install vanachterjacob/BC-MCP - CSA-MCP-servers 📜 🏠 (⭐ 2, 🍴 1) - Cloud Security Alliance Model Context Protocol Servers
javascriptservernpm install CloudSecurityAlliance/csa-mcp-servers - deepre 📘 🏠 (⭐ 2, 🍴 1) - local mcp server perplexity
typescriptmcpservergit clone https://github.com/hirokidaichi/mcp-deepresearch - ghost-mcp-server 📘 🏠 📇 (⭐ 2, 🍴 5, 🐛 2) - A Model Context Protocol (MCP) server that integrates with the Ghost Admin API. This server enables programmatic access to Ghost CMS features including post management, page management, member management, and more.
typescriptmcpserverapijavascriptnpm install mtane0412/ghost-mcp-server - honeycomb-mcp-server 📜 🏠 (⭐ 2, 🍴 2, 🐛 2) - Honeycomb MCP (Model-Controller-Presenter) Server implementation
javascriptmcpservernpm install kajirita2002/honeycomb-mcp-server - jira-mcp-server 📘 🏠 📇 (⭐ 2, 🍴 1) - A model context protocol server for Jira API
typescriptmodelcontextprotocolserverapimcpnpm install ParasSolanki/jira-mcp-server - line-developers-mcp-server 📘 🏠 (⭐ 2) - A MCP Server of https://developers.line.biz/ja/
typescriptmcpserverhttpnpm install odanado/line-developers-mcp-server - linear-mcp-server 📘 🏠 (⭐ 2, 🍴 2, 🐛 1) - MCP server for Linear integration
typescriptmcpservernpm install cpropster/linear-mcp-server - MCP-deepseek-V3-et-claude-desktop 📜 🏠 (⭐ 2, 🍴 1, 🐛 1) - Node.js-based
javascriptnpm install niko91i/MCP-deepseek-V3-et-claude-desktop - MCP-DOC-Server-OpenRouter 📘 🏠 📇 (⭐ 2) - TypeScript-based
apihttpgitgithubtypescriptnpm install xinlei413/MCP-DOC-Server-OpenRouter - mcp-find-similar-github-issues 📘 🏠 (⭐ 2, 🍴 4, 🐛 1) - WIP: An MCP server to find related Github Issues
typescriptmcpservernpm install Jake-Mok-Nelson/mcp-find-similar-github-issues - mcp-linear 📜 🏠 (⭐ 2, 🍴 1) - Implementation of an MCP server for Linear integration
javascriptmcpservernpm install scoutos/mcp-linear - MCP-Servers 📘 🏠 (⭐ 2, 🍴 2) - Servidores MCP (TypeScript-based)
typescriptmcpnpm install Haonter/MCP-Servers - MCP-Server-for-sensor-device 📜 🏠 (⭐ 2, 🍴 4, 🐛 4) - This project is a Node.js application designed for use with Claude Desktop. It simulates a CO2 sensor device and provides a JSON-RPC server to interact with the device. The application can run in both simulation mode and real mode, where it connects to a Raspberry Pi Pico via USB to read CO2 levels.
javascriptserverjsonnodenpm install kmwebnet/MCP-Server-for-sensor-device - mcp-server-hub-server 📘 🏠 (⭐ 2, 🍴 1) - This project provides a central gateway to manage multiple MCP (Model Context Protocol) servers, preventing the need to configure and run duplicate server processes for each LLM client (like Cline, Cursor, etc.). Connect your LLM client to the single gateway-client endpoint provided by this project to access tools from all your managed MCP servers
typescriptclaudeclaude-aicursoraigatewaynpm install bsmi021/mcp-server-hub-server - mcp-server-meraki 📘 🏠 📇 (⭐ 2) - Serveur MCP pour l'API Meraki - Interface standardisée pour la gestion de l'infrastructure Meraki
typescriptmcpapinpm install Censini/mcp-server-meraki - mirrornode-mcp-server 📘 🏠 (⭐ 2) - Hedera MCP server (TypeScript-based)
typescriptmcpservernpm install hedera-dev/mirrornode-mcp-server - mongo-mcp-server 📘 🏠 (⭐ 2, 🍴 2) - MCP server for mongoDB
typescriptmcpservermongodbgonpm install Matteturtle09/mongo-mcp-server - mono-mcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 2) - Monobank MCP Server (TypeScript-based)
typescriptmcpmcp-serverukraineservernpm install clar1k/mono-mcp - smithery-registry-mcp 📘 🏠 📇 (⭐ 2) - MCP server for interacting with the Smithery Registry API
typescriptmcpserverapinpm install aloshy-ai/smithery-registry-mcp - mixelpixx_GoogleSearch_McpServer 📘 🏠 (⭐ 2) - Mirror of https://github.com/mixelpixx/GoogleSearch_McpServer
typescriptmcpserverhttpgonpm install MCP-Mirror/mixelpixx_GoogleSearch_McpServer - mongo-db-mcp 📘 🏠 (⭐ 2, 🍴 1, 🐛 2) - MCP Server for MongoDB
typescriptmcpservermongodbgonpm install PrashantSedhain/mongo-db-mcp - n8n-mcp-server 📜 🏠 (⭐ 2) - A Model-Controller-Provider (MCP) server implementation for n8n workflow automation
javascriptmcpservernpm install S17S17/n8n-mcp-server - pct-mcp-server 📘 🏠 (⭐ 2, 🍴 3, 🐛 1) - Personal Context Technology for AI Personalization MCP server
typescriptai-personalizationcontext-managementmcp-serveropen-sourcenpm install mikhashev/pct-mcp-server - mcp-server-firecrawl 📘 🏠 (⭐ 2, 🍴 3) - TypeScript-based
typescriptnpm install Msparihar/mcp-server-firecrawl - mcp-server-JIRA 📘 🏠 (⭐ 2, 🍴 3, 🐛 1) - Mcp server in typescript to connect with Jira Analyze the issues
typescriptmcpservernpm install uddeshya-23/mcp-server-JIRA - mcp2http 📜 🏠 (⭐ 2, 🍴 2) - MCP2HTTP is a minimal transport adapter that bridges MCP clients using stdio with stateless HTTP servers.
javascriptmcpserverhttpnpm install tekorex/mcp2http - project-hub-mcp-server 📘 🏠 (⭐ 2, 🍴 3, 🐛 1) - MCP server for managing software projects, providing tools for project tracking, note-taking, and GitHub integration
typescriptmcpservernpm install peterparker57/project-hub-mcp-server - tavily-search-mcp-server 📘 🏠 📇 (⭐ 2, 🍴 6) - An MCP server implementation that integrates the Tavily Search API, providing optimized search capabilities for LLMs.
typescriptmcpserverapillmnpm install apappascs/tavily-search-mcp-server - wordpress-mcp-server 🐍 🏠 (⭐ 2, 🍴 1) - A Machine Communication Protocol (MCP) server for publishing content to WordPress sites
typescriptmcpserverpythonnpm install beilunyang/wordpress-mcp-server - pwalker-mcp 📘 🏠 (⭐ 2, 🍴 1) - MCP Server with an artisinal selection of bespoke agent tools.
typescriptmcpservernpm install pauldw/pwalker-mcp - release-notes-server 📘 🏠 (⭐ 2, 🍴 5, 🐛 2) - An MCP server for generating release notes from GitHub commits
typescriptmcpservernpm install nickbaumann98/release-notes-server - sentry-mcp-server 📘 🏠 (⭐ 2, 🍴 1, 🐛 1) - 🤖 A TypeScript implementation of a Sentry MCP (Modern Context Protocol) tool that allows AI agents to access and analyze Sentry error data.
typescriptmcpaijavascriptnpm install FaureAlexis/sentry-mcp-server - slowtime-mcp-server 📘 🏠 (⭐ 2, 🍴 6, 🐛 7) - A Model Context Protocol server for secure time-based operations with timing attack protection and timelock encryption
typescriptservernpm install bmorphism/slowtime-mcp-server - unleash-ff-mcp-server 📘 🏠 (⭐ 2, 🍴 2, 🐛 2) - Unleash MCP Server (TypeScript-based)
typescriptmcpservernpm install ylin6/unleash-ff-mcp-server - browserbase_mcp-server-browserbase 📜 🏠 (⭐ 2, 🍴 2) - Mirror of https://github.com/browserbase/mcp-server-browserbase
javascriptmcpserverhttpnpm install MCP-Mirror/browserbase_mcp-server-browserbase - smallcloud-mcp-server 📜 🏠 (⭐ 2, 🍴 1) - SmallCloud MCP Server Demonstration of an Anthropic MCP server using the Model Context Protocol SDK by Anthropic. For use with Claude Desktop and other MCP Hosts.
javascriptmcpservernpm install SmallCloudCo/smallcloud-mcp-server - exa-server 📜 🏠 (⭐ 2, 🍴 3, 🐛 2) - AI-powered code search MCP server using Exa API for intelligent code search and retrieval in AI assistants
javascriptai-assistantcode-intelligencecode-searchdeveloper-toolsnpm install it-beard/exa-server - agent-mcp-community 📘 🏠 (⭐ 1, 🍴 3, 🐛 1) - agent mcp server 社区 (TypeScript-based)
typescriptmcpservernpm install lucky-aeon/agent-mcp-community - arabold_docs-mcp-server 📘 🏠 (⭐ 1) - Mirror of https://github.com/arabold/docs-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/arabold_docs-mcp-server - asher-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - A Personal Financial Data MCP Server over the israeli-bank-scrapers package
typescriptmcpservernpm install shlomiuziel/asher-mcp - bamboohr-mcp 📘 🏠 📇 (⭐ 1) - A Model Context Protocol (MCP) library for BambooHR, built with Node.js and TypeScript.
typescriptbamboobamboohrbamboohr-apimcpnpm install encoreshao/bamboohr-mcp - blockchain-mcp 📘 🏠 (⭐ 1, 🍴 1) - MCP server to perform blockchain operations using thirdweb
typescriptmcpserverwebainpm install joaquim-verges/blockchain-mcp - Browser-use-claude-mcp 📘 🏠 (⭐ 1) - A browser automation MCP server for AI models like Claude and Gemini 2.5, enabling web browsing capabilities through natural language
typescriptmcpserverwebainpm install jasondsmith72/Browser-use-claude-mcp - bruno-api-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - MCP that allows us to load our bruno collection and have AI call it on our behalf
typescriptmcpainpm install djkz/bruno-api-mcp - c7-mcp-server 📜 🏠 (⭐ 1) - An unofficial MCP server for Context7 by Upstash.
javascriptmcpservernpm install quiint/c7-mcp-server - clicksend-mcp-server 📘 🏠 (⭐ 1, 🍴 1, 🐛 2) - MCP Server for Messaging using ClickSend
typescriptmcpservernpm install ClickSend/clicksend-mcp-server - clockify-mcp 📘 🏠 (⭐ 1, 🍴 2, 🐛 2) - Clockify Model Context Protocol (MCP) server
typescriptmcpservernpm install inakianduaga/clockify-mcp - Copilot-terminal-MCP 📘 🏠 (⭐ 1) - TypeScript-based
typescriptnpm install menoxz/Copilot-terminal-MCP - coupler-io-mcp-server 📘 🏠 (⭐ 1, 🐛 1) - Coupler.io MCP server
typescriptmcpservernpm install railsware/coupler-io-mcp-server - DOC-Server-MCP 📘 🏠 📇 (⭐ 1) - TypeScript-based
apihttpgitgithubtypescriptnpm install xinlei413/DOC-Server-MCP - github-action-trigger-mcp 📜 🏠 (⭐ 1, 🍴 1, 🐛 2) - Node.js-based
javascriptnpm install nextDriveIoE/github-action-trigger-mcp - github-see-mcp-server 📘 🏠 📇 (⭐ 1, 🍴 1) - github-see-mcp-server is an SSE server for real-time GitHub event integration and management. It enables efficient monitoring and automation of repository processes. Developed with TypeScript, it provides a robust, scalable solution for reactive GitHub API interaction.
typescriptmcpserverapireactnpm install JesusMaster/github-see-mcp-server - iracing-data-mcp-server 📜 🏠 📇 (⭐ 1) - Node.js mcp server for iRacing data api
javascriptiracingiracing-apiiracing-clientmcp-servernpm install emilioSp/iracing-data-mcp-server - huntress-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 5, 🐛 3) - MCP server for Huntress API integration
javascriptmcpserverapinpm install DynamicEndpoints/huntress-mcp-server - hyperliquid-mcp 📘 🏠 (⭐ 1, 🍴 2) - A Model Context Protocol (MCP) server that provides onchain tools for AI applications like Claude Desktop and Cursor, allowing them to interact with Hyperliquid.
typescriptmcpserverainpm install Impa-Ventures/hyperliquid-mcp - infactory-mcp 📘 🏠 (⭐ 1) - Infactory MCP Server
typescriptmcpservernpm install infactory-io/infactory-mcp - google_search_mcp_server 📘 🏠 (⭐ 1, 🍴 3, 🐛 1) - A Google Search MCP server that connects with LLMs or any MCP client to enable realtime search.
typescriptmcpserverllmgonpm install hunter-arton/google_search_mcp_server - gorela-developer-mcp-server 📘 🏠 📇 (⭐ 1) - 고릴라(Gorela) 연동 개발자를 위한 개발자 사이트 API 문서 제공 MCP 서버
typescriptmcpapigonpm install BarogoDevelopers/gorela-developer-mcp-server - hibp-mcp-server 📜 🏠 (⭐ 1, 🍴 3, 🐛 1) - Node.js-based
javascriptcyreslabmcpmcp-serversecurity-toolsnpm install Cyreslab-AI/hibp-mcp-server - holaspirit-mcp-server 📜 🏠 (⭐ 1, 🍴 8) - A MCP server that accesses to Holaspirit
javascriptholaspiritmcpmodelcontextprotocolservernpm install syucream/holaspirit-mcp-server - id-generator-mcp 📜 🏠 (⭐ 1, 🍴 2, 🐛 1) - This is a Model Context Protocol (MCP) server that provides ID generation capabilities to AI assistants.
javascriptmcpserverainpm install devstacks-software-engineering/id-generator-mcp - interactive-feedback-macos-mcp 📜 🏠 (⭐ 1) - A native macOS MCP server for collecting interactive user feedback with AppleScript dialogs and image support.
javascriptfeedbackinteractivemacosmcpnpm install gmh5225/interactive-feedback-macos-mcp - IzumiSy_mcp-duckdb-memory-server 📘 🏠 (⭐ 1, 🍴 1, 🐛 5) - Mirror of https://github.com/IzumiSy/mcp-duckdb-memory-server
typescriptmcpserverhttpnpm install MCP-Mirror/IzumiSy_mcp-duckdb-memory-server - JsonPlaceHolder-MCP 📘 🏠 (⭐ 1) - A simple mcp server of JsonPlaceHolder.
typescriptmcpserverjsonnpm install p-gokul/JsonPlaceHolder-MCP - leonardo-ai-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 1) - MCP server for Leonardo AI API - Free daily credits for AI image generation
javascriptmcpserverapiainpm install nikolausm/leonardo-ai-mcp-server - linear-mcp 📘 🏠 📇 (⭐ 1, 🍴 1) - A Linear MCP implementation that handles all Linear resource types.
typescriptlinear-appmcpmcp-servergonpm install anoncam/linear-mcp - mcp-agile-luminary 📜 🏠 (⭐ 1) - An MCP server for connecting with Agile Luminary Project Management Application
javascriptagile-developmentclaude-codecursor-aimcp-servernpm install AgileLuminary/mcp-agile-luminary - mcp-atp 📘 🏠 (⭐ 1) - Model Context Protocol Server for IQAI's Agent tokenization platform
typescriptmcp-serverserverainpm install IQAIcom/mcp-atp - mcp-bitpanda 📘 🏠 📇 (⭐ 1, 🍴 2, 🐛 2) - An MCP server for interacting with the Bitpanda API
typescriptmcpserverapinpm install matteoantoci/mcp-bitpanda - mcp-brave-search 🐍 🏠 (⭐ 1) - Python-based
httpaigitgithubpythonpip install git+https://github.com/thomasvan/mcp-brave-search - mcp-clever-demo 📜 🏠 (⭐ 1, 🍴 2, 🐛 2) - Have fun with MCP from Clever Cloud's documentation and Clever Tools
javascriptclevercloudmcpmcp-servernodejsnpm install davlgd/mcp-clever-demo - mcp-hko 📘 🏠 (⭐ 1, 🍴 1) - Fetch data from Hong Kong Observatory with MCP
typescripthong-konghongkongmcpmcp-serversnpm install louiscklaw/hko-mcp - 23andme-raw-data-lookup-mcp 📜 🏠 (⭐ 1) - MCP server for 23andMe genetic data retrieval by RSID
javascriptmcpservernpm install obuchowski/23andme-raw-data-lookup-mcp - albion_mcp 📘 🏠 (⭐ 1) - Model Context Protocol (MCP) compatible server focused on the sandbox game Albion Online, for AI agents.
typescriptmcpserverainpm install adryansf/albion_mcp - Cardano_MCP 📘 🏠 (⭐ 1, 🍴 1) - A specialized RAG gateway providing language models with Cardano blockchain knowledge. Enables AI assistants to access documentation, validate smart contracts, understand UTXO patterns, and discover development resources. Built on the MCP TypeScript SDK. Open-source.
typescriptcardanomcp-servermcpainpm install Jimmyh-world/Cardano_MCP - chatvolt-mcp 📘 🏠 📇 (⭐ 1) - A Model Context Protocol server that wraps the Chatvolt API, providing tools to manage agents, datastores, and CRM workflows.
typescriptserverapinpm install MiguelMartinezCV/chatvolt-mcp - dex-mcp-server 📜 🏠 📇 (⭐ 1, 🐛 5) - A Model Context Protocol (MCP) server for comprehensive contact relationship management through the Dex API
javascriptmcpserverapinpm install alpabon73/dex-mcp-server - duck-duck-scrape-mcp 📜 🏠 (⭐ 1, 🐛 1) - An MCP server for (free!) search results via duckduckgo
javascriptmcpservergonpm install mmkal/duck-duck-scrape-mcp - ebird-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 1, 🐛 2) - A Model Context Protocol (MCP) server for the eBird API, allowing Claude and other AI assistants to access bird observation data, hotspots, and taxonomy information. Easy integration with Claude Desktop.
javascriptbirdwatchingclaude-desktopebirdmodel-context-protocolnpm install moonbirdai/ebird-mcp-server - ens-mcp-server 📘 🏠 (⭐ 1) - An MCP server for Ethereum Name Service resolutions
typescriptmcpservernpm install josheleonard/ens-mcp-server - f4ww4z_mcp-mysql-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/f4ww4z/mcp-mysql-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/f4ww4z_mcp-mysql-server - FbAdLibraryMCPServer 📘 🏠 📇 (⭐ 1) - Build a Model Context Protocol (MCP) server that provides access to Facebook's Ad Library through web scraping. The server should allow clients to search for advertisements with various filters and retrieve comprehensive ad data.
typescriptmcpserverapiwebnpm install StinCodes/FbAdLibraryMCPServer - file_system_mcp 💎 🏠 (⭐ 1) - Ruby server implementing Model Context Protocol (MCP) for filesystem operations using the https://rubygems.org/gems/vector_mcp gem.
rubymcpmcp-serverserverhttpgit clone https://github.com/sergiobayona/file_system_mcp - finbud-data-mcp 📘 🏠 📇 (⭐ 1, 🍴 2, 🐛 1) - AI & Developer centric financial data API
typescriptfinancial-datafinancial-marketsmcpmcp-servernpm install glaksmono/finbud-data-mcp - flow-mcp-server 📜 🏠 (⭐ 1, 🍴 2, 🐛 1) - Model Context Protocol (MCP) server for Flow blockchain with direct RPC communication
javascriptmcpserverainpm install lmcmz/flow-mcp-server - flux-image-generator-mcp 📘 🏠 (⭐ 1, 🍴 2, 🐛 1) - flux-image-generator-mcp
typescriptmcpnpm install frankdeno/flux-image-generator-mcp - freepik-flux-server 📜 🏠 📇 (⭐ 1) - MCP server for generating images with Freepik Flux-Dev API
javascriptmcpserverapinpm install grafikogr/freepik-flux-server - mcp-get_community-servers 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/mcp-get/community-servers
javascriptmcpserverhttpnpm install MCP-Mirror/mcp-get_community-servers - mcp-iqwiki 📘 🏠 (⭐ 1, 🍴 1) - Model Context Protocol Server for interacting with IQ.wiki content
typescriptmcp-serverservernpm install IQAIcom/mcp-iqwiki - mcp-playwright-test 📘 🏠 📇 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server for automating Playwright tests
apihttpaigitgithubnpm install w1561778301/mcp-playwright-test - mcp-prompts 📜 🏠 (⭐ 1, 🐛 1) - This server allows you to create, organize, and serve prompt templates that can be used by MCP clients for various tasks like meeting analysis, content summarization, and blog post creation.
javascriptmcpmcp-serverprompts-templateservernpm install tubone24/mcp-prompts - mcp-server-spinnaker 📘 🏠 (⭐ 1, 🍴 2, 🐛 1) - MCP Server for Spinnaker integrations.
typescriptmcpservernpm install dion-hagan/mcp-server-spinnaker - mcp-url2markdown 🐍 🏠 (⭐ 1) - url to markdown mcp server
webhttpgitgithubpythonpip install git+https://github.com/sungithubid/mcp-url2markdown - mendableai_firecrawl-mcp-server 📜 🏠 (⭐ 1) - Mirror of https://github.com/mendableai/firecrawl-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/mendableai_firecrawl-mcp-server - neo4j-fastmcp-server 📘 🏠 (⭐ 1) - Neo4j MCP Server built with FastMCP TypeScript framework, featuring OAuth authentication and Docker support
typescriptmcpserverauthoauthnpm install artur-nohup/neo4j-fastmcp-server - newrelic-mcp 📜 🏠 (⭐ 1, 🍴 1) - Model Context Protocol server for New Relic observability platform integration
javascriptservernpm install cloudbring/newrelic-mcp - querysharp-mcp 📘 🏠 (⭐ 1, 🐛 1) - MCP tool to integrate querysharp in code editors like cursor. Gives the ability to ask "fix my database" to your code editor
typescriptmcpdatabasenpm install WeePulse/querysharp-mcp - sdof-mcp 📘 🏠 (⭐ 1, 🍴 1) - Structured Decision Optimization Framework (SDOF) MCP Server - Next-generation knowledge management with 5-phase optimization workflow
typescriptmcpservernpm install tgf-between-your-legs/sdof-mcp - solid-mcp 📘 🏠 (⭐ 1, 🐛 1) - Access data in a Solid Pod using the Model Context Protocol
typescriptnpm install jeswr/solid-mcp - weather-server 📜 🏠 (⭐ 1) - A weather information server built using Model Context Protocol (MCP) to provide real-time weather data and forecasts
javascriptmcpservernpm install pg-yuly/weather-server - TaazKareem_clickup-mcp-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/TaazKareem/clickup-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/TaazKareem_clickup-mcp-server - telos-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - T/MCP is a powerful MCP server that provides access to Telos, a philosophical AI mentor.
typescriptmcpserverainpm install AporiaLabs/telos-mcp - threads-mcp 📘 🏠 (⭐ 1, 🍴 1) - Threads (Meta) MCP server
typescriptmcpservernpm install tttn13/threads-mcp - wikijs-mcp 📘 🏠 (⭐ 1, 🍴 3) - TypeScript-based
typescriptnpm install RicardoCenci/wikijs-mcp - Mcp-Puppeteer-Server 📜 🏠 (⭐ 1, 🍴 2, 🐛 1) - MCP Puppeteer Server HomeAssistant Add-on
javascriptmcpservernpm install rotexhawk/Mcp-Puppeteer-Server - mcp-server-ts-trello 📜 🏠 (⭐ 1, 🍴 7, 🐛 4) - TypeScript implementation of a Model Context Protocol (MCP) server for Trello integration
javascriptmcpservernpm install andypost/mcp-server-ts-trello - mcp-serverless 📘 🏠 (⭐ 1, 🍴 3) - Serverless implementation of the Model Context Protocol (MCP)
typescriptmcpservernpm install tilfin/mcp-serverless - r2-upload-mcp-server 📜 🏠 (⭐ 1) - Cloudflare R2 Upload MCP Server
javascriptmcpservernpm install leonho/r2-upload-mcp-server - mcp-supabase 📜 🏠 (⭐ 1, 🍴 1, 🐛 1) - Mcp server for supabase
javascriptmcpservernpm install stefanraath3/mcp-supabase - sanity-mcp-server 📘 🏠 (⭐ 1, 🍴 2) - MCP for interacting with Sanity IO projects.
typescriptmcpnpm install jlmelis/sanity-mcp-server - sidemail-mcp-server 📜 🏠 (⭐ 1) - Sidemail.io's official MCP Server
javascriptmcpserverainpm install sidemail/sidemail-mcp-server - stata-mcp-server 📜 🏠 (⭐ 1) - MCP server for stata do file
javascriptmcpservernpm install mkprevo/stata-mcp-server - pingcode-mcp-server 📘 🏠 (⭐ 1) - PingCode's MCP Server
typescriptmcpservernpm install shaunxu/pingcode-mcp-server - playwright_mcp_programmatic 📘 🏠 (⭐ 1) - Testing Programmatic Access for Playwright MCP Server
typescriptmcpservertestingnpm install hydroweaver/playwright_mcp_programmatic - ragdb-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - MCP対応のRAGシステム。Markdownドキュメントをベクトル化し、自然言語で高速検索。LibSQL、Qdrant、PostgreSQLに対応してます。
typescriptlibsqlmcpmcp-serverpostgresqlnpm install musoukun/ragdb-mcp - seta-mcp 📘 🏠 (⭐ 1, 🍴 2, 🐛 1) - MCP server powered by local documentation
typescriptlocalmcpmcp-servermodel-context-protocolnpm install techformist/seta-mcp - simple-notion-mcp-server 📘 🏠 (⭐ 1, 🐛 2) - Notion MCP server that uses Markdown for better LLM support
typescriptmcpserverllmnpm install larryhudson/simple-notion-mcp-server - SuMiaoALi_mysql-mcp-server 📜 🏠 (⭐ 1) - Mirror of https://github.com/SuMiaoALi/mysql-mcp-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/SuMiaoALi_mysql-mcp-server - unstorage-mcp 📘 🏠 (⭐ 1, 🍴 1) - Key-Value storage MCP server based on unjs/unstorage, support drivers: redis, mongodb, filesystem. http
typescriptkv-storemcpmcp-serverunstoragenpm install slow-groovin/unstorage-mcp - claude-desktop-mcp 📘 🏠 (⭐ 1) - TypeScript-based
typescriptnpm install tkc/claude-desktop-mcp - cloudstorage-mcp 📜 🏠 (⭐ 1) - MCP Server to interact with Google Cloud Storage
javascriptmcpservergonpm install gitskyflux/cloudstorage-mcp - 66julienmartin_MCP-server-Deepseek_R1 📜 🏠 (⭐ 1) - Mirror of https://github.com/66julienmartin/MCP-server-Deepseek_R1
javascriptmcpserverhttpnpm install MCP-Mirror/66julienmartin_MCP-server-Deepseek_R1 - alertmanager-mcp 📘 🏠 (⭐ 1, 🍴 3) - A Model Context Protocol (MCP) server that integrates with Prometheus Alertmanager
typescriptmcpserverhttpgitnpm install kaznak/alertmanager-mcp - alxspiker_mcp-server-ftp 📜 🏠 (⭐ 1) - Mirror of https://github.com/alxspiker/mcp-server-ftp
javascriptmcpserverhttpnpm install MCP-Mirror/alxspiker_mcp-server-ftp - aviation-mcp 📘 🏠 (⭐ 1) - MCP Server for Aviation LLM interactions
typescriptmcpserverllmnpm install finack/aviation-mcp - coding_devops_mcp_server 📘 🏠 (⭐ 1) - coding_devops_mcp_server
typescriptmcpservernpm install yupengfei1209/coding_devops_mcp_server - coin_daemon_mcp 📘 🏠 (⭐ 1, 🍴 3, 🐛 3) - MCP server for interacting with cryptocurrency daemon RPC interfaces (BETA)
typescriptmcpservernpm install raw391/coin_daemon_mcp - compresto-mcp 📘 🏠 (⭐ 1, 🍴 2, 🐛 1) - Compresto MCP server
typescriptmcpserverrestnpm install dqhieu/compresto-mcp - coingecko-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 1, 🐛 1) - A Node.js Express server that provides a simplified and configurable interface to the CoinGecko cryptocurrency data API
javascriptserverapinodenpm install GaplyDev01/coingecko-mcp-server - external-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - This server enables AI models & Agents to interact with and search data from multiple curated sources through a unified MCP (model context protocol) server..
typescriptmcpserverainpm install recallnet/data-omnifeeds-mcp - fastmcp-server-generator 📜 🏠 (⭐ 1, 🍴 1) - A specialist MCP server that helps users create custom MCP servers
javascriptmcpservernpm install hotelbuddy-online/fastmcp-server-generator - fetch-mcp-server 📘 🏠 (⭐ 1) - fetch urls from webpage using playwright , sse mcp server & nodejs expressjs
typescriptmcpserverwebnodenpm install pnparadise/fetch-mcp-server - Anki-MCP-Server 📜 🏠 (⭐ 1, 🍴 2, 🐛 1) - Anki MCP Server to allow LLMs to create and manage Anki decks via Anki Connect
javascriptmcpserverllmnpm install ethangillani/Anki-MCP-Server - ankr-mcp 📘 🏠 📇 (⭐ 1, 🍴 1, 🐛 1) - MCP server for Ankr APIs
typescriptmcpserverapinpm install akki91/ankr-mcp - arbitrum_mcp_server 📘 🏠 📇 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server that provides real-time Arbitrum blockchain data analysis using the Arbiscan API and Claude AI.
typescriptmcpserverapiainpm install 0xRecruiter/arbitrum_mcp_server - 1broseidon_mcp-jira-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/1broseidon/mcp-jira-server
javascriptmcpserverhttpnpm install MCP-Mirror/1broseidon_mcp-jira-server - boamp-server 📜 🏠 📇 (⭐ 1, 🍴 1) - Serveur MCP (Model Context Protocol) pour interroger l'API BOAMP et récupérer les avis de marchés publics. Ce serveur permet de rechercher des marchés publics en utilisant divers critères et d'obtenir des détails complets sur des marchés spécifiques.
javascriptavispublicsboampmcp-servermcpnpm install stefw/boamp-server - cd-mcp-proxy 📘 🏠 (⭐ 1, 🍴 1) - Extend MCP server functionality to work as a worker
typescriptmcpservernpm install 12beam/cd-mcp-proxy - cf-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - An MCP server on Cloudflare Workers
typescriptmcpservernpm install anishgowda21/cf-mcp-server - felores_gdrive-mcp-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/felores/gdrive-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/felores_gdrive-mcp-server - fetch_mcp 📘 🏠 (⭐ 1, 🐛 1) - Fetch MCP Server (TypeScript-based)
typescriptmcpservernpm install phpmac/fetch_mcp - figma-mcp-cursor 📜 🏠 (⭐ 1) - Node.js-based
javascriptnpm install lookymlive/figma-mcp-cursor - gdli6177_mcp-prompt-server 📜 🏠 (⭐ 1) - Mirror of https://github.com/gdli6177/mcp-prompt-server
javascriptmcpserverhttpnpm install MCP-Mirror/gdli6177_mcp-prompt-server - GongRzhe_Calendar-MCP-Server 📜 🏠 (⭐ 1, 🍴 4) - Mirror of https://github.com/GongRzhe/Calendar-MCP-Server
javascriptmcpserverhttpgonpm install MCP-Mirror/GongRzhe_Calendar-MCP-Server - greyhack-mcp-server 📘 🏠 📇 (⭐ 1, 🍴 4, 🐛 3) - A Grey Hack MCP server for Cursor IDE with GitHub code search, Greybel-JS transpilation, API validation and script generation
typescriptmcpserverapinpm install chromewillow/greyhack-mcp-server - hono-remote-mcp-sample 📘 🏠 (⭐ 1, 🍴 1) - Remote MCP server sample (Hono + Cloudflare Workers + Durable Objects)
typescriptmcpservernpm install 7nohe/hono-remote-mcp-sample - india-flight-mcp 📜 🏠 (⭐ 1) - MCP server to find the cheapest air fare
javascriptmcpserverainpm install ravi-bytes/india-flight-mcp - israeli-bank-scrapers-mcp-demo 📜 🏠 (⭐ 1) - A Model Context Protocol (MCP) server that demonstrates how to scrape financial data using the israeli-bank-scrapers library
javascriptmcpservernpm install shlomiuziel/israeli-bank-scrapers-mcp-demo - landicefu_divide-and-conquer-mcp-server 📜 🏠 (⭐ 1) - Mirror of https://github.com/landicefu/divide-and-conquer-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/landicefu_divide-and-conquer-mcp-server - local-tts-mcp 📘 🏠 (⭐ 1) - Local text-to-speech MCP server with dual engines (macOS Say + Kokoro TTS) for Claude Desktop
typescriptmcpservernpm install SmartLittleApps/local-tts-mcp - Malove86_mcp-mysql-server 📜 🏠 (⭐ 1) - Mirror of https://github.com/Malove86/mcp-mysql-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/Malove86_mcp-mysql-server - mcp_client_7ex 📘 🏠 (⭐ 1) - mcp client example , electron react
typescriptelectronmcpmcp-servernextjsnpm install kuc-arc-f/mcp_client_7ex - MCP_USDA_Server_Quantized 📜 🏠 (⭐ 1) - MCP Server Template for USDA Tools
javascriptmcpservernpm install AntonioPavoni/MCP_USDA_Server_Quantized - mcp-desk 📘 🏠 (⭐ 1) - A Desktop Application To Interact With Your MCP Servers
typescriptmcpservernpm install debsouryadatta/mcp-desk - mcp-for-programmer 📘 🏠 (⭐ 1, 🍴 3) - 一个为程序员学习助力的Model Context Protocol服务器。
typescriptmcpmcp-promptsmcp-servernpm install zaizaizhao/mcp-for-programmer - mcp-jira-git 📘 🏠 (⭐ 1) - MCP Server - Jira & Git Integration
typescriptmcpservernpm install kashuta/mcp-jira-git - mcp-wait-server 📜 🏠 (⭐ 1) - MCP Server to allow AI models to wait
javascriptmcpserverainpm install Amico1285/mcp-wait-server - mcp-web-client 📘 🏠 (⭐ 1, 🐛 2) - A web client for managing MCP servers and tools
typescriptmcpserverwebnpm install AVGenAI/mcp-web-client - mcp4humans 📘 🏠 (⭐ 1, 🍴 1) - User-friendly client for Model Context Protocol (MCP) servers - connect, manage, and execute MCP tools directly in VS Code
typescriptmcpservernpm install daninemonic/mcp4humans - my-mcp-server-github-auth 📘 🏠 (⭐ 1, 🍴 1) - Example MCP server with OAuth based on https://developers.cloudflare.com/agents/guides/remote-mcp-server/
typescriptmcpserverauthoauthnpm install fredrikp999/my-mcp-server-github-auth - mcp-json-tools 📜 🏠 (⭐ 1) - MCP server providing tools to query, inspect, and modify local JSON files.
javascriptmcpserverjsonnpm install zfirsty/mcp-json-tools - mcp-memory-server 📜 🏠 (⭐ 1) - Standalone MCP server for enabling memory for Claude through a knowledge graph
javascriptmcpservernpm install s2005/mcp-memory-server - mcp_poker 📘 🏠 (⭐ 1, 🍴 3, 🐛 2) - TypeScript-based
typescriptnpm install freshlife001/mcp_poker - mcp-avantage 📜 🏠 📇 (⭐ 1, 🍴 2, 🐛 3) - MCP Server for the Alpha Vantage API
javascriptmcpserverapinpm install MissionSquad/mcp-avantage - mcp-landiwetter 📜 🏠 (⭐ 1, 🍴 2) - a simple PoC on how to integrate a custom data-provider in an MCP Server
javascriptmcpservernpm install nabossha/mcp-landiwetter - mcp-pdf-parse 📘 🏠 (⭐ 1, 🐛 2) - MCP server for parsing data from a pdf url
typescriptmcpservernpm install Khush08/mcp-pdf-parse - mcp-perplexity-api 📘 🏠 📇 (⭐ 1, 🍴 2) - A MCP Perplexity API server written in Typescript with stdio and SSE transport support.
typescriptmcpserverapinpm install sibbl/mcp-perplexity-api - mcp-pro 📘 🏠 (⭐ 1) - Package all your MCP servers into a single Remote MCP Gateway for one click installations, MCP analytics, creating/sharing MCP packages, and more...
typescriptmcpservernpm install falktravis/mcp-library - cosmosdb-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - Azure Cosmos DB MCP Client and Server
typescriptmcpserverazurenpm install patrice-truong/cosmosdb-mcp - custom-context-mcp 📘 🏠 (⭐ 1) - This Model Context Protocol (MCP) server provides tools for structuring and extracting data from text according to JSON templates.
typescriptmcpserverjsonnpm install omer-ayhan/custom-context-mcp - doggybee_mcp-server-leetcode 📘 🏠 (⭐ 1, 🍴 1, 🐛 2) - Mirror of https://github.com/doggybee/mcp-server-leetcode
typescriptmcpserverhttpnpm install MCP-Mirror/doggybee_mcp-server-leetcode - EmanuelJr_web3-mcp-server 📘 🏠 (⭐ 1) - Mirror of https://github.com/EmanuelJr/web3-mcp-server
typescriptmcpserverwebhttpnpm install MCP-Mirror/EmanuelJr_web3-mcp-server - Employees-Airdrop-Rewards-MCP 📘 🏠 (⭐ 1, 🍴 3, 🐛 3) - A MCP Server to launch a token, add value to it, distribute to your employees via email
typescriptmcpserverainpm install monostate/Employees-Airdrop-Rewards-MCP - fish-speech-mcp 📜 🏠 (⭐ 1) - An MCP server for text-to-speech synthesis (TTS) for LLMs.
javascriptmcpserverllmnpm install demon24ru/fish-speech-mcp - g0t4_mcp-server-memory-file 📘 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/g0t4/mcp-server-memory-file
typescriptmcpserverhttpnpm install MCP-Mirror/g0t4_mcp-server-memory-file - garc33_bitbucket-server-mcp-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/garc33/bitbucket-server-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/garc33_bitbucket-server-mcp-server - mcp-client-helper 📘 🏠 (⭐ 1) - mcp client helper(管理,执行 mcp server)
typescriptmcpservernpm install Yangbin-v/mcp-client-helper - mcp-evolution-api 📘 🏠 📇 (⭐ 1) - MCP server for evolution api, the non official api for whatsapp
typescriptmcpserverapinpm install genera-ai/mcp-evolution-api - home-assistant-mcp-server 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - home-assistant-mcp-server
typescriptmcpservernpm install oleander/home-assistant-mcp-server - ibproduct_ib-mcp-cache-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/ibproduct/ib-mcp-cache-server
javascriptmcpserverhttpnpm install MCP-Mirror/ibproduct_ib-mcp-cache-server - jeanibarz_knowledge-base-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/jeanibarz/knowledge-base-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jeanibarz_knowledge-base-mcp-server - kevinwatt_mcp-server-searxng 📜 🏠 (⭐ 1) - Mirror of https://github.com/kevinwatt/mcp-server-searxng
javascriptmcpserverhttpnpm install MCP-Mirror/kevinwatt_mcp-server-searxng - kfastov_telegram-mcp-server 📜 🏠 (⭐ 1) - Mirror of https://github.com/kfastov/telegram-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/kfastov_telegram-mcp-server - laptou_rust-docs-mcp-server 📘 🏠 (⭐ 1) - Mirror of https://github.com/laptou/rust-docs-mcp-server
typescriptmcpserverhttprustnpm install MCP-Mirror/laptou_rust-docs-mcp-server - LiusCraft_superset-mcp-server 📘 🏠 (⭐ 1) - Mirror of https://github.com/LiusCraft/superset-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/LiusCraft_superset-mcp-server - mailpace-mcp 📘 🏠 (⭐ 1, 🍴 4, 🐛 4) - An Model Context Protocol (MCP) Server for Transactional Email Provider MailPace
typescriptmcpserverainpm install mailpace/mailpace-mcp - kablewy_financial-analysis-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/kablewy/financial-analysis-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/kablewy_financial-analysis-mcp-server - math-mcp 📜 🏠 (⭐ 1, 🍴 1) - Demo of MCP client/server using durable objects for trackings state
javascriptmcpservernpm install dinasaur404/math-mcp - mcp_sse_sample 📘 🏠 (⭐ 1, 🍴 1) - MCP ServerのSSE実装のサンプル
typescriptmcpservernpm install iuill/mcp_sse_sample - mcp-delete 📜 🏠 (⭐ 1, 🍴 5, 🐛 2) - A Model Context Protocol (MCP) server that provides file deletion capabilities for AI assistants. Supports both relative and absolute paths with smart path resolution, making it easy for AI assistants to safely delete files when needed.
javascriptmcpserverainpm install qpd-v/mcp-delete - mcp-mindmesh 📘 🏠 (⭐ 1, 🍴 1) - Claude 3.7 Swarm with Field Coherence: A Model Context Protocol (MCP) server that orchestrates multiple specialized Claude 3.7 Sonnet instances in a quantum-inspired swarm. It creates a field coherence effect across pattern recognition, information theory, and reasoning specialists to produce optimally coherent responses from ensemble intelligence.
typescriptclaude-3-7-sonnetclaude-apigemini-2-5-pro-expmcpnpm install wheattoast11/mcp-mindmesh - MCP-MONI 📘 🏠 (⭐ 1) - MCP MONI is a backend server that can execute commands like token swaps and transfers on the Monad network. It’s designed for easy integration with chat UIs or other applications.
typescriptmcpservernpm install deseti/MCP-MONI - mcp-server-mssql 📘 🏠 (⭐ 1) - MCP Server for MS SQL Integration - Provides ModelContextProtocol support for Microsoft SQL Server
typescriptmcpservernpm install TerraCo89/mcp-server-mssql - mcp-proxy-sidecar 📜 🏠 (⭐ 1, 🍴 1, 🐛 1) - A fork of JetBrains MCP Server that adds real-time WebSocket monitoring of all MCP interactions
javascriptmcpserverwebainpm install dortegau/mcp-proxy-sidecar - mcp-qdrant-docs 📘 🏠 (⭐ 1) - An MCP server that scrapes websites, indexes content into Qdrant, and provides a query tool.
typescriptmcpserverwebnpm install kazuph/mcp-qdrant-docs - mcp-server 📜 🏠 (⭐ 1) - mcp server (Node.js-based)
javascriptmcpservernpm install pranavmanoj1/mcp-server - mcp-server 📘 🏠 (⭐ 1, 🐛 1) - MCP server for the Apache Camel based Weik.io Integration Platform
typescriptmcpservernpm install weikio/mcp-server - mcp-server-example-image-block 📜 🏠 📇 (⭐ 1) - An example MCP server that sends image blocks
apihttpgitgithubjavascriptnpm install larryhudson/mcp-server-example-image-block - mcp-server-guide 🏠 (⭐ 1) - A comprehensive guide and example implementations for building Model Context Protocol (MCP) servers in Python and TypeScript.
example-codemcpmodel-context-protocolpython-sdktypescript-sdkgit clone https://github.com/kaianuar/mcp-server-guide - MCP-Server-CommandLine 📘 🏠 (⭐ 1) - This is a simple MCP-Server for command line, and the main idea belongs to hdcola
typescriptmcpserverainpm install Allenyzh/MCP-Server-CommandLine - Mcp-server-createanyhtmlapp 📜 🏠 (⭐ 1) - 🚀 MCP Server & VSCode Extension A powerful tool that enables developers to create full-fledged web applications using natural language prompts. Built with an MCP Server and a VSCode extension, it integrates with Google's LLM 🤖 to generate HTML, CSS, and JavaScript code. 🎨💻
javascriptmcpserverwebmlnpm install Suryansh1987/Mcp-server-createanyhtmlapp - mcp-server-linear 📘 🏠 📇 (⭐ 1, 🍴 1, 🐛 11) - Model Context Protocol (MCP) server for interacting with the Linear API. This server provides tools and resources for accessing and manipulating Linear issues, projects, and other data through a standardized MCP interface.
typescriptmcpserverapinpm install mkusaka/mcp-server-linear - mcp-whats-the-passphrase 📜 🏠 (⭐ 1, 🍴 3, 🐛 2) - Example node MCP server. When a user asks the agent for the passphrase, a special code phase is provided.
javascriptboilerplatemcpmcp-servermodel-context-protocolnpm install gbti-network/mcp-basic-test - mcpDemo 📜 🏠 (⭐ 1, 🍴 1) - MCP Server demo (Node.js-based)
javascriptmcpservernpm install davlgd/mcpDemo - moralis-mcp 📜 🏠 📇 (⭐ 1) - A powerful Model Context Protocol (MCP) server implementation that provides seamless access to Moralis Web3 API endpoints for querying blockchain data across multiple networks, including NFTs, tokens, wallet analytics, and DeFi positions.
javascriptmcpserverapiwebnpm install a6b8/moralis-mcp - neurosift-mcps 📜 🏠 (⭐ 1, 🍴 1, 🐛 1) - MCP servers for neurosift
javascriptmcpservernpm install magland/neurosift-mcps - symbol-blockchain-mcp-server 📘 🏠 📇 (⭐ 1, 🍴 1) - Symbol Blockchain MCP Server. (REST API tools)
typescriptblockchainmcp-serversymbolmcpnpm install husqvaluna/symbol-mcp-server - test-neon-mcp-server-waku 📘 🏠 (⭐ 1) - RSC Demo using Neon's MCP Server and Waku ⛩️
typescriptmcpservernpm install PaulieScanlon/test-neon-mcp-server-waku - mcp-server-diceroll 📘 🏠 (⭐ 1) - fumievalさんのパクリ (TypeScript-based)
typescriptnpm install shimapon/mcp-server-diceroll - mcp-server-hub 📘 🏠 (⭐ 1, 🍴 1) - mcp-server 合集 (TypeScript-based)
typescriptmcpservernpm install JQSC/mcp-server-hub - nns-mcp 📘 🏠 (⭐ 1) - Nad Name Service MCP Server
typescriptmcpservernpm install nadnameservice/nns-mcp - notepad-server 📜 🏠 (⭐ 1, 🍴 1) - Notes server based on TypeScript implementation of the MCP protocol, providing functions for adding, removing, and updating notes, and supporting integration with Claude Desktop.基于 TypeScript 实现的 MCP 协议笔记服务器,提供笔记的添加、删除、更新等功能,支持与 Claude Desktop 集成。
javascriptmcpservernpm install GuoAccount/notepad-server - olostep-mcp-server 📘 🏠 (⭐ 1, 🍴 2, 🐛 3) - TypeScript-based
typescriptwebhttpgitgithubnpm install olostep/olostep-mcp-server - mcp-servers 📜 🏠 (⭐ 1, 🍴 1, 🐛 1) - MCP Servers to extend functionality
javascriptmcpservernpm install ihiteshsharma/mcp-servers - mcp-sse 📘 🏠 (⭐ 1, 🍴 1) - demo of MCP SSE server limitations using the bun runtime
typescriptmcpservernpm install the-vampiire/mcp-sse - mcp-sse-server-demo 📘 🏠 (⭐ 1) - mcp sse server demo (TypeScript-based)
typescriptmcpservernpm install arthur-vr/mcp-sse-server-demo - mcp-stock-market 📘 🏠 📇 (⭐ 1, 🍴 2, 🐛 3) - MCP server to connect to the Alpha Vantage APIs
typescriptmcpserverapinpm install ctoouli/mcp-stock-market - mcp-teamate-server 📘 🏠 (⭐ 1, 🍴 1) - Teamate MCP 服务器端 (TypeScript-based)
typescriptmcpnpm install aokihu/mcp-teamate-server - mcp-thinking-tool 📘 🏠 (⭐ 1, 🍴 1) - TypeScript-based
typescriptnpm install piotrpalek/mcp-thinking-tool - mcp-vercel 📘 🏠 (⭐ 1, 🍴 1, 🐛 3) - free MCP server hosting using vercel
typescriptmcpservernpm install sweetmantech/next-mcp - mcpilled 📜 🏠 (⭐ 1, 🍴 1, 🐛 11) - MCPilled.com is a collection of curated news about MCP servers, clients, protocol updates and everything else MCP
javascriptmcpservernpm install altryne/mcpilled - minimal-mcp-server 📜 🏠 (⭐ 1, 🍴 1) - A minimal implementation of a Model Context Protocol (MCP) server
javascriptcursormcpmcp-serverstarternpm install LeZuse/minimal-mcp-server - N8N-api-MCP 📜 🏠 (⭐ 1) - MCP Server for interacting with an n8n instance
javascriptmcpservernpm install jasondsmith72/N8N-api-MCP - openapi-to-mcpserver 📘 🏠 📇 (⭐ 1) - Converts an OpenAPI specification file into an MCP server
typescriptmcpserverapinpm install spaceguy101/openapi-to-mcpserver - tetris-mcp 📜 🏠 (⭐ 1) - MCP Server capable of operating Tetris board
javascriptmcpservernpm install EdamAme-x/tetris-mcp - typescript-definition-finder-mcp 📜 🏠 (⭐ 1, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server that helps AI code editors find TypeScript symbol definitions in your codebase. This tool is particularly useful when you need to locate the original definition of imported symbols, classes, interfaces, or functions in a TypeScript project.
javascriptmcpserverainpm install runninghare/typescript-definition-finder-mcp - vectra-mcp-server 📘 🏠 📇 (⭐ 1, 🍴 1) - An MCP server providing tools to manage and query a Vectra knowledge base, enabling integration with MCP clients via a backend API.
typescriptmcpserverapinpm install dangvu0502/vectra-mcp - WalletMCP 📘 🏠 (⭐ 1) - A Simple MCP Server For Interacting With Solana Wallets
typescriptsolanasolana-balance-checkerwebweb3jsnpm install paulfruitful/WalletMCP - YCloud-Developers_ycloud-whatsapp-mcp-server 📘 🏠 (⭐ 1) - Mirror of https://github.com/YCloud-Developers/ycloud-whatsapp-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/YCloud-Developers_ycloud-whatsapp-mcp-server - plasma 💎 🏠 (⭐ 1, 🍴 3, 🐛 3) - A Rails-inspired Ruby SDK for building Model Context Protocol (MCP) servers
rubymcpserveraigit clone https://github.com/plasma-mcp/plasma - powerpoint-generator-mcp 📜 🏠 (⭐ 1, 🍴 1, 🐛 1) - A PowerPoint generator for Model Context Protocol (MCP) using Bun (Note: Unable to read/edit existing presentation)
javascriptmcpmcp-servernpm install Pylogmon/powerpoint-generator-mcp - prayer-time-mcp-server 📜 🏠 (⭐ 1) - A MCP server giving Salat (Namaz | Prayer) time for 5 daily prayers with middle of night, sunset and sunrise.
javascriptmcpserverainpm install imsaar/prayer-time-mcp-server - property-prices-mcp 📘 🏠 (⭐ 1) - UK Property Price Search MCP Server
typescriptmcpservernpm install joemclo/property-prices-mcp - re-stack-mcp 📘 🏠 📇 (⭐ 1, 🍴 3, 🐛 2) - Re-Stack MCP server is designed to integrate Stack Overflow into LLM-based coding workflows using the Stack Exchange API
typescriptmcpserverapillmnpm install jagreetdg/re-stack-mcp - remote-mcp-server-authless-andor 📘 🏠 (⭐ 1, 🍴 1) - Remote MCP server to summarize/scrape Andor season 2 episodes using Browser Rendering and Workers AI
typescriptbrowser-renderingclaudeclaude-mcpcloudflarenpm install elizabethsiegle/remote-mcp-server-authless-andor - pokemon-mcp-server 📘 🏠 📇 (⭐ 1) - This a MCP server that allows clients to fetch Pokemon Data via the official Pokemon API
typescriptmcpserverapinpm install indroneelray/pokemon-mcp-server - realtime-crypto-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - A real-time cryptocurrency data provider for Model Context Protocol servers.
typescriptservernpm install smhnkmr/realtime-crypto-mcp-server - recurse-mcp 📜 🏠 (⭐ 1) - An MCP server for the Recurse Center
javascriptmcpservernpm install namanyayg/recurse-mcp - repo-analyzer-mcp 📘 🏠 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server for analyzing code repositories with special tools for the Nostr protocol and NDK.
typescriptmcpservernpm install DocNR/repo-analyzer-mcp - Shodan-MCP-Server-Inspector 📜 🏠 📇 (⭐ 1, 🐛 1) - This is a Model Context Protocol (MCP) server that provides access to the Shodan API. It allows you to programmatically query Shodan for information about devices, vulnerabilities, and more.
javascriptmcpserverapinpm install X3r0K/Shodan-MCP-Server-Inspector - Spotify-Playlist-Curator-MCP-Server 📜 🏠 (⭐ 1) - MCP server that can analyze your Spotify playlists and use Claude to recommend songs based on the mood, vibe, BPM, and other musical attributes.
javascriptmcpservernpm install lechiffre1/Spotify-Playlist-Curator-MCP-Server - stacktrace-mcp 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - Simple JS Stacktrace MCP for getting the nearest error location from JS asset URL and let LLM checks if it matches anything with current codebase. Designed for non-sourcemap users.
typescriptmcpmcp-servermodel-context-protocolllmnpm install antonybudianto/stacktrace-mcp - NextChat-MCP 📘 🏠 (⭐ 1, 🍴 1) - NextChat with MCP server creation functionality and OpenRouter integration
typescriptmcpservernpm install vredrick2/NextChat-MCP - npm-types-mcp-server 📘 🏠 (⭐ 1) - An MCP (Model Context Protocol) server for providing TypeScript type definitions as MCP Resources.
typescriptmcpservernpm install JackVCurtis/npm-types-mcp-server - tidymodels-mcp 📜 🏠 (⭐ 1, 🍴 3, 🐛 3) - This MCP server was developed to improve Cline's agentic workflows by being up-to-date with the public repositories and docs under https://github.com/tidymodels
javascriptclinemcprstatstidymodelsnpm install JavOrraca/tidymodels-mcp - tiny-ser-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - MCP (TypeScript-based)
typescriptmcpnpm install bestK/tiny-ser-mcp-server - tradovate-mcp-server 📜 🏠 (⭐ 1, 🍴 2, 🐛 1) - Tradovate MCP Server
javascriptmcpservernpm install alexanimal/tradovate-mcp-server - unix-timestamps-mcp 📜 🏠 (⭐ 1) - A simple MCP server that does one thing only - help your LLM to use current unix timestamps. Something that models are currently struggling with, partially due to knowledge cutoffs and not really knowing where in time they are.
javascriptmcpserverllmnpm install Ivor/unix-timestamps-mcp - uuid-mcp-server-example 📘 🏠 (⭐ 1) - uuid(v4)を作成するシンプルなMCPサーバーです。
typescriptmcpnpm install Suntory-Y-Water/uuid-mcp-server-example - vibe-coder-mcp-v4 📘 🏠 (⭐ 1) - Final v4 release of Vibe Coder MCP Server with Automatic Contextual Retrieval System (ACRS) tools
typescriptmcpservernpm install jsscarfo/vibe-coder-mcp-v4 - web-search-mcp 📘 🏠 (⭐ 1, 🍴 2) - MCP server for web searches
typescriptmcpserverwebnpm install muka/web-search-mcp - davlgd_mcp-js-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/davlgd/mcp-js-server
javascriptmcpserverhttpnpm install MCP-Mirror/davlgd_mcp-js-server - enemyrr_mcp-mysql-server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/enemyrr/mcp-mysql-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/enemyrr_mcp-mysql-server - mcp-github 📘 🏠 (⭐ 1, 🐛 1) - A Model Context Protocol (MCP) server for interacting with GitHub
typescriptmcpservernpm install renantrendt/mcp-github - mcp-lighthouse 📜 🏠 (⭐ 1, 🍴 3, 🐛 1) - An MCP server for chatting with your Lighthouse portfolio
javascriptmcpservernpm install l3wi/mcp-lighthouse - mcp-openfec 📜 🏠 📇 (⭐ 1, 🍴 6, 🐛 3) - A Model Context Protocol (MCP) server that provides access to Federal Election Commission (FEC) campaign finance data through the OpenFEC API.
javascriptmcpserverapiainpm install psalzman/mcp-openfec - pbs-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 4, 🐛 4) - Australian Pharmaceutical Benefits Scheme PBS API Server using Anthropic MCP with natural language LLM integration
javascriptmcpserverapillmnpm install matthewdcage/pbs-mcp-server - pocketbase-mcp-server 📜 🏠 (⭐ 1, 🍴 1, 🐛 1) - Model Context Protocol Server for PocketBase
javascriptservernpm install imiborbas/pocketbase-mcp-server - pollinations-ai-image-server 📜 🏠 (⭐ 1, 🐛 1) - A Model Context Protocol server for generating images using Pollinations AI
javascriptserverainpm install zym9863/pollinations-ai-image-server - spoonacular-server 📜 🏠 📇 (⭐ 1) - A Model Context Protocol server for Spoonacular API
javascriptserverapinpm install zym9863/spoonacular-server - yapi-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 1) - Yapi MCP Server (Node.js-based)
javascriptmcpyapiserverapinpm install zoeminghong/yapi-mcp-server - alexatnordnet_mcp-google-custom-search-server 📘 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/alexatnordnet/mcp-google-custom-search-server
typescriptmcpserverhttpgonpm install MCP-Mirror/alexatnordnet_mcp-google-custom-search-server - Automata-Labs-team_MCP-Server-Playwright 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/Automata-Labs-team/MCP-Server-Playwright
javascriptmcpserverhttpnpm install MCP-Mirror/Automata-Labs-team_MCP-Server-Playwright - kablewy_salesforce-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/kablewy/salesforce-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/kablewy_salesforce-mcp-server - semgrep-mcp-server 📜 🏠 (⭐ 1, 🍴 4, 🐛 2) - Node.js-based
javascriptnpm install stefanskiasan/semgrep-mcp-server - twitch-mcp-server 📘 🏠 📇 (⭐ 1, 🍴 5, 🐛 2) - A Model Context Protocol (MCP) server that provides tools for interacting with the Twitch API using the Helix API.
typescriptmcpserverapinpm install mtane0412/twitch-mcp-server - ZubeidHendricks_youtube-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/ZubeidHendricks/youtube-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/ZubeidHendricks_youtube-mcp-server - mcp-software-consultant 📘 🏠 (⭐ 1, 🍴 1, 🐛 1) - A CLI tool, MCP server, and vscode extension that allows Cline to ask an external specialized consultant for help
typescriptmcpservernpm install delorenj/mcp-software-consultant - mcp-tavily-server 📜 🏠 (⭐ 1, 🍴 2) - Tavily MCP Server for Cline
javascriptmcpservernpm install zenturacp/tavily-server - PhialsBasement_CMD-MCP-Server 📜 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/PhialsBasement/CMD-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/PhialsBasement_CMD-MCP-Server - Brave Search 🏠 📇 - Web search capabilities using Brave's Search API
apiwebhttpaigit - Fetch 🏠 - Efficient web content fetching and processing for AI consumption
webhttpaigitgithub - NYTimes 🏠 📇 - Search articles using the NYTimes API
apihttpgitgithub - Puppeteer 🏠 📇 - Browser automation for web scraping and interaction
apiwebhttpaigit - Skyvern 🏠 - MCP to let Claude or your own LLM control your browser
httpaillmgitgithub - RivalSearchMCP 🏠 - A powerful MCP server providing a suite of tools for web search, content discovery, and automated research workflows.
webhttpgitgithub - 302_custom_mcp 📜 🏠 - 302 Custom MCP (Node.js-based)
javascriptmcpnpm install 302ai/302_custom_mcp - bigcommerce-api-mcp 📜 🏠 - BigCommerce MCP Server
javascriptbigcommercebigcommerce-apibigcommerce-mcpmcpnpm install isaacgounton/bigcommerce-api-mcp - aligo-sms-mcp-server 📜 🏠 📇 - Model Context Protocol (MCP) server for Aligo SMS API integration https://smartsms.aligo.in/smsapi.html aligo 는 (주)알리는사람들 사의 상표명입니다.
javascriptmcpserverapimlnpm install hongsw/aligo-sms-mcp-server - Chat-Royale 📘 🏠 - A Clash Royale agent, powered by the custom built Clash Royale MCP client and server. Enables the agent to fetch real time data from the game.
typescriptmcpservergit clone https://github.com/Baighasan/clash-royale-mcp-server - cmmv-mcp 📘 🏠 - Model Context Protocol (MCP) module for CMMV
typescriptcmmvmcpmcp-servermodel-context-protocolnpm install cmmvio/cmmv-mcp - data4library-mcp 📘 🏠 📇 - MCP server for Korean National Library API with 25+ tools for book/library search, popular trends, and GPS-based nearby library discovery
typescriptbook-searchclaude-mcpdata4libraryfastmcpnpm install isnow890/data4library-mcp - mcp-server-elasticsearch 📘 🏠 - A production-ready Model Context Protocol (MCP) server that connects AI assistants like Claude Desktop to Elasticsearch clusters. This server provides comprehensive Elasticsearch operations through natural language interactions.
typescriptmcpserverainpm install zx8086/mcp-server-elasticsearch - mcp-server-web 🏠 - 一个基于MCP协议开发的LLM(大模型)服务端项目
vuemcpllmgit clone https://github.com/Hiohk/mcp-server-weather - mcpCreatioServer 📘 🏠 - mcp server for personal use
typescriptmcpservernpm install mpawlikcreatio/mcpCreatioServer - 4everland-hosting-mcp 📘 🏠 - TypeScript-based
typescripthttpaigitgithubnpm install 4everland/4everland-hosting-mcp - beckn-mcp 📘 🏠 - MCP Server for Beckn Protocol (SSE Transport)
typescriptaisdkbeckn-protocolbunmcpnpm install rajatsandeepsen/beckn-mcp - bitbucket-server-mcp-server 📜 🏠 - MCP (Model Context Protocol) server for Bitbucket Server Pull Request management
javascriptmcpservernpm install kartikpatpatwingify/bitbucket-server-mcp-server - brainiac-mcp-server 📘 🏠 - Brainiac MCP Server is a sophisticated cognitive computing engine that leverages the Model Context Protocol (MCP) to deliver human-like reasoning capabilities.
typescriptmcpserverainpm install cavanaughdesign/brainiac-mcp-server - Google_chat_mcp_server 📜 🏠 - This is G_chat Mcp server written in Ts contain various tools fetch to post.
javascriptmcpserverainpm install KaranThink41/Google_chat_mcp_server - heroicons-mcp 📘 🏠 - heroicons-mcp is a Model Context Protocol (MCP) server that exposes Heroicons. It allows LLMs and agentic applications to search, list, and generate usage examples of icons in React applications.
typescriptheroicons-reactmcpmcp-serverservernpm install SeeYangZhi/heroicons-mcp - honeypot-mcp-server 📜 🏠 - Node.js-based
javascriptnpm install Thinh-nguyen-03/honeypot-mcp-server - heroku_heroku-mcp-server 📘 🏠 - Mirror of https://github.com/heroku/heroku-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/heroku_heroku-mcp-server - hiyorineko_mcp-rollbar-server 📘 🏠 - Mirror of https://github.com/hiyorineko/mcp-rollbar-server
typescriptmcpserverhttpnpm install MCP-Mirror/hiyorineko_mcp-rollbar-server - homebrew-jira-cli-mcp 💎 🏠 - Homebrew tap for jira-cli-mcp - MCP server that wraps jira-cli for AI assistants
rubyhomebrewhomebrew-tapjiramcpgit clone https://github.com/choplin/homebrew-jira-cli-mcp - graph-memory-rag-mcp-server 📜 🏠 - A Model Context Protocol (MCP) server implementation for graph-based memory storage with RAG capabilities
javascriptmcpservernpm install lecharles/graph-memory-rag-mcp-server - housekeep-mcp-netlify 📘 🏠 - Housekeep MCP server deployed to Netlify
typescriptmcpservernpm install mrmikardo/housekeep-mcp-netlify - HosakaKeigo_spreadsheet-mcp-server 📘 🏠 - Mirror of https://github.com/HosakaKeigo/spreadsheet-mcp-server
typescriptmcpserverhttpgonpm install MCP-Mirror/HosakaKeigo_spreadsheet-mcp-server - hu9_remote-mcp-server-authless 📘 🏠 - Mirror of https://github.com/hu9/remote-mcp-server-authless
typescriptmcpserverauthhttpnpm install MCP-Mirror/hu9_remote-mcp-server-authless - hyros-mcp-server 📜 🏠 📇 - Hyros MCP Server - Model Context Protocol server providing 24 Hyros API tools for AI agents and automation platforms
javascriptmcpserverapiainpm install zalogarcia/hyros-mcp-server - itemit-mcp 📘 🏠 - Asset Tracking made easy with itemit MCP Server. You can leverage this tools on your MCP Clients. Made by mcp.umin.ai team.
typescriptmcpserveraihttpnpm install umin-ai/itemit-mcp - Infisical_infisical-mcp-server 📜 🏠 - Mirror of https://github.com/Infisical/infisical-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/Infisical_infisical-mcp-server - jacdac-mcp 📘 🏠 - A MCP server for Jacdac
typescriptmcpservernpm install pelikhan/jacdac-mcp - jackedelic_exa-mcp-server 📘 🏠 - Mirror of https://github.com/jackedelic/exa-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jackedelic_exa-mcp-server - kintone-oauth-mcp-server-cfw 📘 🏠 - これは Cloudflare Workers として deploy可能な kintone 用の Model Context Protocol (MCP) サーバーです。 OAuth で認証するため、(秘匿すべき)認証情報をローカルディスク内などに保存しません。 ある cybozu.comドメイン用に この MCP Sever を deploy しておけば、そのドメインを使用する全ての人がこの MCP Server を共用利用できます。 プログラムをローカルにセットアップする必要がなく、Webブラウザー版の Claude からも使用することができます。
typescriptmcpserverwebauthnpm install r3-yamauchi/kintone-oauth-mcp-server-cfw - jageenshukla_hello-world-mcp-server 📘 🏠 - Mirror of https://github.com/jageenshukla/hello-world-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jageenshukla_hello-world-mcp-server - jalali-mcp-server 📜 🏠 - jalali date mcp server
javascriptmcpservernpm install pfndesign/jalali-mcp-server - JeongJaeSoon_sample-mcp-server 📘 🏠 - Mirror of https://github.com/JeongJaeSoon/sample-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/JeongJaeSoon_sample-mcp-server - jamb-mcp-server 📘 🏠 - Jamb MCP Server (TypeScript-based)
typescriptmcpservernpm install jambllc/jamb-mcp-server - james-mcp-stremable 📘 🏠 - This is a customized MCP remote client based on the original project.(https://github.com/ferrants/mcp-streamable-http-typescript-server)
typescriptmcpserverhttpnpm install network1211/james-mcp-stremable - janwilmake_openapi-mcp-server 📜 🏠 📇 - Mirror of https://github.com/janwilmake/openapi-mcp-server
javascriptmcpserverapihttpnpm install MCP-Mirror/janwilmake_openapi-mcp-server - JavaProgrammerLB_zoom-mcp-server 📘 🏠 - Mirror of https://github.com/JavaProgrammerLB/zoom-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/JavaProgrammerLB_zoom-mcp-server - jean-technologies_smartlead-mcp-server-local 📘 🏠 - Mirror of https://github.com/jean-technologies/smartlead-mcp-server-local
typescriptmcpserverhttpnpm install MCP-Mirror/jean-technologies_smartlead-mcp-server-local - jimmcq_Lemonade-Stand-MCP-Server 📜 🏠 - Mirror of https://github.com/jimmcq/Lemonade-Stand-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/jimmcq_Lemonade-Stand-MCP-Server - jinzcdev_leetcode-mcp-server 📘 🏠 - Mirror of https://github.com/jinzcdev/leetcode-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jinzcdev_leetcode-mcp-server - jmagar_overseerr-mcp-server 📘 🏠 - Mirror of https://github.com/jmagar/overseerr-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jmagar_overseerr-mcp-server - glifxyz_glif-mcp-server 📘 🏠 - Mirror of https://github.com/glifxyz/glif-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/glifxyz_glif-mcp-server - gluneau_hive-mcp-server 📘 🏠 - Mirror of https://github.com/gluneau/hive-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/gluneau_hive-mcp-server - GongRzhe_Image-Generation-MCP-Server 📜 🏠 - Mirror of https://github.com/GongRzhe/Image-Generation-MCP-Server
javascriptmcpserverhttpgonpm install MCP-Mirror/GongRzhe_Image-Generation-MCP-Server - google-calendar-mcp 📘 🏠 📇 - Model Context Protocol (MCP) server for Claude Desktop connecting to Google Calender using Google Calendar API
typescriptmcpserverapigonpm install Jackson88/google-calendar-mcp - google-calendar-mcp 📘 🏠 - MCP server for Google Calendar integration
typescriptmcpservergonpm install KhryptorGraphics/google-calendar-mcp - google-drive-mcp-server 📘 🏠 - google drive mcp 서버를 만들어보자 일단 sheet부터
typescriptmcpgonpm install seeun0210/google-drive-mcp-server - GPlay_reviews_MCP_server 📜 🏠 - ⭐️ MCP Server for Google Play Reviews
javascriptmcpservergonpm install Kirill812/GPlay_reviews_MCP_server - hatch-mcp-server 📜 🏠 - hatch-mcp-server (Node.js-based)
javascriptmcpservernpm install Meerkats-Ai/hatch-mcp-server - hedera-dev_hedera-mcp-server 📜 🏠 - Mirror of https://github.com/hedera-dev/hedera-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/hedera-dev_hedera-mcp-server - hedera-dev_mirrornode-mcp-server 📘 🏠 - Mirror of https://github.com/hedera-dev/mirrornode-mcp-server
typescriptmcpserverhttpnodenpm install MCP-Mirror/hedera-dev_mirrornode-mcp-server - hello-mcp-server 📘 🏠 - A simple Hello World server implementing the Model Context Protocol (MCP)
typescriptmcpservernpm install gkushang/hello-mcp-server - hono-mcp-template 📘 🏠 - A template for using hono to serve MCP server in streamableHTTP
typescriptmcpserverhttpnpm install wudongjie/hono-mcp-template - joaquinsoza_x-mcp-server 📘 🏠 - Mirror of https://github.com/joaquinsoza/x-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/joaquinsoza_x-mcp-server - housing-mcp-server 📘 🏠 - 공공 주택 정보 조회를 위한 MCP 서버
typescriptmcpnpm install MJunKWON/housing-mcp-server - hrs-asano_claude-mcp-trello 📜 🏠 - Mirror of https://github.com/hrs-asano/claude-mcp-trello
javascriptmcphttpnpm install MCP-Mirror/hrs-asano_claude-mcp-trello - hugeicons_mcp-server 📘 🏠 - Mirror of https://github.com/hugeicons/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/hugeicons_mcp-server - icraft2170_youtube-data-mcp-server 📜 🏠 - Mirror of https://github.com/icraft2170/youtube-data-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/icraft2170_youtube-data-mcp-server - inkdropapp_mcp-server 📜 🏠 - Mirror of https://github.com/inkdropapp/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/inkdropapp_mcp-server - integrator-mcp-server 📘 🏠 - Integrator MCP Server
typescriptmcpservernpm install boostspace/integrator-mcp-server - intersective_practera-mcp-server 📘 🏠 - Mirror of https://github.com/intersective/practera-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/intersective_practera-mcp-server - jootsuki_backlog-mcp-server 📜 🏠 - Mirror of https://github.com/jootsuki/backlog-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/jootsuki_backlog-mcp-server - kxkaloo/mcp 🏠 - Enables AI models to extract structured data from websites using the Scrapezy MCP server.
webhttpaigitgithub - logzio-mcp-server 📘 🏠 - Unofficial mcp server for logz.io
typescriptmcpservernpm install jklnr/logzio-mcp-server - mcp 📜 🏠 - MCP server for Testomat.io
javascriptmcpservernpm install testomatio/mcp - leonardsellem_n8n-mcp-server 📘 🏠 - Mirror of https://github.com/leonardsellem/n8n-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/leonardsellem_n8n-mcp-server - jtucker_mcp-untappd-server 📜 🏠 - Mirror of https://github.com/jtucker/mcp-untappd-server
javascriptmcpserverhttpnpm install MCP-Mirror/jtucker_mcp-untappd-server - keegancsmith_linear-issues-mcp-server 📜 🏠 - Mirror of https://github.com/keegancsmith/linear-issues-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/keegancsmith_linear-issues-mcp-server - kesslerio_attio-mcp-server 📘 🏠 - Mirror of https://github.com/kesslerio/attio-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/kesslerio_attio-mcp-server - Layr-Labs_eigenlayer-mcp-server 📘 🏠 - Mirror of https://github.com/Layr-Labs/eigenlayer-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/Layr-Labs_eigenlayer-mcp-server - Lightbaby_mcp-server-novacv 📜 🏠 - Mirror of https://github.com/Lightbaby/mcp-server-novacv
javascriptmcpserverhttpnpm install MCP-Mirror/Lightbaby_mcp-server-novacv - Listed-Google-MCP-Server 📘 🏠 - Google search mcp server output in table format
typescriptmcpservergonpm install lin-working-bot/Listed-Google-MCP-Server - luckycola-mcp 📜 🏠 - luckycolaWeb的开放MCP Server
javascriptmcpserverwebnpm install mingle98/luckycola-mcp - LiteraturePro_mcp-server 📘 🏠 - Mirror of https://github.com/LiteraturePro/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/LiteraturePro_mcp-server - liveblocks_liveblocks-mcp-server 📘 🏠 - Mirror of https://github.com/liveblocks/liveblocks-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/liveblocks_liveblocks-mcp-server - llm-model-providers-mcp 📜 🏠 - mcp server for fetching available llm models
javascriptmcpserveraillmnpm install jhsu/llm-model-providers-mcp - lmcmz_flow-mcp-server 📜 🏠 - Mirror of https://github.com/lmcmz/flow-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/lmcmz_flow-mcp-server - local-mcp 📘 🏠 - This project build a local mcp server to fetch weather
typescriptmcpservernpm install MiguelAngelGutierrezMaya/local-mcp - local-mcp-server-sample 📜 🏠 - This is a sample local MCP server.
javascriptmcpservernpm install 7nohe/local-mcp-server-sample - local-scanner-mcp 📜 🏠 - MCP server for scanning local code and localhost URLs
javascriptmcpservernpm install treaties-ai/local-scanner-mcp - mailgun_mailgun-mcp-server 📜 🏠 - Mirror of https://github.com/mailgun/mailgun-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/mailgun_mailgun-mcp-server - marcopesani_mcp-server-serper 📘 🏠 - Mirror of https://github.com/marcopesani/mcp-server-serper
typescriptmcpserverhttpnpm install MCP-Mirror/marcopesani_mcp-server-serper - marcopesani_think-mcp-server 📘 🏠 - Mirror of https://github.com/marcopesani/think-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/marcopesani_think-mcp-server - MarketplaceAdPros_amazon-ads-mcp-server 📜 🏠 - Mirror of https://github.com/MarketplaceAdPros/amazon-ads-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/MarketplaceAdPros_amazon-ads-mcp-server - mcp 📘 🏠 📇 - An MCP server that generates forms and surveys using the Weavely API.
typescriptmcpserverapinpm install weavely/mcp - mcp 📘 🏠 - Building mcp servers , just exploring
typescriptmcpservernpm install aloysathekge/mcp - mcp 📜 🏠 - Node.js-based
javascriptnpm install alfahq/mcp - horizondatawave_hdw-mcp-server 📜 🏠 - Mirror of https://github.com/horizondatawave/hdw-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/horizondatawave_hdw-mcp-server - jimpick_mcp-json-db-collection-server 📜 🏠 - Mirror of https://github.com/jimpick/mcp-json-db-collection-server
javascriptmcpserverhttpjsonnpm install MCP-Mirror/jimpick_mcp-json-db-collection-server - junmer_mcp-server-lottiefiles 📘 🏠 - Mirror of https://github.com/junmer/mcp-server-lottiefiles
typescriptmcpserverhttpnpm install MCP-Mirror/junmer_mcp-server-lottiefiles - k8s-mcp 📘 🏠 - k8s服务相关状态检查 (TypeScript-based)
typescriptnpm install vazylin1124/k8s-mcp - kablewy_fred-mcp-server 📘 🏠 - Mirror of https://github.com/kablewy/fred-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/kablewy_fred-mcp-server - kakehashi-inc_mattermost-mcp-server 📘 🏠 - Mirror of https://github.com/kakehashi-inc/mattermost-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/kakehashi-inc_mattermost-mcp-server - kapilduraphe_okta-mcp-server 📘 🏠 📇 - Mirror of https://github.com/kapilduraphe/okta-mcp-server
typescriptmcpserverapihttpnpm install MCP-Mirror/kapilduraphe_okta-mcp-server - krep-mcp-server 📜 🏠 - High-performance string search MCP server with automatic CPU core scaling
javascriptmcpservernpm install bmorphism/krep-mcp-server - kuru-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install georgyturevich/kuru-mcp-server - Laity624_my-mcp-server 📘 🏠 - Mirror of https://github.com/Laity624/my-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/Laity624_my-mcp-server - lallen30_mcp-remote-server 📘 🏠 - Mirror of https://github.com/lallen30/mcp-remote-server
typescriptmcpserverhttpnpm install MCP-Mirror/lallen30_mcp-remote-server - landicefu_mcp-client-configuration-server 📜 🏠 - Mirror of https://github.com/landicefu/mcp-client-configuration-server
javascriptmcpserverhttpnpm install MCP-Mirror/landicefu_mcp-client-configuration-server - Leonelberio_the-wordpress-mcp-server 📜 🏠 - Mirror of https://github.com/Leonelberio/the-wordpress-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/Leonelberio_the-wordpress-mcp-server - lsp-tools-mcp 📘 🏠 - An MCP server to build LSP
typescriptmcpservernpm install rajnaveen344/lsp-tools-mcp - lupuletic_onyx-mcp-server 📘 🏠 - Mirror of https://github.com/lupuletic/onyx-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/lupuletic_onyx-mcp-server - MadeByNando_MCP-linear-Server 📘 🏠 - Mirror of https://github.com/MadeByNando/MCP-linear-Server
typescriptmcpserverhttpnpm install MCP-Mirror/MadeByNando_MCP-linear-Server - MadeByNando_mcp-postgres-server 📜 🏠 - Mirror of https://github.com/MadeByNando/mcp-postgres-server
javascriptmcpserverhttppostgresnpm install MCP-Mirror/MadeByNando_mcp-postgres-server - manolaz_emergency-medicare-planner-mcp-server 📜 🏠 - Mirror of https://github.com/manolaz/emergency-medicare-planner-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/manolaz_emergency-medicare-planner-mcp-server - manpreet2000_mcp-database-server 📘 🏠 - Mirror of https://github.com/manpreet2000/mcp-database-server
typescriptmcpserverdatabasehttpnpm install MCP-Mirror/manpreet2000_mcp-database-server - mase2_mcp_server 📘 🏠 📇 - Node.js-basierter Model Control Protocol Server, der die REST-API aus sws-computersysteme/mase2_frontend_techniker/server/api/v1 kapselt.
typescriptserverapirestnodenpm install biebl/mase2_mcp_server - marcelmarais_spotify-mcp-server 📘 🏠 - Mirror of https://github.com/marcelmarais/spotify-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/marcelmarais_spotify-mcp-server - markdownlint-mcp-server 📘 🏠 - MCP server for enforcing markdownlint rules on generated markdown content
typescriptmcpservernpm install barnett617/markdownlint-mcp-server - KBB99_mcp-registry-server 📜 🏠 - Mirror of https://github.com/KBB99/mcp-registry-server
javascriptmcpserverhttpnpm install MCP-Mirror/KBB99_mcp-registry-server - kiwamizamurai_mcp-kibela-server 📘 🏠 - Mirror of https://github.com/kiwamizamurai/mcp-kibela-server
typescriptmcpserveraihttpnpm install MCP-Mirror/kiwamizamurai_mcp-kibela-server - langfuse_mcp-server-langfuse 📘 🏠 - Mirror of https://github.com/langfuse/mcp-server-langfuse
typescriptmcpserverhttpnpm install MCP-Mirror/langfuse_mcp-server-langfuse - leafeye_lunchmoney-mcp-server 📘 🏠 - Mirror of https://github.com/leafeye/lunchmoney-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/leafeye_lunchmoney-mcp-server - learn-mcp-by-building 📜 🏠 - Learn MCP by building from Scarch
javascriptlearn-in-publiclearning-by-doingmcpmcp-clientnpm install AshikNesin/learn-mcp-by-building - matstack-code-rules-mcp 📘 🏠 - MCP server for reliably reading code rules into Agentic AI context
typescriptmcpserverainpm install jarle/matstack-code-rules-mcp - mcma123_firecrawl-mcp-server 📜 🏠 - Mirror of https://github.com/mcma123/firecrawl-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/mcma123_firecrawl-mcp-server - mcp 📜 🏠 - General purpose MCP-server for 6digit studio
javascriptmcpservernpm install 6digit-studio/mcp - mcp 📘 🏠 - MCP Servers, exposed as a CLI tool
typescriptmcpservernpm install jpowersdev/mcp - HeatherFlux_github-issue-mcp-server 📜 🏠 - Mirror of https://github.com/HeatherFlux/github-issue-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/HeatherFlux_github-issue-mcp-server - hmk_attio-mcp-server 📜 🏠 - Mirror of https://github.com/hmk/attio-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/hmk_attio-mcp-server - GongRzhe_Calendar-Autoauth-MCP-Server 📜 🏠 - Mirror of https://github.com/GongRzhe/Calendar-Autoauth-MCP-Server
javascriptmcpserverauthoauthnpm install MCP-Mirror/GongRzhe_Calendar-Autoauth-MCP-Server - GongRzhe_REDIS-MCP-Server 📜 🏠 - Mirror of https://github.com/GongRzhe/REDIS-MCP-Server
javascriptmcpserverhttpredisnpm install MCP-Mirror/GongRzhe_REDIS-MCP-Server - GongRzhe_TRAVEL-PLANNER-MCP-Server 📜 🏠 - Mirror of https://github.com/GongRzhe/TRAVEL-PLANNER-MCP-Server
javascriptmcpserverhttpgonpm install MCP-Mirror/GongRzhe_TRAVEL-PLANNER-MCP-Server - handfuloflight_convex-mcp-server 📜 🏠 - Mirror of https://github.com/handfuloflight/convex-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/handfuloflight_convex-mcp-server - hideya_weather-mcp-server 📘 🏠 - Mirror of https://github.com/hideya/weather-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/hideya_weather-mcp-server - hmk_box-mcp-server 📜 🏠 - Mirror of https://github.com/hmk/box-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/hmk_box-mcp-server - iaptic_mcp-server-iaptic 📘 🏠 - Mirror of https://github.com/iaptic/mcp-server-iaptic
typescriptmcpserverhttpnpm install MCP-Mirror/iaptic_mcp-server-iaptic - identimoji_mcp-server-emojikey 📘 🏠 - Mirror of https://github.com/identimoji/mcp-server-emojikey
typescriptmcpserverhttpnpm install MCP-Mirror/identimoji_mcp-server-emojikey - imankamyabi_dynamodb-mcp-server 📜 🏠 - Mirror of https://github.com/imankamyabi/dynamodb-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/imankamyabi_dynamodb-mcp-server - integration-app_mcp-server 📜 🏠 - Mirror of https://github.com/integration-app/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/integration-app_mcp-server - Iwark_linear-mcp-server 📜 🏠 - Mirror of https://github.com/Iwark/linear-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/Iwark_linear-mcp-server - MCP 📘 🏠 - MCP server (TypeScript-based)
typescriptmcpservernpm install SweetingTech/MCP - ivo-toby_mcp-openapi-server 📜 🏠 📇 - Mirror of https://github.com/ivo-toby/mcp-openapi-server
javascriptmcpserverapihttpnpm install MCP-Mirror/ivo-toby_mcp-openapi-server - jacksteamdev_mcp-sqlite-bun-server 📘 🏠 - Mirror of https://github.com/jacksteamdev/mcp-sqlite-bun-server
typescriptmcpserverhttpsqlitenpm install MCP-Mirror/jacksteamdev_mcp-sqlite-bun-server - jakedahn_deno2-playwright-mcp-server 📘 🏠 - Mirror of https://github.com/jakedahn/deno2-playwright-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jakedahn_deno2-playwright-mcp-server - jerhadf_linear-mcp-server 📜 🏠 - Mirror of https://github.com/jerhadf/linear-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/jerhadf_linear-mcp-server - jmagar_ghome-mcp-server 📘 🏠 - Mirror of https://github.com/jmagar/ghome-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/jmagar_ghome-mcp-server - joeBlockchain_mcp-server-client 📘 🏠 - Mirror of https://github.com/joeBlockchain/mcp-server-client
typescriptmcpserveraihttpnpm install MCP-Mirror/joeBlockchain_mcp-server-client - johnnyoshika_mcp-server-sqlite-npx 📜 🏠 - Mirror of https://github.com/johnnyoshika/mcp-server-sqlite-npx
javascriptmcpserverhttpsqlitenpm install MCP-Mirror/johnnyoshika_mcp-server-sqlite-npx - JoshuaRileyDev_app-store-connect-mcp-server 📘 🏠 - Mirror of https://github.com/JoshuaRileyDev/app-store-connect-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/JoshuaRileyDev_app-store-connect-mcp-server - JoshuaRileyDev_supabase-mcp-server 📜 🏠 - Mirror of https://github.com/JoshuaRileyDev/supabase-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/JoshuaRileyDev_supabase-mcp-server - jpinillagoshawk_mcp-server-file-modifier 📜 🏠 - Mirror of https://github.com/jpinillagoshawk/mcp-server-file-modifier
javascriptmcpserverhttpgonpm install MCP-Mirror/jpinillagoshawk_mcp-server-file-modifier - kentaro_mcp-local-command-server 📜 🏠 - Mirror of https://github.com/kentaro/mcp-local-command-server
javascriptmcpserverhttpnpm install MCP-Mirror/kentaro_mcp-local-command-server - kiliczsh_mcp-mongo-server 📜 🏠 - Mirror of https://github.com/kiliczsh/mcp-mongo-server
javascriptmcpserverhttpgonpm install MCP-Mirror/kiliczsh_mcp-mongo-server - kimtaeyoon83_mcp-server-youtube-transcript 📜 🏠 - Mirror of https://github.com/kimtaeyoon83/mcp-server-youtube-transcript
javascriptmcpserverhttpnpm install MCP-Mirror/kimtaeyoon83_mcp-server-youtube-transcript - knmurphy_glide-api-mcp-server 📜 🏠 📇 - Mirror of https://github.com/knmurphy/glide-api-mcp-server
javascriptmcpserverapihttpnpm install MCP-Mirror/knmurphy_glide-api-mcp-server - KS-GEN-AI_jira-mcp-server 📜 🏠 - Mirror of https://github.com/KS-GEN-AI/jira-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/KS-GEN-AI_jira-mcp-server - kurtseifried_mcp-servers-kurtseifried 📜 🏠 - Mirror of https://github.com/kurtseifried/mcp-servers-kurtseifried
javascriptmcpserverhttpnpm install MCP-Mirror/kurtseifried_mcp-servers-kurtseifried - la-rebelion_mcp-server 📘 🏠 - Mirror of https://github.com/la-rebelion/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/la-rebelion_mcp-server - Laksh-star_mcp-server-tmdb 📜 🏠 - Mirror of https://github.com/Laksh-star/mcp-server-tmdb
javascriptmcpserverhttpnpm install MCP-Mirror/Laksh-star_mcp-server-tmdb - lamemind_coder-toolbox-mcp-server 📘 🏠 - Mirror of https://github.com/lamemind/coder-toolbox-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/lamemind_coder-toolbox-mcp-server - loglmhq_mcp-server-github-repo 📜 🏠 - Mirror of https://github.com/loglmhq/mcp-server-github-repo
javascriptmcpserverhttpnpm install MCP-Mirror/loglmhq_mcp-server-github-repo - loglmhq_mcp-server-prometheus 📜 🏠 - Mirror of https://github.com/loglmhq/mcp-server-prometheus
javascriptmcpserverhttpnpm install MCP-Mirror/loglmhq_mcp-server-prometheus - longyi1207_glean-mcp-server 📜 🏠 - Mirror of https://github.com/longyi1207/glean-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/longyi1207_glean-mcp-server - magicp-mhl/newsnow 🏠 📇 - Facilitates elegant real-time news reading with adaptive scraping and MCP server support for seamless integration.
apihttpmlgitgithub - MCP 📘 🏠 - MCP Server (TypeScript-based)
typescriptmcpservernpm install vvalkov1/MCP - mcp-add-server 📜 🏠 - mcp-add-server (Node.js-based)
javascriptmcpservernpm install zhangzhefang-github/mcp-add-server - mcp-amazon-cloudwatch-logs 📘 🏠 - A Model Context Protocol (MCP) server that enables AI assistants to interact with Amazon CloudWatch Logs through a standardized interface using AWS SDK.
typescriptcloudwatchcloudwatch-logsmcpmcp-servernpm install hyorimitsu/mcp-amazon-cloudwatch-logs - mcp-code-search-server 📘 🏠 - 一个MCP Server,帮助LLM查找相关代码在文件中的位置,支持返回完整的函数定义。
typescriptmcpserverllmnpm install fx-an/mcp-code-search-server - mcp-coding-mr 📜 🏠 📇 - A simple MCP server for CODING MR API
javascriptmcpserverapinpm install yankeguo/mcp-coding-mr - mcp-cookbook 📘 🏠 - MCP server providing AI coding assistants with reusable recipes and procedures for common development tasks
typescriptmcpserverainpm install mikevalstar/mcp-cookbook - mcp-demo 📘 🏠 - Hello world on mcp server
typescriptmcpservernpm install nssachin/mcp-demo - mcp-deploy 📜 🏠 - Medrehab MCP Server (Node.js-based)
javascriptmcpservernpm install SiteGlue/mcp-deploy - 2bo_qiita-mcp-server 📘 🏠 - Mirror of https://github.com/2bo/qiita-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/2bo_qiita-mcp-server - 9olidity_MCP-Server-Pentest 📜 🏠 - Mirror of https://github.com/9olidity/MCP-Server-Pentest
javascriptmcpserverhttpnpm install MCP-Mirror/9olidity_MCP-Server-Pentest - abhaybabbar_retellai-mcp-server 📘 🏠 - Mirror of https://github.com/abhaybabbar/retellai-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/abhaybabbar_retellai-mcp-server - adapoet_fabric-mcp-server 📜 🏠 - Mirror of https://github.com/adapoet/fabric-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/adapoet_fabric-mcp-server - ai_mcptut1 📘 🏠 - Mcp server and client tutorial
typescriptmcpservernpm install khanakia/ai_mcptut1 - ai-search-mcp-server 📜 🏠 - AI搜索的MCP server (Node.js-based)
javascriptmcpserverainpm install XvJunyan/ai-search-mcp-server - akc2267_solana-mcp-server 📘 🏠 - Mirror of https://github.com/akc2267/solana-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/akc2267_solana-mcp-server - 5ajaki_safe-mcp-server 📜 🏠 - Mirror of https://github.com/5ajaki/safe-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/5ajaki_safe-mcp-server - aashari_mcp-server-atlassian-bitbucket 📘 🏠 - Mirror of https://github.com/aashari/mcp-server-atlassian-bitbucket
typescriptmcpserverhttpnpm install MCP-Mirror/aashari_mcp-server-atlassian-bitbucket - aashari_mcp-server-atlassian-confluence 📘 🏠 - Mirror of https://github.com/aashari/mcp-server-atlassian-confluence
typescriptmcpserverhttpnpm install MCP-Mirror/aashari_mcp-server-atlassian-confluence - AdamikHQ_adamik-mcp-server 📘 🏠 - Mirror of https://github.com/AdamikHQ/adamik-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/AdamikHQ_adamik-mcp-server - adrianozagallo-home_mcp-server 📘 🏠 - Mirror of https://github.com/adrianozagallo-home/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/adrianozagallo-home_mcp-server - ai-yliu_filesystem-mcp-server 📜 🏠 - Mirror of https://github.com/ai-yliu/filesystem-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/ai-yliu_filesystem-mcp-server - aiyogg_tinypng-mcp-server 📘 🏠 - Mirror of https://github.com/aiyogg/tinypng-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/aiyogg_tinypng-mcp-server - akiojin_playfab-mcp-server 📜 🏠 - Mirror of https://github.com/akiojin/playfab-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/akiojin_playfab-mcp-server - alchemy-sdk-mcp 📘 🏠 - TypeScript-based
typescriptnpm install itsanishjain/alchemy-sdk-mcp - alexanimal_tradovate-mcp-server 📜 🏠 - Mirror of https://github.com/alexanimal/tradovate-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/alexanimal_tradovate-mcp-server - 0xtotaylor_mcp-server-skyfire 📘 🏠 - Mirror of https://github.com/0xtotaylor/mcp-server-skyfire
typescriptmcpserverhttpnpm install MCP-Mirror/0xtotaylor_mcp-server-skyfire - 9506hqwy_redmine_mcp_server 💎 🏠 - Mirror of https://github.com/9506hqwy/redmine_mcp_server
rubymcpserverhttpgit clone https://github.com/MCP-Mirror/9506hqwy_redmine_mcp_server - abhiz123_todoist-mcp-server 📜 🏠 - Mirror of https://github.com/abhiz123/todoist-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/abhiz123_todoist-mcp-server - ac3xx_mcp-servers-kagi 📘 🏠 - Mirror of https://github.com/ac3xx/mcp-servers-kagi
typescriptmcpserverhttpnpm install MCP-Mirror/ac3xx_mcp-servers-kagi - adamwattis_mcp-proxy-server 📘 🏠 - Mirror of https://github.com/adamwattis/mcp-proxy-server
typescriptmcpserverhttpnpm install MCP-Mirror/adamwattis_mcp-proxy-server - agentico-dev_mcp-server 📘 🏠 - Mirror of https://github.com/agentico-dev/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/agentico-dev_mcp-server - AI-FE_dify-mcp-server 📜 🏠 - Mirror of https://github.com/AI-FE/dify-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/AI-FE_dify-mcp-server - aipower-rpa-mcp-server 🏠 - a mcp server for 影刀RPA
httpaimlgitgithubgit clone https://github.com/catinair/aipower-rpa-mcp-server - audius-mcp-atris 📘 🏠 - Model Context Protocol server for Audius. Perform market research, purchase premium tracks, upload songs, and much more!
typescriptserverhttpaigitnpm install glassBead-tc/audius-mcp-atris - alt-decision-tree-mcp-server 📘 🏠 - Model Context Protocol server that generates appropriate alternative text for images using ALT decision tree
typescripta11yaccessibilityalt-textmcpnpm install yamanoku/alt-decision-tree-mcp-server - amgadabdelhafez_dbx-mcp-server 📘 🏠 - Mirror of https://github.com/amgadabdelhafez/dbx-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/amgadabdelhafez_dbx-mcp-server - assets-mcp 📘 🏠 📇 - A Cloudflare Worker MCP server that integrates with the Helius API to provide asset search tools
typescriptmcpserverapinpm install pratikbuilds/assets-mcp - authorize-net-mcp 📘 🏠 - Experimental Authorize.net Node.js TypeScript MCP Server
typescriptmcpserverauthnodenpm install zmarty/authorize-net-mcp - alxspiker_Windows-Command-Line-MCP-Server 📘 🏠 - Mirror of https://github.com/alxspiker/Windows-Command-Line-MCP-Server
typescriptmcpserverhttpnpm install MCP-Mirror/alxspiker_Windows-Command-Line-MCP-Server - amitdeshmukh_stdout-mcp-server 📘 🏠 - Mirror of https://github.com/amitdeshmukh/stdout-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/amitdeshmukh_stdout-mcp-server - anandkumarpatel_remote-mcp-server 📘 🏠 - Mirror of https://github.com/anandkumarpatel/remote-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/anandkumarpatel_remote-mcp-server - Aniket310101_MCP-Server-Couchbase 📘 🏠 - Mirror of https://github.com/Aniket310101/MCP-Server-Couchbase
typescriptmcpserverhttpnpm install MCP-Mirror/Aniket310101_MCP-Server-Couchbase - AnuragRai017_database-updater-MCP-Server 📜 🏠 - Mirror of https://github.com/AnuragRai017/database-updater-MCP-Server
javascriptmcpserverdatabaseainpm install MCP-Mirror/AnuragRai017_database-updater-MCP-Server - arc-mcp-server 📘 🏠 - Accelerate development with ARC MCP
typescriptmcpnpm install maxmurphySF/arc-mcp-server - AnuragRai017_python-docs-server-MCP-Server 📜 🏠 - Mirror of https://github.com/AnuragRai017/python-docs-server-MCP-Server
javascriptmcpserveraihttpnpm install MCP-Mirror/AnuragRai017_python-docs-server-MCP-Server - Atomzzm_mcp-mysql-server 📜 🏠 - Mirror of https://github.com/Atomzzm/mcp-mysql-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/Atomzzm_mcp-mysql-server - AustinKelsay_nostr-mcp-server 📜 🏠 - Mirror of https://github.com/AustinKelsay/nostr-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/AustinKelsay_nostr-mcp-server - aws-trusted-advisor-mcp-server 📘 🏠 - AWS Trusted Advisor MCP Server - 低利用率EC2インスタンスの停止やEBSスナップショットの作成など、AWS環境の最適化を提案するツール
typescriptmcpserverawsrustnpm install enomoto11/aws-trusted-advisor-mcp-server - avantjohn_mcp-server-test-04 📘 🏠 - Mirror of https://github.com/avantjohn/mcp-server-test-04
typescriptmcpserverhttpnpm install MCP-Mirror/avantjohn_mcp-server-test-04 - awwaiid_mcp-server-taskwarrior 📜 🏠 - Mirror of https://github.com/awwaiid/mcp-server-taskwarrior
javascriptmcpserveraihttpnpm install MCP-Mirror/awwaiid_mcp-server-taskwarrior - azsap-mcp-typescript 📘 🏠 - SAP On Azure MCP Server for TypeScript
typescriptmcpserverazurenpm install ArchitectRavi/azsap-mcp-typescript - azure-iothub-mcp-server 📘 🏠 - MCP Server for Azure IoT Hub mainly for read-only monitoring purposes. Uses Azure CLI for authentication.
typescriptmcpserveraiauthnpm install tlaukkanen/azure-iothub-mcp-server - B-Step62_mcp-server-mlflow 📘 🏠 - Mirror of https://github.com/B-Step62/mcp-server-mlflow
typescriptmcpservermlhttpnpm install MCP-Mirror/B-Step62_mcp-server-mlflow - bart6114_my-bear-mcp-server 📜 🏠 - Mirror of https://github.com/bart6114/my-bear-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bart6114_my-bear-mcp-server - basicMcpServer 📘 🏠 - 타입스크립트로 구현한 MCP 서버 기
typescriptmcpnpm install HIG52/basicMcpServer - Beyond-Network-AI_beyond-mcp-server 📘 🏠 - Mirror of https://github.com/Beyond-Network-AI/beyond-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/Beyond-Network-AI_beyond-mcp-server - brale-api-mcp 📜 🏠 📇 - MCP Server for Brale API - https://docs.brale.xyz/docs/introduction
javascriptmcpserverapihttpnpm install stablecoinxyz/brale-api-mcp - browser-automation-server 📜 🏠 - A Model Context Protocol (MCP) server that provides browser automation capabilities for Claude and other MCP-compatible AI assistants
javascriptmcpserverainpm install samihalawa/browser-automation-server - browserbee-mcp-demo 📘 🏠 - Demo MCP servers for BrowserBee
typescriptmcpservernpm install nalbion/browserbee-mcp-demo - cdata-connect-cloud-mcp-server 📜 🏠 - !!【お願い】!! CData社が Official で出している 「CData Connect Cloud」に対応したMCP サーバー(Connect Cloud MCP Server)の OSS実装がありますので、そちら https://github.com/CDataSoftware/connectcloud-mcp-server を使用してください!
javascriptmcpserverhttpnpm install r3-yamauchi/cdata-connect-cloud-mcp-server - chatbot-mcp 📘 🏠 - A simple client and server mcp
typescriptmcpservernpm install AndersonHqds/chatbot-mcp - chenshuai2144_mcp-server 📘 🏠 - Mirror of https://github.com/chenshuai2144/mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/chenshuai2144_mcp-server - chronos-mcp 📜 🏠 - Chronos – A Stellar MCP server
javascriptmcpservernpm install grandmastr/chronos-mcp - civic-pass-mcp-server 📘 🏠 - civic-pass-mcp-server
typescriptmcpservernpm install chainaim3003/civic-pass-mcp-server - claude-mcp-integration 📘 🏠 - Claude MCP Server Integration & GitHub Actions
typescriptmcpservernpm install mokemoke0821/claude-mcp-integration - clerk-mcp-template 📘 🏠 - A production-ready template for building Model Context Protocol (MCP) servers with Clerk authentication on Cloudflare Workers
typescriptmcpserverauthnpm install dyeoman2/clerk-mcp-template - cloudflare-mcp 📘 🏠 - Build an MCP server and deploy it to cloudflare workers
typescriptcloudflare-kvcloudflare-workersmcp-servermcpnpm install shashankboosi/cloudflare-mcp - comic-database-mcp 📘 🏠 📇 - A Model Context Protocol (MCP) server that provides AI assistants with structured access to the Comic Vine API. Get detailed information about comic books, characters, publishers, and more in a conversation-friendly format.
typescriptmcpserverapiainpm install Urlyss/comic-database-mcp - esign-cn-open-source_mcp-server-esign 📜 🏠 - Mirror of https://github.com/esign-cn-open-source/mcp-server-esign
javascriptmcpserverhttpnpm install MCP-Mirror/esign-cn-open-source_mcp-server-esign - ewelink-mcp-server 📜 🏠 - Control devices on the eWelink App through LLM
javascriptllmnpm install 991glasses/ewelink-mcp-server - Figma_MCP_Server 📘 🏠 - react (TypeScript-based)
typescriptreactnpm install Dhruv-220/Figma_MCP_Server - figma-mcp-handholding 📘 🏠 - A test of making a simple word editor using the Figma MCP server with Cursor. This test has been handholding cursor through all the components.
typescriptmcpservernpm install RuniEllingsgaard/figma-mcp-handholding - first-mcp-server 📘 🏠 - 初めてのMCPサーバー (TypeScript-based)
typescriptmcpnpm install YuukiTsuchida/first-mcp-server - enjin-platform-mcp-server 📜 🏠 📇 - An MCP server that enables interaction with the Enjin Platform API.
javascriptmcpserverapinpm install EtayM/enjin-platform-mcp-server - evm-mcp 📘 🏠 - A MCP server for doing ETH transactions in an EVM chain
typescriptmcpserverainpm install Nightfallsh4/evm-mcp - express-mcp-server-echo 📘 🏠 - An example of using express-mcp-handler to serve an mcp serve via http
typescriptmcphttpnpm install jhgaylor/express-mcp-server-echo - express-mcp-server-text-extractor 📘 🏠 - An MCP server providing tools to extract text from things
typescriptmcpservernpm install jhgaylor/express-mcp-server-text-extractor - ethangillani_connectwise-mcp-server 📜 🏠 - Mirror of https://github.com/ethangillani/connectwise-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/ethangillani_connectwise-mcp-server - event-catalog_mcp-server 📘 🏠 - Mirror of https://github.com/event-catalog/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/event-catalog_mcp-server - evm-mcp-server 📘 🏠 - An EVM interaction service based on Model Context Protocol (MCP)
typescriptmcpnpm install sinco-lab/evm-mcp-server - fabric-mcp 📘 🏠 📇 - The Fabric MCP is a powerful integration that connects Anthropic's Claude with Fabric's AI pattern framework. It processes YouTube videos and various content types through a unified API.
typescriptmcpapiainpm install 48Nauts-Operator/fabric-mcp - father-mcp 📜 🏠 - An MCP server enabling AI models to implement the Model Context Protocol, complete with tools and documentation.
javascriptmcpserveraidocumentationnpm install deepsuthar496/father-mcp - Faucet94_super-win-cli-mcp-server 📘 🏠 - Mirror of https://github.com/Faucet94/super-win-cli-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/Faucet94_super-win-cli-mcp-server - fiberflow-mcp-gateway 📜 🏠 - Run Fiberflow MCP SSE Server over stdio.
javascriptmcpservernpm install derbenoo/fiberflow-mcp-gateway - figma-mcp-oneshot 📘 🏠 - A test of making a simple word editor using the Figma MCP server with Cursor. This test is a one shot prompt from Figma with all the components created. No clean up in the code.
typescriptmcpservernpm install RuniEllingsgaard/figma-mcp-oneshot - figma-mcp-server 📜 🏠 - A real-time WebSocket server for multi-user cursor collaboration in Figma using the Multi-Cursor Protocol (MCP).
javascriptmcpserverwebwebsocketnpm install QnoteAITeam/figma-mcp-server - figma-mcp-server 📜 🏠 - Interacts with Figma file content, dev resources, comments, and webhooks.
javascriptwebnpm install deepsuthar496/figma-mcp-server - faiz-gear_dify-mcp-server-ts 📘 🏠 - Mirror of https://github.com/faiz-gear/dify-mcp-server-ts
typescriptmcpserveraihttpnpm install MCP-Mirror/faiz-gear_dify-mcp-server-ts - epaproditus_google-workspace-mcp-server 📜 🏠 - Mirror of https://github.com/epaproditus/google-workspace-mcp-server
javascriptmcpserverhttpgonpm install MCP-Mirror/epaproditus_google-workspace-mcp-server - ergut_mcp-bigquery-server 📜 🏠 - Mirror of https://github.com/ergut/mcp-bigquery-server
javascriptmcpserverhttpnpm install MCP-Mirror/ergut_mcp-bigquery-server - exa-labs_exa-mcp-server 📜 🏠 - Mirror of https://github.com/exa-labs/exa-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/exa-labs_exa-mcp-server - felores_placid-mcp-server 📘 🏠 - Mirror of https://github.com/felores/placid-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/felores_placid-mcp-server - fillout-mcp-server 📘 🏠 📇 - MCP Server for the Fillout.io API, enabling form management, response handling, and analytics.
typescriptmcpserverapinpm install danielma-tic/fillout-mcp-server - Firecrawl Mcp Server - Official Firecrawl MCP Server - Adds powerful web scraping to Cursor, Claude and any other LLM clients.
firecrawlscrapingweb - flowmcp-core 📜 🏠 📇 - FlowMCP is a framework for adapting existing web APIs into a standardized Model Context Protocol (MCP) interface, enabling structured, testable, and semantically consistent access for AI systems.
javascriptmcpmcp-serverapiwebnpm install FlowMCP/flowMCP - flowmcp-schemas 📜 🏠 📇 - The FlowMCP Schema Library provides a large collection of standardized API schemas that enable AI systems to seamlessly interact with over 400+ MCP-compatible routes across major Web3 data providers.
javascriptmcpapiwebainpm install flowMCP/flowMCP-schemas - flowmcp-servers 📜 🏠 📇 - Provides local and remote servers to run FlowMCP schemas via stdio or HTTP/SSE for AI–API integration.
javascriptmcpmcp-serverserverapinpm install FlowMCP/flowmcp-servers - git-jira-mcp-server 📘 🏠 - 这是一个用于获取 Jira 需求信息的 MCP 服务器,基于当前 Git 分支名自动获取对应的 Jira 需求详情。
typescriptmcpnpm install 1pone/git-jira-mcp-server - connections-mcp-server 📘 🏠 - If you're looking for today's NYT Connections puzzle answers or spoiler hints, you've come to the right place. Connections Hint is updated daily and provides access to a complete historical archive.
typescriptconnections-hintnyt-connectionsainpm install wytxer/connections-mcp-server - cv-mcp 📘 🏠 - This is an MCP Server that provides static answers about Frank Goortani's CV
typescriptmcpservergonpm install FrankGoortani/cv-mcp - Cyreslab-AI_burpsuite-mcp-server 📜 🏠 - Mirror of https://github.com/Cyreslab-AI/burpsuite-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/Cyreslab-AI_burpsuite-mcp-server - Cyreslab-AI_marinetraffic-mcp-server 📘 🏠 - Mirror of https://github.com/Cyreslab-AI/marinetraffic-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/Cyreslab-AI_marinetraffic-mcp-server - cyyzpanpan_remote-mcp-server 📘 🏠 - Mirror of https://github.com/cyyzpanpan/remote-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/cyyzpanpan_remote-mcp-server - floodfx_mcp-server-linear 📘 🏠 - Mirror of https://github.com/floodfx/mcp-server-linear
typescriptmcpserverhttpnpm install MCP-Mirror/floodfx_mcp-server-linear - gdrive-sparc-mcp 📘 🏠 - Google Drive MCP Server - A Model Context Protocol server for intelligent Google Drive integration with OAuth 2.0, content analysis, and organization insights
typescriptmcpserverauthoauthnpm install danfeder/gdrive-sparc-mcp - git-mob-mcp-server 📘 🏠 - Model Context Protocol (MCP) server for git-mob CLI app
typescriptmcpserverauthhttpnpm install Mubashwer/git-mob-mcp-server - dave-wind_mysql-mcp-server 📜 🏠 - Mirror of https://github.com/dave-wind/mysql-mcp-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/dave-wind_mysql-mcp-server - github-mcp-server-local 📜 🏠 - Local Docker setup for GitHub MCP Server with docker-compose
javascriptmcpserverdockernpm install shesadri/github-mcp-server-local - bilibii-mcp-server 📜 🏠 - 这是一个基于Model Context Protocol (MCP)的服务,用于查询B站用户的粉丝数量。通过提供B站用户ID,可以获取该用户的粉丝数。
javascriptmcpnpm install HEXING19/bilibii-mcp-server - bluesky-daily-mcp 📘 🏠 - An MCP Server to help you surface the most interesting topics from your Bluesky follows daily.
typescriptblueskymcp-servermcpservernpm install briangershon/bluesky-daily-mcp - buffett-code-mcp-server 📘 🏠 📇 - buffett-code apiをバックエンドにしたMCP Server
typescriptmcpserverapinpm install BuffettCode/buffett-code-mcp-server - bmorphism_krep-mcp-server 📜 🏠 - Mirror of https://github.com/bmorphism/krep-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bmorphism_krep-mcp-server - bmorphism_manifold-mcp-server 📜 🏠 - Mirror of https://github.com/bmorphism/manifold-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bmorphism_manifold-mcp-server - botnbot_mcp 📘 🏠 - MCP Server for Botnbot
typescriptmcpservernpm install frocher/botnbot_mcp - brand-to-theme-mcp-server 📘 🏠 - Servidor MCP para convertir PDFs de identidad de marca en temas de Shopify
typescriptmcpnpm install mmokarzel/brand-to-theme-mcp-server - brianellin_bsky-mcp-server 📜 🏠 - Mirror of https://github.com/brianellin/bsky-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/brianellin_bsky-mcp-server - buu-mcp-server 📘 🏠 - MCP Server for Buu AI
typescript3d-generationmcpserverainpm install Buu-AI/buu-mcp-server - bybit-mcp-server 📘 🏠 - Repository for Bybit MCP Server project
typescriptmcpservernpm install Tinycute00/bybit-mcp-server - BrockReece_whimsical-mcp-server 📘 🏠 - Mirror of https://github.com/BrockReece/whimsical-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/BrockReece_whimsical-mcp-server - bsmi021_mcp-chain-of-draft-server 📘 🏠 - Mirror of https://github.com/bsmi021/mcp-chain-of-draft-server
typescriptmcpserveraihttpnpm install MCP-Mirror/bsmi021_mcp-chain-of-draft-server - bsmi021_mcp-file-context-server 📜 🏠 - Mirror of https://github.com/bsmi021/mcp-file-context-server
javascriptmcpserverhttpnpm install MCP-Mirror/bsmi021_mcp-file-context-server - bsmi021_mcp-file-operations-server 📘 🏠 - Mirror of https://github.com/bsmi021/mcp-file-operations-server
typescriptmcpserverhttpnpm install MCP-Mirror/bsmi021_mcp-file-operations-server - caiyun-mcp-tools 📜 🏠 📇 - Model Context Protocol (MCP) server for the Caiyun Weather API
javascriptmcpserverapiainpm install PsychArch/caiyun-mcp-tools - CamdenClark_anki-mcp-server 📜 🏠 - Mirror of https://github.com/CamdenClark/anki-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/CamdenClark_anki-mcp-server - captain-blue210_anki-mcp-server 📜 🏠 - Mirror of https://github.com/captain-blue210/anki-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/captain-blue210_anki-mcp-server - chatmcp_mcp-server-router 📜 🏠 - Mirror of https://github.com/chatmcp/mcp-server-router
javascriptmcpserverhttpnpm install MCP-Mirror/chatmcp_mcp-server-router - chinchillo-mcp-server 📘 🏠 - チンチロができるMCPサーバーです。 (TypeScript-based)
typescriptmcpnpm install Suntory-Y-Water/chinchillo-mcp-server - christian561_gel-mcp-server 📘 🏠 - Mirror of https://github.com/christian561/gel-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/christian561_gel-mcp-server - claude-figma-mcp 📘 🏠 - TypeScript-based
typescriptnpm install Tony-Youn/claude-figma-mcp - cloudinary-mcp-server 📜 🏠 📇 - Model Context Protocol (MCP) Server for Cloudinary API
javascriptmcpserverapinpm install yoavniran/cloudinary-mcp-server - cloudtasks-mcp 📜 🏠 - MCP Server to interact with Google Cloud Tasks
javascriptmcpservergonpm install gitskyflux/cloudtasks-mcp - andypost_mcp-server-ts-trello 📜 🏠 - Mirror of https://github.com/andypost/mcp-server-ts-trello
javascriptmcpserverhttpnpm install MCP-Mirror/andypost_mcp-server-ts-trello - ccc0168_modes-mcp-server 📜 🏠 - Mirror of https://github.com/ccc0168/modes-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/ccc0168_modes-mcp-server - Chrusic_todoist-mcp-server-extended 📜 🏠 - Mirror of https://github.com/Chrusic/todoist-mcp-server-extended
javascriptmcpserverhttpnpm install MCP-Mirror/Chrusic_todoist-mcp-server-extended - code-analyzer-server 📜 🏠 - MCP server for analyzing code for bugs, errors, and functionality issues
javascriptmcpservernpm install vigourpt/code-analyzer-server - coin-flip-mcp 📜 🏠 - MCP server for flipping coins with varying degrees of randomness from random.org
javascriptmcpservernpm install TeglonLabs/coin-flip-mcp - comment-stripper-mcp 📜 🏠 - A flexible MCP server that batch processes code files to remove comments across multiple programming languages. Currently supports JavaScript, TypeScript, and Vue files with regex-based pattern matching. Handles individual files, directories (including subdirectories), and text input. Built for clean code maintenance and preparation.
javascriptmcpserveraivuenpm install yhzion/comment-stripper-mcp - context-optimizer-mcp 📜 🏠 - An MCP server that uses Redis and in-memory caching to optimize and extend context windows for large chat histories
javascriptmcpserverredisnpm install degenhero/context-optimizer-mcp - coyaSONG_youtube-mcp-server 📜 🏠 - Mirror of https://github.com/coyaSONG/youtube-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/coyaSONG_youtube-mcp-server - cpropster_linear-mcp-server 📘 🏠 - Mirror of https://github.com/cpropster/linear-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/cpropster_linear-mcp-server - crazyrabbitLTC_mcp-ethers-server 📘 🏠 - Mirror of https://github.com/crazyrabbitLTC/mcp-ethers-server
typescriptmcpserverhttpnpm install MCP-Mirror/crazyrabbitLTC_mcp-ethers-server - crazyrabbitLTC_mcp-snapshot-server 📘 🏠 - Mirror of https://github.com/crazyrabbitLTC/mcp-snapshot-server
typescriptmcpserverhttpnpm install MCP-Mirror/crazyrabbitLTC_mcp-snapshot-server - csonigo_datagouv-mcp-server 📘 🏠 - Mirror of https://github.com/csonigo/datagouv-mcp-server
typescriptmcpserverhttpgonpm install MCP-Mirror/csonigo_datagouv-mcp-server - cursor-talk-to-figma-mcp_fork 📜 🏠 - Node.js-based
javascriptnpm install eldarshmatkov/cursor-talk-to-figma-mcp_fork - custom-mcp 📘 🏠 - Custom mcp example (TypeScript-based)
typescriptmcpnpm install GiladShoham/custom-mcp - custom-mcp-server 📜 🏠 - A custom MCP server integrating Brave search, filesystem, GitHub, and sequential thinking
javascriptmcpservernpm install degenhero/custom-mcp-server - custom-mcp-template 📘 🏠 - This template helps you quickly bootstrap a new Model Context Protocol (MCP) server project based on recommended practices.
typescriptclaudecursormcpmcpservernpm install bsmi021/custom-mcp-template - cyanheads_ntfy-mcp-server 📘 🏠 - Mirror of https://github.com/cyanheads/ntfy-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/cyanheads_ntfy-mcp-server - Cyreslab-AI_flightradar-mcp-server 📜 🏠 - Mirror of https://github.com/Cyreslab-AI/flightradar-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/Cyreslab-AI_flightradar-mcp-server - data-mcp-server 📘 🏠 📇 - TypeScript-based
apiwebhttpaiopenainpm install NexusX-MCP/data-mcp-server - da1y_mcp-server-elasticsearch 📜 🏠 - Mirror of https://github.com/da1y/mcp-server-elasticsearch
javascriptmcpserverhttpnpm install MCP-Mirror/da1y_mcp-server-elasticsearch - datadog-mcp-server 📘 🏠 - MCP Server for Datadog
typescriptmcpservernpm install i524/datadog-mcp-server - datagovmy-mcp 📘 🏠 - A NodeJS TypeScript MCP server designed to fetch foreign exchange rate data from datagov.my and perform bidirectional currency conversion between foreign currencies and MYR.
typescriptmcpservernodegonpm install leeliwei930/datagovmy-mcp - dbx-mcp-server 📘 🏠 - working Dropbox MCP server for cursor .47 using simple variable and a simple wrapper
typescriptmcpservernpm install Albiemark/dbx-mcp-server - cyanheads_obsidian-mcp-server 📘 🏠 - Mirror of https://github.com/cyanheads/obsidian-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/cyanheads_obsidian-mcp-server - crazyrabbitLTC_mcp-coingecko-server 📜 🏠 - Mirror of https://github.com/crazyrabbitLTC/mcp-coingecko-server
javascriptmcpserverhttpnpm install MCP-Mirror/crazyrabbitLTC_mcp-coingecko-server - crazyrabbitLTC_mcp-etherscan-server 📘 🏠 - Mirror of https://github.com/crazyrabbitLTC/mcp-etherscan-server
typescriptmcpserverhttpnpm install MCP-Mirror/crazyrabbitLTC_mcp-etherscan-server - crazyrabbitLTC_mcp-twitter-server 📘 🏠 - Mirror of https://github.com/crazyrabbitLTC/mcp-twitter-server
typescriptmcpserverhttpnpm install MCP-Mirror/crazyrabbitLTC_mcp-twitter-server - cyanheads_atlas-mcp-server 📘 🏠 - Mirror of https://github.com/cyanheads/atlas-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/cyanheads_atlas-mcp-server - cyanheads_git-mcp-server 📘 🏠 - Mirror of https://github.com/cyanheads/git-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/cyanheads_git-mcp-server - d365-agent-mcpserver-ts 🏠 - TypeScript/Node.js MCP Server. Alternative to .NET server, depends on d365-agent-odataclient-ts for D365 tools.
mcpservernodegit clone https://github.com/ntrtd/d365-agent-mcpserver-ts - dynamo-readonly-mcp 📜 🏠 - AWS DynamoDB Read-Only MCP Server
javascriptmcpserverawsnpm install jjikky/dynamo-readonly-mcp - developer-research-server 📜 🏠 - MCP server for developer research tasks
javascriptmcpservernpm install ali-nr/developer-research-server - domain-checker-mcp 📜 🏠 - MCP server for checking domain availability using RDAP and WHOIS with support for bulk checking multiple domains in parallel.
javascriptmcpserverainpm install unitythemaker/domain-checker-mcp - drand-mcp-server 📘 🏠 - A model context protocol server for drand
typescriptserverhttpgitgithubnpm install randa-mu/drand-mcp-server - deshartman_twilio-agent-payments-mcp-server 📘 🏠 - Mirror of https://github.com/deshartman/twilio-agent-payments-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/deshartman_twilio-agent-payments-mcp-server - elijahdev0_mcp-server 📜 🏠 - Mirror of https://github.com/elijahdev0/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/elijahdev0_mcp-server - dcSpark_mcp-server-jupiter 📘 🏠 - Mirror of https://github.com/dcSpark/mcp-server-jupiter
typescriptmcpserverhttpnpm install MCP-Mirror/dcSpark_mcp-server-jupiter - degenduel-mcp 📘 🏠 - MCP server with custom tools designed specifically for DegenDuel
typescriptmcpservernpm install BranchManager69/degenduel-mcp - descope-sample-apps_descope-mcp-server-stdio 📘 🏠 - Mirror of https://github.com/descope-sample-apps/descope-mcp-server-stdio
typescriptmcpserverhttpnpm install MCP-Mirror/descope-sample-apps_descope-mcp-server-stdio - deshartman_twilio-messaging-mcp-server 📘 🏠 - Mirror of https://github.com/deshartman/twilio-messaging-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/deshartman_twilio-messaging-mcp-server - dhartunian_cockroachdb-mcp-server 📘 🏠 - Mirror of https://github.com/dhartunian/cockroachdb-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/dhartunian_cockroachdb-mcp-server - diegofornalha_mcp-server-trello 📘 🏠 - Mirror of https://github.com/diegofornalha/mcp-server-trello
typescriptmcpserverhttpgonpm install MCP-Mirror/diegofornalha_mcp-server-trello - docker-mcp-server-template 📘 🏠 - DockerでMCPサーバーを立ち上げるテンプレート
typescriptmcpdockernpm install Hurukawa2121/docker-mcp-server-template - Domoteek_mcp-server-airbnb 📜 🏠 - Mirror of https://github.com/Domoteek/mcp-server-airbnb
javascriptmcpserveraihttpnpm install MCP-Mirror/Domoteek_mcp-server-airbnb - dperussina_mssql-mcp-server 📜 🏠 - Mirror of https://github.com/dperussina/mssql-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/dperussina_mssql-mcp-server - dpflucas_mysql-mcp-server 📜 🏠 - Mirror of https://github.com/dpflucas/mysql-mcp-server
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/dpflucas_mysql-mcp-server - dubco-mcp-server 📜 🏠 📇 - MCP server for Dub.co link shortener API integration
javascriptmcpserverapinpm install Gitmaxd/dubco-mcp-server - duhlink_instagram-server-next-mcp 📘 🏠 - Mirror of https://github.com/duhlink/instagram-server-next-mcp
typescriptmcpserverhttpnpm install MCP-Mirror/duhlink_instagram-server-next-mcp - Dumpling-AI_mcp-server-dumplingai 📜 🏠 - Mirror of https://github.com/Dumpling-AI/mcp-server-dumplingai
javascriptmcpserveraihttpnpm install MCP-Mirror/Dumpling-AI_mcp-server-dumplingai - DynamicEndpoints_advanced-pocketbase-mcp-server 📜 🏠 - Mirror of https://github.com/DynamicEndpoints/advanced-pocketbase-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/DynamicEndpoints_advanced-pocketbase-mcp-server - EasyMCP 📘 🏠 - Support easy mcp server connecting to user without the knowledge of programs
typescriptmcpservernpm install jeean0668/EasyMCP - el-el-san_vidu-mcp-server 📘 🏠 - Mirror of https://github.com/el-el-san/vidu-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/el-el-san_vidu-mcp-server - emmett-deen_Linear-MCP-Server 📘 🏠 - Mirror of https://github.com/emmett-deen/Linear-MCP-Server
typescriptmcpserverhttpnpm install MCP-Mirror/emmett-deen_Linear-MCP-Server - encore-mcp-example 📘 🏠 - This is a simple Model Context Protocol (MCP) demo focused on weather functionality using Encore.
typescriptmcpnpm install leofmarciano/encore-mcp-example - formulahendry_mcp-server-code-runner 📘 🏠 - Mirror of https://github.com/formulahendry/mcp-server-code-runner
typescriptmcpserverhttpnpm install MCP-Mirror/formulahendry_mcp-server-code-runner - freepik-mcp-server 📜 🏠 📇 - MCP server for generating images with Freepik Flux-Dev API
javascriptmcpserverapinpm install grafikogr/freepik-mcp-server - Fujitsu-AI_MCP-Server-for-MAS-Developments 📜 🏠 - Mirror of https://github.com/Fujitsu-AI/MCP-Server-for-MAS-Developments
javascriptmcpserveraihttpnpm install MCP-Mirror/Fujitsu-AI_MCP-Server-for-MAS-Developments - galachain-mcp 📘 🏠 - Galachain MCP server for use with LLMs
typescriptmcpserveraillmnpm install IndiaJonathan/galachain-mcp - gallabox-mcp-server 📜 🏠 📇 - A Model Context Protocol (MCP) server implementation for Gallabox WhatsApp APIs. This server acts as a middleware between MCP clients and the Gallabox API, providing a standardized interface for sending WhatsApp messages.
javascriptmcpserverapinpm install navayuvan-gallabox/gallabox-mcp-server - garc33_js-sandbox-mcp-server 📜 🏠 - Mirror of https://github.com/garc33/js-sandbox-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/garc33_js-sandbox-mcp-server - gemini-dk_mcp-server-firebase 📘 🏠 - Mirror of https://github.com/gemini-dk/mcp-server-firebase
typescriptmcpserverhttpnpm install MCP-Mirror/gemini-dk_mcp-server-firebase - github-explorer-mcp 📘 🏠 - A TypeScript implementation of an MCP server that provides GitHub repository information including file content, directory structure, and other metadata for MCP clients.
typescriptmcpservernpm install x51xxx/github-explorer-mcp - generate_image-mcp-server 📜 🏠 - A Model Context Protocol server for generating images
javascriptservernpm install Tomocrystal/generate_image-mcp-server - genm_mcp-server-discord-webhook 📜 🏠 - Mirror of https://github.com/genm/mcp-server-discord-webhook
javascriptmcpserverwebhttpnpm install MCP-Mirror/genm_mcp-server-discord-webhook - georgejeffers_gemini-mcp-server 📘 🏠 - Mirror of https://github.com/georgejeffers/gemini-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/georgejeffers_gemini-mcp-server - github-mcp 📜 🏠 - A Model Context Protocol (MCP) server implementation for GitHub integration
javascriptmcpservernpm install oghenetejiriorukpegmail/github-mcp - github-mcp-server 📜 🏠 📇 - A Management Control Panel server for GitHub projects using Issues API
javascriptserverapinpm install brukhabtu/github-mcp-server - github-mcp-server 📘 🏠 - MCP server for github operation
typescriptmcpservernpm install minimind-org/github-mcp-server - mcp_bitbucket_pipelines 📘 🏠 - Bitbucket Pipelines MCP is a Model Context Protocol (MCP) server that provides tools for interacting with Bitbucket Pipelines. This server implements the MCP standard, enabling language models like Claude to manage Bitbucket Pipelines through a standardized interface.
typescriptmcpservernpm install ygorpinto/mcp_bitbucket_pipelines - mcp_client_server 📜 🏠 📇 - his is a Node.js command-line application that integrates with GitHub via the Model Context Protocol (MCP) server and OpenAI's API.
javascriptmcpserverapiainpm install devmadni/mcp_client_server - mcp_grareco 📘 🏠 - 任意URLまたはテキストをグラレコ化するMCP Server
typescriptmcpservernpm install iuill/mcp_grareco - mcp_ios_project 🐍 🏠 - mcp_ios_project (Python-based)
httpgitgithubpythonmcppip install git+https://github.com/LuckyXYJ/mcp_ios_project - mcp_server 📜 🏠 - Custom MCP Server to integrate with tools and run inside a n8n instance
javascriptmcpservernpm install matheusleite/mcp_server - MCP_server 📜 🏠 - Basic Node.js HTTP server
javascriptserverhttpnodenpm install udaya38/MCP_server - mcp-ambassador 📜 🏠 - An MCP server that scouts, recommends, and connects you with useful MCP servers to augment your current tasks or projects. It prefers using existing web search MCP tools for discovery, or suggests installing one if not available.
javascriptmcpserverwebainpm install WynnD/mcp-ambassador - mcp-apikit 📘 🏠 📇 - Get API document info from mcp server
typescriptmcpserverapinpm install scarqin/mcp-apikit - mcp-atlassian 📜 🏠 - MCP server for integrating Atlassian products (Confluence, Jira) with Model Context Protocol
javascriptmcpservernpm install petrsovadina/mcp-atlassian - mcp_server_starter_typescript 📘 🏠 - A starter template for creating a Model Context Protocol (MCP) server using TypeScript
typescriptmcpservernpm install yhwancha/mcp_server_starter_typescript - mcp_starter 📜 🏠 - How to setup mcp server and mcp client.
javascriptmcpservernpm install sharmatriloknath/mcp_starter - mcp_test_with_ollama 📜 🏠 - an custom mcp server and custom mcp client project powered by ollama's llama 3.2
javascriptmcpservernpm install MasudOsmanmr9/mcp_test_with_ollama - mcp_ui_phase1 📘 🏠 - creating ui for mcp servers.
typescriptmcpservernpm install avsai24/mcp_ui_phase1 - mcp-adobe-aep 📘 🏠 📇 - MCP Server for Adobe Experience Platform APIs integration
typescriptmcpserverapinpm install praveensharmajava/mcp-adobe-aep - mcp-agent 📘 🏠 - TypeScript-based
webhttpllmgitgithubnpm install Elvis720/mcp-agent - MCP-Books-Service 📘 🏠 - This is my Example of MCP Server for connect to books service, for my blog
typescriptmcpservernpm install thappatan/MCP-Books-Service - mcp-cassandra-server 📘 🏠 - Model Context Protocol for cassandra database
typescriptdatabasenpm install sahil1115/mcp-cassandra-server - mcp-client 📜 🏠 - Model Context Protocol client for AI-MCP-Logger integration with Claude
javascriptmcpainpm install NeuralLog/mcp-client - mcp-client-example 📘 🏠 📇 - This is a sample CLI chat application for an AI assistant using the Anthropic API in conjunction with an MCP client and MCP server.
typescriptmcpserverapiainpm install t-shiratori/mcp-client-example - mcp-client-server 📜 🏠 - Node express and React based MCP client server demo
javascriptmcpserverreactnodenpm install sujaykundu777/mcp-client-server - mcp-cloudwatch-tracker 📘 🏠 - TypeScript-based
typescriptnpm install Juri-Dev-Lab/mcp-cloudwatch-tracker - mcp_practice 📜 🏠 - a mcp server (Node.js-based)
javascriptmcpservernpm install vivalalova/mcp_practice - mcp-agents 📘 🏠 - A curated list of essential MCP servers that I created for personal use. Feel free to use them.
typescriptmcpservernpm install omar391/mcp-agents - mcp-commands 💎 🏠 - A Ruby on Rails MCP server with file operation commands
rubymcpserveraigit clone https://github.com/arockwell/mcp-commands - mcp-console-application 📘 🏠 - A MCP Server and Client developed from the quick start guide in their documentation
typescriptmcpserverdocumentationnpm install Chazzychouse/mcp-console-application - mcp-coinbase-commerce 📘 🏠 - MCP server for generating Coinbase Commerce payment links
typescriptmcpservernpm install zhangzhongnan928/mcp-coinbase-commerce - mcp-continuity-server 📜 🏠 - Um servidor MCP para gerenciamento de continuidade e estado em projetos, baseado no MCP Continuity Tool
javascriptmcpnpm install Lucasdoreac/mcp-continuity-server - mcp-continuity-server-fixed 📜 🏠 - Versão corrigida do MCP Continuity Server compatível com SDK 1.7.0
javascriptmcpservernpm install Lucasdoreac/mcp-continuity-server-fixed - mcp-cursor 📘 🏠 - An MCP server for sending prompts to Cursor IDE
typescriptmcpservernpm install ardyvoid/mcp-cursor - MCP-demo-blog-analyzer 🏠 - A quickstart to test MCP blog analyzer client and a webpage visitor server
mcpserverwebgit clone https://github.com/WaelDataReply/MCP-demo-blog-analyzer - mcp-gh-pr-mini 📜 🏠 - A minimal MCP (Model Context Protocol) server for interacting with GitHub pull requests.
javascriptmcpservernpm install y-hirakaw/mcp-gh-pr-mini - mcp-maxima 📘 🏠 - Model Context Protocol(MCP) server of Maxima.
typescriptmcpservernpm install toms74209200/mcp-maxima - mcp-example-stdio 📘 🏠 - Simple MCP server implementation
typescriptmcpservernpm install a-polishchuk/mcp-example-stdio - mcp-go-colly 🐹 🏠 - When crawling you deserve the best.
webhttpllmgitgithubgo install bneil/mcp-go-colly@latest - mcp-integrated-search-server 📜 🏠 📇 - Integrated Search MCP Server - Google Custom Search + Redmine API integration for AI assistants
javascriptmcpserverapiainpm install mako10k/mcp-integrated-search-server - mcp-jena 📘 🏠 - mcp server for Apache Jena
typescriptmcpservernpm install ramuzes/mcp-jena - mcp-on-vercel 📜 🏠 - Template for deploying an MCP server on Vercel, with bearer authentication for both SSE and Streamable HTTP
javascriptmcpserverauthhttpnpm install xarical/mcp-on-vercel - mcp-servers 📜 🏠 - Kandilli, HangiKredi, Tamamlayıcı Sağlık Mcp Servers
javascripthangikredikandillikandilli-rasathanesimcpnpm install HakanUcaar/mcp-servers - mcp-sumologic 📘 🏠 📇 - MCP Server for SumoLogic API
typescriptmcpserverapinpm install greyaperez/mcp-sumologic - MCP-test 📜 🏠 - Node.js-based
javascriptnpm install k-dudhat/MCP-test - mcp-pwd-generator 📘 🏠 - A Model Context Protocol (MCP) server that generates random passwords with different character sets.
typescriptmcpservernpm install acidkeyxyz/mcp-pwd-generator - mcp-servers-config 📜 🏠 - Cursor用MCPサーバー設定リポジトリ(GitHub、Notion、Brave)
javascriptmcpnpm install u10-github/mcp-servers-config - MCP-ServerV2 📘 🏠 - nueva versión del servidor MCP usando MCP SDK e incluye Incluye validación (zod), permite definir herramientas de forma declarativa, que pueden ser invocadas por modelos como si fueran funciones (similar a OpenAI function calling).
typescriptmcpainpm install klever24v/MCP-ServerV2 - mcp-ptna-news 📜 🏠 - MCP Server for PTNA news feeds
javascriptmcpservernpm install PTNA/mcp-ptna-news - MCP-Puppeteer-Advanced-Cursor-...- 📘 🏠 - Advanced Puppeteer automation server with enhanced functionality (MCP Server)
typescriptmcpservernpm install jatidevelopments/mcp-puppeteer-advanced - mcp-simple-gateway 📘 🏠 - Simple proxy server for MCP with token-based authentication support.
typescriptmcpserverauthnpm install denwakeup/mcp-simple-gateway - MCP-SmartBulb 📘 🏠 - A Node.js + TypeScript-based MCP server that lets you control a smart bulb inside your room—turn it on/off, change brightness, and adjust color dynamically over the private network ip which can be intercepted from the network request of bulb.
typescriptmcpservernodenpm install curious04/MCP-SmartBulb - mcp-tool-server-milvus 📘 🏠 - A MCP server which provides tools function to insert into and query data from the Milvus vector database.
typescriptmcpserverdatabasenpm install yhwang/mcp-tool-server-milvus - mcp-ts-demo-cf 📘 🏠 - Demo of a remote deployed MCP Server
typescriptmcpservernpm install simonberner/mcp-ts-demo-cf - mcp-rcp-server 📘 🏠 - This is just a private project, for your reference.
typescriptnpm install yonaka15/mcp-rcp-server - mcp-recipes 📘 🏠 - A server that exposes tools to query recipes using the Model Context Protocol (MCP).
typescriptmcpservernpm install degentics-ai/mcp-recipes - mcp-remote-server 📜 🏠 - MCP remote context server for Copilot integration
javascriptmcpservernpm install PhanMa01/mcp-remote-server - mcp-search-and-create-task 📘 🏠 - MCP server for searching patients and creating tasks in Flight Health Atlas system.
typescriptmcpservernpm install Flight-Health/mcp-search-and-create-task - mcp-server 📘 🏠 - MCP Server implementation with CloudFlare integration
typescriptmcpservernpm install cbwinslow/mcp-server - mcp-server-demo 📘 🏠 - Create Simple MCP Server with Typescript
typescriptmcpservernpm install sarat9/mcp-server-demo - mcp-rest 📜 🏠 - Exposes a SSE MCP server as a rest endpoints for tools. Only for testing
javascriptmcpserverresttestingnpm install ivanboring/mcp-rest - mcp-server-postgres 📜 🏠 - MCP Server for PostgreSQL databases
javascriptmcpserverdatabasepostgresnpm install yuru-sha/mcp-server-postgres - mcp-server-say-hello 📜 🏠 - The most simple ModelContext Protocol server example, just say hello to user
javascriptservernpm install BrightLin/mcp-server-say-hello - mcp-server-shell-exec 📜 🏠 - Shell Execution MCP Server for Claude and other MCP-compatible AI assistants
javascriptmcpserverainpm install samihalawa/mcp-server-shell-exec - MCP-Rick-Morty-API-Playground 📜 🏠 📇 - MCP server for playing with Rick and Morty API, which using claude for desktop, can get characters per ID or all characters with pagination.
javascriptmcpserverapinpm install zhaxoph/MCP-Rick-Morty-API-Playground - mcp-server 📘 🏠 - mcp server (TypeScript-based)
typescriptmcpservernpm install qingtianyu/mcp-server - mcp-servers 📘 🏠 - Here lies all the custom MCP Servers I have created
typescriptmcpservernpm install melkorCBA/mcp-servers - mcp-starter-kit-node 📘 🏠 - MCP Server example for up and running in Node
typescriptmcpservernodenpm install scriptstar/mcp-starter-kit-node - mcp-turborepo 📘 🏠 - A simple MCP client/server setup.
typescriptmcpservernpm install AnasSiddiqui18/mcp-turborepo - mcp-server 📘 🏠 - Playing with MCP servers.....
typescriptmcpservernpm install RahulRana0707/mcp-server - mcp-server 📘 🏠 📇 - A Model Context Protocol server with GitHub API integration
typescriptserverapinpm install rizzabh/mcp-server - mcp-server 📘 🏠 - A prototype using mcp-framework to build tools for AIs
typescriptmcpainpm install distractdiverge/mcp-server - mcp-server 📘 🏠 - Servidor MCP em teste
typescriptmcpnpm install Maicon-Bartoski-Saas/mcp-server - mcp-server 📘 🏠 - practice mcp server with typescript(GPT 내용)
typescriptmcpservernpm install place-content/mcp-server - mcp-server 📘 🏠 - A full web interface for Minecraft server hosting A marketplace-style dashboard for managing multiple servers Your own cloud-based game hosting panel Tools for teams, events, streamers, or Minecraft mini-game development
typescriptserverwebnpm install Hezhykeyhel/mcp-server - MCP-Server 📜 🏠 - 自用的mcp 服务 (Node.js-based)
javascriptmcpnpm install Alex-lsky/MCP-Server - MCP-server 📜 🏠 📇 - This is a Model Context Protocol (MCP) server implementation that allows AI assistants to interact with Spotify's API.
javascriptmcpserverapiainpm install addy07s/MCP-server - MCP-Server 📘 🏠 📇 - A Model Context Protocol (MCP) server for PayPal API integration with improved error handling, comprehensive API coverage, and detailed documentation.
typescriptmcpserverapiainpm install arbuthnot-eth/MCP-Server - MCP-Server 📘 🏠 - for query and add student
typescriptnpm install lee926427/MCP-Server - mcp-server-aibd-devcontainer 📘 🏠 - MCP server for AI-boosted development in VS Code DevContainers.
typescriptmcpserverainpm install gergelyszerovay/mcp-server-aibd-devcontainer - mcp-server-apple-calendar 📘 🏠 - A simple mcp-server to add calendar events
typescriptmcpservernpm install Allenyzh/mcp-server-apple-calendar - mcp-server-basic 📜 🏠 - A basic MCP server (Node.js-based)
javascriptmcpservernpm install barreiros/mcp-server-basic - mcp-server-bear 📜 🏠 - MCP server for Bear note-taking app
javascriptmcpservernpm install Ssiswent/mcp-server-bear - mcp-server-blockchain 📘 🏠 - mcp server for blockchain
typescriptmcpserverainpm install Brush-Bot/mcp-server-blockchain - mcp-server-boilerplate 📘 🏠 - Model Context Protocol(MCP) サーバーのボイラープレートとなるシンプルな実装です。
typescriptmcpnpm install takunagai/mcp-server-boilerplate - mcp-server-canvas 📘 🏠 - TypeScript-based
typescriptnpm install enkhbold470/mcp-server-canvas - mcp-server-cli-kintone-experimental 📘 🏠 - これは cli-kintone を MCP (Model Context Protocol) Server化できないかという発想をもとに検証している実験的なリポジトリです。機能の揃った MCP Server を求めている方は https://github.com/r3-yamauchi/kintone-mcp-server を使ってください。
typescriptmcpserverhttpnpm install r3-yamauchi/mcp-server-cli-kintone-experimental - mcp-server-cloudbrowser 📜 🏠 - Node.js-based
javascriptnpm install clpublic/mcp-server-cloudbrowser - mcp-server-db 📜 🏠 - A very simple prototype tools that could be equipped by LLM-powered MCP client to access DB. Intended for GDGoC IPBxUI Build with AI workshop.
javascriptmcpaillmgonpm install sultanfariz/mcp-server-db - mcp-server-edgedb 📘 🏠 - EdgeDB MCP服务器项目 (TypeScript-based)
typescriptmcpnpm install obiwan90/mcp-server-edgedb - mcp-server-esign 📜 🏠 - mcp-server-esign (Node.js-based)
javascriptmcpservernpm install esign-cn-open-source/mcp-server-esign - mcp-server-client-example 📘 🏠 - TypeScript-based
typescriptnpm install ykitaza/mcp-server-client-example - mcp-server-config 📜 🏠 - Fixed configuration for Model Context Protocol server with proper dependencies
javascriptservernpm install rvjwhite/mcp-server-config - mcp-server-dev 📜 🏠 - Development repository for MCP (Managed Communication Protocol) server
javascriptmcpservernpm install cnewave/mcp-server-dev - mcp-server-discord-webhook 📜 🏠 - Model Context Protocol server for sending messages via Discord webhooks
javascriptserverwebnpm install shehdrbs123/mcp-server-discord-webhook - mcp-server-example 📜 🏠 📇 - 🚀 A conversational AI agent powered by Model Context Protocol (MCP), Express.js, and Gemini API that can automate Twitter (X) posts and perform dynamic interactions.
javascriptmcpapiainpm install ameyshrotri/mcp-server-example - MCP-server-experiments 📘 🏠 - MCP basic (TypeScript-based)
typescriptmcpnpm install rubaiat-hossain/MCP-server-basic - mcp-server-diceroll 📜 🏠 - Dice Roll Server for Model Context Protocol
javascriptservernpm install fumieval/mcp-server-diceroll - mcp-server-docker-ts 🏠 - TypeScript version of MCP server Docker with remote connection support
mcpserverdockergit clone https://github.com/HelloDimension/mcp-server-docker-ts - mcp-server-extension 📜 🏠 - A basic MCP server for tool exposure using FastMCP and VS code extension distribution
javascriptmcpservernpm install ranjanbinwani/mcp-server-extension - mcp-server-for-java 📘 🏠 - Expose VSCode features such as file viewing and editing as MCP, enabling advanced AI-assisted coding directly from tools like Claude Desktop
typescriptmcpainpm install saikaNya/mcp-server-for-java - MCP-Server-for-Smart-Bulb-With-Claude 📘 🏠 - This project creates an MCP server using Node.js and TypeScript to autonomously control a smart bulb via UDP communication. It integrates with AI interfaces like ChatGPT or Claude, enabling seamless, anonymous, and automated lighting control with color and brightness adjustments.
typescriptjavascriptnodejs-servernpmmcpnpm install Arpitmahajan123/MCP-Server-for-Smart-Bulb-With-Claude - mcp-server-flomo 📜 🏠 - record notes to flomo
javascriptnpm install GolderBrother/mcp-server-flomo - mcp-server-git-learn 📘 🏠 - A repository to learn MCP Server with implementing git features.
typescriptmcpservernpm install killinsun/mcp-server-git-learn - mcp-server-lol 📘 🏠 - a MCP server to lol esport information
typescriptmcpservernpm install andraderaul/mcp-server-lol - mcp-web-cam 📘 🏠 - A MCP server for using web camera
typescriptmcpserverwebnpm install kmizu/mcp-web-cam - mcp-webpage 📘 🏠 - Discusses MCP and popular servers
typescriptmcpservernpm install Raytech99/mcp-webpage - me-mcp 📘 🏠 - Your personal MCP Server
typescriptmcpservernpm install mihalik/me-mcp - mcp-server-google-cloud-logging 📘 🏠 - gcloud で Logging からログを取得する
typescriptloggingnpm install kazuhideoki/mcp-server-google-cloud-logging - mcp-server-google-search 📘 🏠 - MCP server proxy for Google Programmable Search Engine
httpgitgithubtypescriptmcp-servernpm install 1999AZZAR/mcp-server-google-search - mcp-server-k8s 📘 🏠 - MCP server for enabling AI use local k8s resources
typescriptmcpserverainpm install Wan-Hao/mcp-server-k8s - mcp-server-librarian 📘 🏠 📇 - Librarian is a Model Context Protocol (MCP) server that provides an API for listing, searching, and retrieving markdown files stored in a structured manner.
typescriptmcpmcp-serverserverapinpm install SegaraRai/mcp-server-librarian - mcp-server-linearapp 📘 🏠 📇 - A Model Context Protocol (MCP) server for the Linear API
typescriptlinearmcpmcp-serverservernpm install magarcia/mcp-server-linearapp - mcp-server-promua 📘 🏠 📇 - MCP сервер для роботи з API Prom.ua
typescriptmcpapinpm install bigcatchkm/mcp-server-promua - mcp-server-qdrant-retrieve 📘 🏠 - MCP server for semantic search with Qdrant vector database
typescriptmcpserverdatabasenpm install gergelyszerovay/mcp-server-qdrant-retrive - mcp-server-starter-kit 📜 🏠 - Trying mcp server for the very first time.
javascriptmcpservernpm install anix001/mcp-server-starter-kit - mcp-server-strateegia 📘 🏠 📇 - Model Context Protocol for strateegia API
typescriptapinpm install filipecalegario/mcp-server-strateegia - mcp-server-taiwan-aqi 🐘 🏠 - PHP-based
phpgit clone https://github.com/besthand/mcp-server-taiwan-aqi - mcp-server-tess 📘 🏠 - Servidor MCP TESS para integração de agentes - Implementação do protocolo MCP para serviços TESS AI
typescriptmcpainpm install diegofornalha/mcp-server-tess - mcp-server-tess-xtp 📘 🏠 📇 - Extensão XTP para o servidor MCP-TESS - Integração da API TESS com XTP
typescriptmcpapinpm install diegofornalha/mcp-server-tess-xtp - mcp-server-test 🏠 - React application for MCP server test
cssmcpserverreactgit clone https://github.com/moebius08/mcp-server-test - MCP-Server-Tester 🏠 - MCP Server Tester is a simple web tool to test and validate MCP server installation codes. Built with Node.js, Express, and EJS, it provides real-time server response results with a clean, responsive UI.
ejsaxioscssejs-template-engineexpressjsgit clone https://github.com/nandkumar1000/MCP-Server-Tester - mcp-servers 📜 🏠 - Repository for MCP (Model Context Protocol) servers and related resources
javascriptmcpservernpm install allanbrunobr/mcp-servers - mcp-server-test 📜 🏠 - Test MCP Server (Node.js-based)
javascriptmcpservernpm install paveldudka/mcp-server-test - mcp-server-typescript-template 📘 🏠 - MCP Server Template using @modelcontextprotocol Typescript SDK
typescriptmcpservernpm install zubhav/mcp-server-typescript-template - mcp-server-web3 📘 🏠 - The web3 function plugin server base on MCP of Anthropic.
typescriptmcpserverwebnpm install tdergouzi/mcp-server-web3 - mcp-servers 📘 🏠 - A collection of Minecraft Protocol (MCP) servers implemented in TypeScript
typescriptmcpservernpm install pgtipping/mcp-servers - mcp-servers 📜 🏠 - This project is for MCP Servers and Agentic Modelling.
javascriptmcpservernpm install jigarbhoye04/mcp-servers - mcp-servers 📘 🏠 - MCP servers to give super powers to LLMs
typescriptmcpserverllmnpm install frhgm/mcp-servers - mcp-servers 📜 🏠 - Collection of Model Context Protocol (MCP) servers for Cursor IDE integration
javascriptmcpservernpm install GrandMasterK414/mcp-servers - mcp-servers 📘 🏠 - MCP Servers For System
typescriptmcpservernpm install The-System-Coperation/mcp-servers - mcp-template 📜 🏠 - A template for building MCP (Model Context Protocol) servers for Claude and other AI assistants
javascriptmcpserverainpm install 3dyuval/mcp-template - mcp-tenor-api 📘 🏠 📇 - An mcp server for using the tenor api
typescriptmcpserverapinpm install hzrd149/mcp-tenor-api - mcp-testing-library 📘 🏠 - Test environment for MCP servers
typescriptmcpservernpm install moekiorg/mcp-testing-library - mcp-server-rubygems 📘 🏠 📇 - A Model Context Protocol (MCP) server for fetching rubygems metadata via rubygems.org API
typescriptmcpmcp-servermodel-context-protocolrubynpm install 6/mcp-server-rubygems - mcp-todo-app 📘 🏠 - a combination of MCP server and client that add a touch of AI to simple todo app
typescriptmcpserverainpm install waliseddiqi/mcp-todo-app - mcp-ts-quickstart 📘 🏠 - Build-less TypeScript quickstart for an MCP server implementation
typescriptbuild-freemcpmcp-servernodenpm install cephalization/mcp-ts-quickstart - MCP-x 📜 🏠 - mcp client and server both with gemini ai
javascriptmcpserverainpm install shubham6822/MCP-x - MCPCalendar 📘 🏠 - MCP Server for Connecting Google Calendar And Claude Desktop
typescriptmcpservergonpm install Codewith-me1/MCPCalendar - mcpdotdirect_evm-mcp-server 📘 🏠 - Mirror of https://github.com/mcpdotdirect/evm-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/mcpdotdirect_evm-mcp-server - mcpServer 📘 🏠 - MCP 서버 학습을 위한 간단예제 실습
typescriptmcpnpm install hyen43/mcpServer - McpServer 📜 🏠 📇 - An MCP (Model Context Protocol server) Api / Server
javascriptmcpserverapinpm install ericbowser/McpServer - MCPTest 📘 🏠 - Testing MCP server (TypeScript-based)
typescriptmcpservertestingnpm install Sandesha-Patali/MCPTest - mcptest 📜 🏠 - MCP server with GitHub integration
javascriptmcpservernpm install somaria/mcptest - md2PDF-MCP 📜 🏠 - Node.js-based
javascriptnpm install BlakeB254/md2PDF-MCP - mem0-mcp-server-ts 📘 🏠 - A TypeScript implementation of the Mem0 MCP server for integration with various tools like Smithery, Cursor, and more.
typescriptmcpservernpm install sadiuysal/mem0-mcp-server-ts - metis-mcp-demo 📜 🏠 - A demo repository for testing the GitHub MCP server
javascriptmcpservertestingnpm install dagron78/metis-mcp-demo - milkosten_task-mcp-server 📜 🏠 - Mirror of https://github.com/milkosten/task-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/milkosten_task-mcp-server - mcpservers_mcp-server-chatsum 📘 🏠 - Mirror of https://github.com/mcpservers/mcp-server-chatsum
typescriptmcpserverhttpnpm install MCP-Mirror/mcpservers_mcp-server-chatsum - mhazarabad/browser-use-mcp 🏠 📇 - Automates browser tasks using the Browser Use API, offering task management and monitoring capabilities.
apihttpgitgithubmonitoring - minesweeper-mcp-server 📜 🏠 - An MCP server for playing Minesweeper
javascriptmcpservernpm install CODGODMW/minesweeper-mcp-server - Monad-Testnet-Uniswap-MCP-Server 📘 🏠 - A MCP server built on Monad Testnet ultilizing Uniswap V2 for buying and selling tokens
typescriptmcpservernpm install K115DuyBowl/Monad-Testnet-Uniswap-MCP-Server - MonkeytypeMCP 📜 🏠 📇 - An MCP server for monkeytype.com that exposes all of their API endpoints.
javascriptmcp-servertypingtypingspeedmcpnpm install CodeDreamer06/MonkeytypeMCP - monobank-mcp 📘 🏠 - A Monobank MCP (Model Context Protocol) Server
typescriptmcpmcp-servermonomonobanknpm install todesstoss/monobank-mcp - minimind-org_mcp-server-typescript-template 📘 🏠 - Mirror of https://github.com/minimind-org/mcp-server-typescript-template
typescriptmcpserverhttpnpm install MCP-Mirror/minimind-org_mcp-server-typescript-template - misterboe_strapi-mcp-server 📜 🏠 📇 - Mirror of https://github.com/misterboe/strapi-mcp-server
javascriptmcpserverapihttpnpm install MCP-Mirror/misterboe_strapi-mcp-server - mkusaka_mcp-shell-server 📘 🏠 - Mirror of https://github.com/mkusaka/mcp-shell-server
typescriptmcpserverhttpnpm install MCP-Mirror/mkusaka_mcp-shell-server - mmnt-mcp-server 📘 🏠 - MCP server for Mamont search engine
typescriptmcpservernpm install zbkm/mmnt-mcp-server - Model-Context-Protocol 📘 🏠 - Resources to Understand MCPs and Interacts with MCP Server
typescriptmcpservergit clone https://github.com/Kushal1306/Model-Context-Protocol - Model-Context-Protocol 📘 🏠 - Model Context Protocol Server PoC Project
typescriptmcpmcp-serverservergit clone https://github.com/ellenfel/Model-Context-Protocol - model-context-provider-server 📘 🏠 - Built a MCP server for learning purpose
typescriptmcpservernpm install bizprat/model-context-provider-server - mohammeduvaiz_figma-mcp-server 📘 🏠 - Mirror of https://github.com/mohammeduvaiz/figma-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/mohammeduvaiz_figma-mcp-server - mkusaka_mcp-server-perplexity 📜 🏠 - Mirror of https://github.com/mkusaka/mcp-server-perplexity
javascriptmcpserverhttpnpm install MCP-Mirror/mkusaka_mcp-server-perplexity - mohdsuhail007/VerbilioMCP 🏠 - Facilitates seamless integration with GitHub using Verbilio MCP server for streamlined workflow automation.
httpaimlgitgithub - mx-mcp 📘 🏠 - MCP Server for MultiversX
typescriptmcpservernpm install multiversx/mx-mcp - pangea-mcp-server 📘 🏠 📇 - A Model Context Protocol (MCP) server that provides integration with Pangea APIs
typescriptmcpserverapinpm install pangeacyber/pangea-mcp-server - my-model-context 📘 🏠 - CLI to smootly manage local MCP configurations.
typescriptmcpgit clone https://github.com/matteovhaxt/my-model-context - open-api-mcp 📘 🏠 📇 - Generate a MCP server based on OpenAPI specifications
typescriptmcpserverapinpm install nexpando-com/open-api-mcp - openSVM_dexscreener-mcp-server 📜 🏠 - Mirror of https://github.com/openSVM/dexscreener-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/openSVM_dexscreener-mcp-server - mikhael-abdallah_mcp-revisor-server 📘 🏠 - Mirror of https://github.com/mikhael-abdallah/mcp-revisor-server
typescriptmcpserverhttpnpm install MCP-Mirror/mikhael-abdallah_mcp-revisor-server - moom-mcp 📜 🏠 - MCP server for controlling Moom window layouts on macOS through Claude Desktop
javascriptmcpservernpm install itrimble/moom-mcp - my-first-mcpserver 📘 🏠 - my first MCP Server specifically for MS Copilot
typescriptmcpservernpm install danar124/my-first-mcpserver - my-mcp-server 📘 🏠 - Try MCP Server (TypeScript-based)
typescriptmcpservernpm install danny-yamamoto/my-mcp-server - my-mcp-server 📜 🏠 - Demo project showcasing MCP server integration with MongoDB Atlas for payment data retrieval.
javascriptmcpservermongodbgonpm install Denyme24/mcp-payments-demo - N2YO-MCP 📘 🏠 - MCP server to query N2YO space catalog
typescriptmcpservernpm install MaxwellCalkin/N2YO-MCP - nAItive_Cloudflare_MCP 📜 🏠 - MCP client repository for Cloudflare services integration with Cursor/GitHub - enables natural language interaction with Cloudflare's 13 MCP servers including documentation, Workers bindings, observability, container services, and AutoRAG.
javascriptmcpserveraidocumentationnpm install mikec-naitive/nAItive_Cloudflare_MCP - neon-auth-mcp-oauth 📘 🏠 - PoC of an MCP server in a Next.js app with Neon Auth and custom OAuth flow for MCP.
typescriptmcpserverauthoauthnpm install andrelandgraf/neon-auth-mcp-oauth - normal-coder_gitee-mcp-server 📘 🏠 - Mirror of https://github.com/normal-coder/gitee-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/normal-coder_gitee-mcp-server - onx-mcp-server 📘 🏠 📇 - A Model Context Protocol (MCP) server implementation that integrates with Onspring's API, allowing AI assistants to access and manipulate data stored in Onspring instances.
typescriptmcpmcp-serveronspringservernpm install StevanFreeborn/onx-mcp-server - naver-api-mcp-server 📘 🏠 📇 - nest.js naver api mcp server
typescriptmcpserverapinpm install easdkr/naver-api-mcp-server - niklauslee_frame0-mcp-server 📜 🏠 - Mirror of https://github.com/niklauslee/frame0-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/niklauslee_frame0-mcp-server - nulab_backlog-mcp-server 📘 🏠 - Mirror of https://github.com/nulab/backlog-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/nulab_backlog-mcp-server - nuxt-ui-mcp 📘 🏠 - Nuxt UI MCP Server (TypeScript-based)
typescriptmcpservernpm install katokdoescode/nuxt-ui-mcp - octagon-funding-data-mcp 📜 🏠 📇 - The Octagon Funding Data MCP server provides specialized AI-powered company funding transaction analysis capabilities by integrating with advanced funding intelligence agents. Covers comprehensive venture capital research, funding rounds, investor activity, and investment trends.
javascriptmcpserverapiainpm install OctagonAI/octagon-funding-data-mcp - octagon-transcripts-mcp 📜 🏠 - The Octagon Transcripts MCP server provides specialized AI-powered earnings call transcript analysis capabilities by integrating with advanced transcripts analysis agents. Covers over 8,000 public companies with continuous daily updates and historical data dating back to 2018.
javascriptmcpserveraigonpm install OctagonAI/octagon-earnings-transcripts-mcp - omnisend-mcp 📘 🏠 - Omnisend MCP server (TypeScript-based)
typescriptmcpservernpm install plutzilla/omnisend-mcp - osm-mcp-server 📜 🏠 📇 - A Model Context Protocol server for OpenStreetMap APIs
javascriptserverapinpm install yuiseki/osm-mcp-server - pdf-co-mcp-server 📜 🏠 📇 - MCP server for PDF.co API integration - enables AI assistants to perform PDF operations
javascriptmcpserverapiainpm install nikolausm/pdf-co-mcp-server - perspective-mcp 📜 🏠 - MCP server for multi-perspective analysis and structured debates
javascriptai-toolsmcpmodel-context-protocoltypescriptnpm install FiveOhhWon/perspective-mcp - MCP-Weather-Server 📘 🏠 - A weather server application for MCP
typescriptmcpservernpm install cskiro/MCP-Weather-Server - minecraft-mcp 📜 🏠 - Using Mineflayer to create an MCP server to Minecraft.
javascriptmcpservernpm install uukelele-scratch/minecraft-mcp - Monad-MCP-Server 📜 🏠 - This MCP server allows to check the MONAD network data
javascriptmcpservernpm install LOFT228/Monad-MCP-Server - mongo_mcp_server 📘 🏠 - mongodb mcp server를 만들어보자
typescriptmcpservermongodbgonpm install seeun0210/mongo_mcp_server - mongodb-mcp-server 📜 🏠 - A Model Context Protocol server for MongoDB integration with Claude
javascriptservermongodbgonpm install ryaker/mongodb-mcp-server - moody-mcp-server 📘 🏠 - ポケモンの特性「むらっけ」を簡易的に再現したMPC Server
typescriptservernpm install crow-fox/moody-mcp-server - MrunmayS_exa-mcp-server 📜 🏠 - Mirror of https://github.com/MrunmayS/exa-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/MrunmayS_exa-mcp-server - my-first-mcp 📘 🏠 - My first MCP (Model Context Protocol) server
typescriptlearningmcpmodelcontextprotocolpocnpm install kWAYTV/my-first-mcp - Msparihar_mcp-server-firecrawl 📘 🏠 - Mirror of https://github.com/Msparihar/mcp-server-firecrawl
typescriptmcpserverhttpnpm install MCP-Mirror/Msparihar_mcp-server-firecrawl - my-mcp-server 📘 🏠 - MCP test (TypeScript-based)
typescriptmcpnpm install Laity624/my-mcp-server - myfirstmcpserver 📜 🏠 - My first mcp server (Node.js-based)
javascriptmcpservernpm install enriquetecfan11/myfirstmcpserver - mysql_mcp 📜 🏠 - Node.js-based
javascriptnpm install boyzoid/mysql_mcp - Nekzus_mcp-server 📜 🏠 - Mirror of https://github.com/Nekzus/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/Nekzus_mcp-server - neondatabase-labs_mcp-server-neon 📘 🏠 - Mirror of https://github.com/neondatabase-labs/mcp-server-neon
typescriptmcpserverdatabasehttpnpm install MCP-Mirror/neondatabase-labs_mcp-server-neon - niledatabase_nile-mcp-server 📘 🏠 - Mirror of https://github.com/niledatabase/nile-mcp-server
typescriptmcpserverdatabasehttpnpm install MCP-Mirror/niledatabase_nile-mcp-server - niyonabil_blogger-mcp-server 📘 🏠 - Mirror of https://github.com/niyonabil/blogger-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/niyonabil_blogger-mcp-server - noahgsolomon_pumpfun-mcp-server 📘 🏠 - Mirror of https://github.com/noahgsolomon/pumpfun-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/noahgsolomon_pumpfun-mcp-server - notion-mcp 📘 🏠 - Notion MCP Server (TypeScript-based)
typescriptmcpmcp-servernotionnotion-apinpm install tkc/notion-mcp - Noveum_api-market-mcp-server 📘 🏠 📇 - Mirror of https://github.com/Noveum/api-market-mcp-server
typescriptmcpserverapihttpnpm install MCP-Mirror/Noveum_api-market-mcp-server - npmtrends-mcp-server 📘 🏠 - Model Context Protocol Server for NPM trends.
typescriptservernpm install jeasonstudio/npmtrends-mcp-server - nsxdavid_clickup-mcp-server 📘 🏠 - Mirror of https://github.com/nsxdavid/clickup-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/nsxdavid_clickup-mcp-server - nsxdavid_surrealdb-mcp-server 📜 🏠 - Mirror of https://github.com/nsxdavid/surrealdb-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/nsxdavid_surrealdb-mcp-server - oboard_mcp 📘 🏠 📇 - Oboard MCP - Model Context Protocol for Oboard API
typescriptmcpapinpm install don-alberto/oboard_mcp - ogoldberg_gemini-context-mcp-server 📘 🏠 - Mirror of https://github.com/ogoldberg/gemini-context-mcp-server
typescriptmcpserverhttpgonpm install MCP-Mirror/ogoldberg_gemini-context-mcp-server - okto-mcp-server 📜 🏠 📇 - MCP sever using okto v2 apis
javascriptmcpapinpm install okto-hq/okto-mcp-server - olostep_olostep-mcp-server 📘 🏠 - Mirror of https://github.com/olostep/olostep-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/olostep_olostep-mcp-server - onigeya_siyuan-mcp-server 📘 🏠 - Mirror of https://github.com/onigeya/siyuan-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/onigeya_siyuan-mcp-server - Nazruden_clickup-mcp-server 📘 🏠 - Mirror of https://github.com/Nazruden/clickup-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/Nazruden_clickup-mcp-server - notification-mcp 📜 🏠 - MCP server to send notifications via Telegram
javascriptmcpservernpm install MobileVibe/notification-mcp - open-browser-mcp-server 📜 🏠 - Open the browser and visit the specified website address
javascriptwebnpm install handoing/open-browser-mcp-server - openai-mcp-server 📜 🏠 - MCP server for OpenAI protocol
javascriptmcpserverainpm install voronkovm/openai-mcp-server - openweathermap-mcp-server 📘 🏠 📇 - A lightweight MCP server using Bun to fetch current and 5-day weather data from OpenWeatherMap APIs. Built with @modelcontextprotocol/sdk, Zod for validation, and Axios for API calls. Provides tools to get weather info by latitude and longitude over stdio transport.
typescriptmcpserverapinpm install abhayymishraa/openweathermap-mcp-server - mtane0412_ghost-mcp-server 📘 🏠 - Mirror of https://github.com/mtane0412/ghost-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/mtane0412_ghost-mcp-server - mtane0412_twitch-mcp-server 📘 🏠 - Mirror of https://github.com/mtane0412/twitch-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/mtane0412_twitch-mcp-server - my-mcp-servers 📜 🏠 - A quick implementation for MCP servers. CodeQL implemented for security checks and avoid leaks of your sensitive data.
javascriptmcpservernpm install cremerf/my-mcp-servers - my-mcp-worker 📘 🏠 - MCP Server with Cloudflare Workers
typescriptmcpservernpm install sivakumarl/my-mcp-worker - nacgarg_bazel-mcp-server 📜 🏠 - Mirror of https://github.com/nacgarg/bazel-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/nacgarg_bazel-mcp-server - nailuoGG_anki-mcp-server 📘 🏠 - Mirror of https://github.com/nailuoGG/anki-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/nailuoGG_anki-mcp-server - OpenAI-WebSearch-MCP-Server 📜 🏠 - A server for handling OpenAI web search using MCP (Multi-Config Protocol)
javascriptmcpserverwebainpm install bitibi/OpenAI-WebSearch-MCP-Server - openbnb-org_mcp-server-airbnb 📜 🏠 - Mirror of https://github.com/openbnb-org/mcp-server-airbnb
javascriptmcpserveraihttpnpm install MCP-Mirror/openbnb-org_mcp-server-airbnb - orbit-logistics_notion-mcp-server 📘 🏠 - Mirror of https://github.com/orbit-logistics/notion-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/orbit-logistics_notion-mcp-server - OtotaO_unsloth-mcp-server 📜 🏠 - Mirror of https://github.com/OtotaO/unsloth-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/OtotaO_unsloth-mcp-server - PaddleHQ_paddle-mcp-server 📘 🏠 - Mirror of https://github.com/PaddleHQ/paddle-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/PaddleHQ_paddle-mcp-server - ParasSolanki_github-mcp-server 📘 🏠 - Mirror of https://github.com/ParasSolanki/github-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/ParasSolanki_github-mcp-server - ParasSolanki_jira-mcp-server 📘 🏠 - Mirror of https://github.com/ParasSolanki/jira-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/ParasSolanki_jira-mcp-server - PaymanAI_payman-doc-mcp-server 📘 🏠 - Mirror of https://github.com/PaymanAI/payman-doc-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/PaymanAI_payman-doc-mcp-server - PayPal-MCP-defunct 📘 🏠 📇 - A Model Context Protocol (MCP) server for PayPal API integration with backdated commits
typescriptmcpserverapinpm install arbuthnot-eth/PayPal-MCP-Backdated - pblittle_lightning-mcp-server 📘 🏠 - Mirror of https://github.com/pblittle/lightning-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/pblittle_lightning-mcp-server - peancor_moodle-mcp-server 📜 🏠 - Mirror of https://github.com/peancor/moodle-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/peancor_moodle-mcp-server - peeper-mcp-server 📜 🏠 - Model Control Panel server for Peeper application
javascriptservernpm install maskedsaqib/peeper-mcp-server - peng-shawn_mermaid-mcp-server 📜 🏠 - Mirror of https://github.com/peng-shawn/mermaid-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/peng-shawn_mermaid-mcp-server - neondatabase_mcp-server-neon 📘 🏠 - Mirror of https://github.com/neondatabase/mcp-server-neon
typescriptmcpserverdatabasehttpnpm install MCP-Mirror/neondatabase_mcp-server-neon - Perplexity Ask MCP Server - A Model Context Protocol Server connector for Perplexity API, to enable web search without leaving the MCP ecosystem.
perplexitysearchweb - portkey-admin-mcp-server 📘 🏠 - A Model Context Protocol (MCP) server implementation for the Portkey AI platform, providing a standardized interface for managing AI configurations, workspaces, and analytics.
typescriptmcpserverainpm install r-huijts/portkey-admin-mcp-server - Resilient-MCP 📘 🏠 - MCP Server to interact with ResilientDB
typescriptmcpservernpm install harish876/Resilient-MCP - probo-mcp-server 📜 🏠 📇 - A Model Context Protocol (MCP) wrapper for the Probo printing API. Simplifies interactions with Probo's print service through standardized, type-safe interfaces for product configuration, ordering, and status tracking.
javascriptmcpapinpm install BrightNexo/probo-mcp-server - procesio-mcp-server 📜 🏠 📇 - MCP Server for interacting with the Procesio API
javascriptmcpserverapinpm install serenichron/procesio-mcp-server - pushinator-mcp 📘 🏠 - Official Pushinator MCP server
typescriptmcp-servermodel-context-protocolpush-notificationsmcpnpm install appricos/pushinator-mcp - sinch-mcp-server 📘 🏠 📇 - Exposing Sinch's APIs as MCP Tools
typescriptmcpapinpm install sinch/sinch-mcp-server - Solana-MCP 📜 🏠 - A simple solana mcp server.
javascriptmcpservernpm install Devang0907/Solana-MCP - speaking-bots-mcp 📘 🏠 - An MCP server that can send speaking bots inside meetings
typescriptmcpservernpm install Meeting-Baas/speaking-bots-mcp - stateset-mcp-server 📘 🏠 - StateSet MCP Server (TypeScript-based)
typescriptmcpservernpm install stateset/stateset-mcp-server - web-content-mcp 📘 🏠 - TypeScript-based
typescriptnpm install hmalfee/web-content-mcp - token-info-mcp 📜 🏠 - MCP server to check Betha's OAuth tokens
javascriptmcpserverauthoauthnpm install Castrozan/token-info-mcp - t3ta_sql-mcp-server 📘 🏠 - Mirror of https://github.com/t3ta/sql-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/t3ta_sql-mcp-server - teable-mcp-server 📜 🏠 - an mcp server to interact with teable's database
javascriptmcpserverdatabasenpm install mounta11n/teable-mcp-server - translate-server 📘 🏠 - 一个简单的翻译MCP Server,可以实现单文件或者目录翻译能力,仅支持JSON数据(JSON,JS,TS格式),根据文件名称自动截取翻译的目标语言,完成自动化处理。
typescriptmcpserverjsonnpm install vlinr/translate-server - weather-mcp 📘 🏠 - Sample mcp app from anthropic tutorials
typescriptmcpnpm install The-Focus-AI/weather-mcp - super-win-cli-mcp-server 📘 🏠 - Super Windows CLI Server, Fixed this "https://www.mcpmarket.com/server/super-windows-cli" as it is a mess to run on windows.
typescriptmcpserverhttpnpm install Faucet94/super-win-cli-mcp-server - taskeract-mcp 📜 🏠 - Node.js-based
javascripthttpgitgithubnpm install Acqusys/taskeract-mcp - test-mcp-server 📘 🏠 - delete me (TypeScript-based)
typescriptnpm install gecBurton/test-mcp-server - TestMcpServer 🏠 - A Model Context Protocol server implementation providing mathematical operations through a standardized interface. Built with TypeScript and Node.js, this server demonstrates how to create and expose tools via the Model Context Protocol specification.
htmlservernodegit clone https://github.com/maikmetzger/TestMcpServer - testai-mcp-server 📘 🏠 - testai-mcp-server (TypeScript-based)
typescriptmcpserverainpm install eax/testai-mcp-server - SurajAdsul_mcp-server-salesforce 📘 🏠 - Mirror of https://github.com/SurajAdsul/mcp-server-salesforce
typescriptmcpserverhttpnpm install MCP-Mirror/SurajAdsul_mcp-server-salesforce - tauri-mcp-weather 📘 🏠 - A Tauri app that implements MCP weather server and client
typescriptmcpservernpm install pipefold/tauri-mcp-weather - tenderned-mcp 📘 🏠 - a POC Tenderned MCP server to fetch Tenderned data
typescriptmcpservernpm install jeroensmink98/tenderned-mcp - think-tool-mcp 📜 🏠 - An MCP server implementing Anthropic's think tool
javascriptmcpservernpm install monotykamary/think-tool-mcp - timewarrior-mcp 📘 🏠 - MCP Server for interacting with TimeWarrior
typescriptmcpservernpm install MicroMichaelIE/timewarrior-mcp - timing-mcp-server 📘 🏠 - This is Timing(time tracking app) MCP Server
typescriptmcpmcp-servertimingservernpm install tomoyanakano/timing-mcp-server - tmhr1850_backlog-mcp-server 📘 🏠 - Mirror of https://github.com/tmhr1850/backlog-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/tmhr1850_backlog-mcp-server - todo_mcp_server 📜 🏠 - A simple todo model context protocol (mcp) server
javascriptmcpservernpm install imsaar/todo_mcp_server - todo-mcp-server 📘 🏠 📇 - A demo project connecting AI assistants to a Todo app using Model Context Protocol. Features React frontend, FastAPI backend, and Claude Desktop integration.
typescriptapiaireactnpm install sam55silver/todo-mcp-server - toyMCP 📜 🏠 📇 - This is a simple example server implementing a To-Do list CRUD API using the Model Context Protocol (MCP) concepts, specifically using JSON-RPC 2.0 over HTTP. It uses Node.js, Express, and PostgreSQL (via Docker) for persistence.
javascriptmcpserverapihttpnpm install izaqyos/toyMCP - trade_mcp 📘 🏠 - Created a MCP server with zeroda trade SDK
typescriptmcpservernpm install adarshask07/trade_mcp - TommyBez_dbt-semantic-layer-mcp-server 📘 🏠 - Mirror of https://github.com/TommyBez/dbt-semantic-layer-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/TommyBez_dbt-semantic-layer-mcp-server - T1nker-1220_memories-with-lessons-mcp-server 📜 🏠 - Mirror of https://github.com/T1nker-1220/memories-with-lessons-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/T1nker-1220_memories-with-lessons-mcp-server - transcript-manager-mcp 📘 🏠 - Orchestrates several MCP servers to streamline my note-gathering process
typescriptmcpservermlnpm install lmarte17/transcript-manager-mcp - syucream_holaspirit-mcp-server 📘 🏠 - Mirror of https://github.com/syucream/holaspirit-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/syucream_holaspirit-mcp-server - syucream_lightdash-mcp-server 📘 🏠 - Mirror of https://github.com/syucream/lightdash-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/syucream_lightdash-mcp-server - tadasant_mcp-server-stability-ai 📘 🏠 - Mirror of https://github.com/tadasant/mcp-server-stability-ai
typescriptmcpserveraihttpnpm install MCP-Mirror/tadasant_mcp-server-stability-ai - tanevanwifferen_usescraper-mcp-server 📜 🏠 - Mirror of https://github.com/tanevanwifferen/usescraper-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/tanevanwifferen_usescraper-mcp-server - tatn_mcp-server-diff-typescript 📜 🏠 - Mirror of https://github.com/tatn/mcp-server-diff-typescript
javascriptmcpserverhttpnpm install MCP-Mirror/tatn_mcp-server-diff-typescript - tbensonwest_loxo-mcp-server 📜 🏠 - Mirror of https://github.com/tbensonwest/loxo-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/tbensonwest_loxo-mcp-server - test-mcp-server 🏠 - test mcp server develop with typescript
mcpservergit clone https://github.com/287852793/test-mcp-server - untapped-mcp 📘 🏠 - A Untapped MCP server to be used with claude.
typescriptmcpservernpm install etoxin/untapped-mcp - vestige-mcp 📘 🏠 - Vestige MCP Server implementation, Algorand batteries included!
typescriptmcpservergonpm install GoPlausible/vestige-mcp - trykitt-mcp 📜 🏠 📇 - An MCP server acting as a wrapper around the Trykitt API (https://trykitt.ai/) to find and verify B2B emails via AI assistants.
javascriptmcpserverapiainpm install samy-clivolt/trykitt-mcp - ts-demo-mcp 📘 🏠 - MCP Server Template for Bun Developers
typescriptmcpmcp-serverservernpm install gedankrayze/ts-demo-mcp - tsp-mcp-server 📜 🏠 - A Model Context Protocol server for solving Traveling Salesman Problem (TSP)
javascriptservernpm install omeletJK/tsp-mcp-server - u301-mcp 📜 🏠 - Effortlessly create clean, elegant links in bulk — powered by AI.
javascriptmcp-serveru301url-shortenerainpm install tealight-uk/u301-mcp - typespec-mcp-todo 📘 🏠 - A simple TODO MCP server fully vibecoded using the TypeSpec MCP Server with GitHub Copilot and OpenAI GPT 4.1
typescriptmcpserverainpm install achandmsft/typespec-mcp-todo - uh-joan_cortellis-mcp-server 📜 🏠 - Mirror of https://github.com/uh-joan/cortellis-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/uh-joan_cortellis-mcp-server - unctad-ai_eregulations-mcp-server 📘 🏠 - Mirror of https://github.com/unctad-ai/eregulations-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/unctad-ai_eregulations-mcp-server - usegranthq_mcp-server 📜 🏠 - Mirror of https://github.com/usegranthq/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/usegranthq_mcp-server - vikunja-mcp 📘 🏠 - Basic MCP server for interacting with Vikunja to-do app
typescriptmcpservernpm install AnthonyUtt/vikunja-mcp - webcrawl-mcp 📘 🏠 - This repository implements a Model Context Protocol (MCP) server for web crawling capabilities, exposing crawlers as LangChain-compatible tools or any MCP-compliant client. It includes two main services:
typescriptmcpserverwebainpm install SteffenHebestreit/Webcrawl-MCP - weather-mcp 📘 🏠 - A Weather MCP server providing weather alerts and forecasts via the Model Context Protocol.
typescriptmcpmcp-servernodejsservernpm install encoreshao/weather-mcp - WebRendererMCP 📜 🏠 - MCP server that renders HTML produced by LLMs
javascriptmcpservermlllmnpm install zys5945/WebRendererMCP - wechat-mcp-server 📜 🏠 - wechat-mcp-server (Node.js-based)
javascriptmcpservernpm install Sirhap/wechat-mcp-server - weidwonder_terminal-mcp-server 📘 🏠 - Mirror of https://github.com/weidwonder/terminal-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/weidwonder_terminal-mcp-server - WhatsApp-MCP-Server 📘 🏠 - This server bridges WhatsApp messages with large language models, allowing for intelligent summarization, response generation, scheduling, and personal assistant tasks using the MCP specification.
typescriptmcpservernpm install Mtumish1/WhatsApp-MCP-Server - wikipedia-mcp-server 📘 🏠 📇 - Minimal TypeScript-based HTTP server exposing Wikipedia search and page retrieval via MediaWiki API
typescriptmcpmediawikiserverapinpm install 1999AZZAR/wikipedia-mcp-server - weather-mcp 📜 🏠 - Sample MCP server implementation for fetching weather forecasts
javascriptmcpservernpm install nakamurau1/weather-mcp - weather-mcp 📘 🏠 - A weather MCP server Demo
typescriptmcp-serverssestdiomcpnpm install vhxnif/weather-mcp - Weather-MCP-server 📘 🏠 - Learning how to create MCP server in node js
typescriptmcpservernodenpm install Prashant-Kamboj/Weather-MCP-server - weather-server 📜 🏠 - TypeScript-based MCP server that implements a weather information system.
javascriptmcpservernpm install chaminda360/weather-server - web-monitor-mcp-safepoint 🏠 - The mcp server for safepoint web monitor
mcpserverwebgit clone https://github.com/co0ontty/web-monitor-mcp-safepoint - yourls-mcp 📜 🏠 - Model Control Protocol (MCP) server for YOURLS URL shortening integration with Claude Desktop
javascriptmcpservernpm install kesslerio/yourls-mcp - wesnermichel_nexus-mcp-claude-desktop-server 📘 🏠 - Mirror of https://github.com/wesnermichel/nexus-mcp-claude-desktop-server
typescriptmcpserverhttpnpm install MCP-Mirror/wesnermichel_nexus-mcp-claude-desktop-server - when2meet-mcp 📜 🏠 - This is a Model Context Protocol (MCP) server that provides integration with When2Meet. It allows users to specify availability in natural language, and for LLMs to fill out their when2meet in their place.
javascriptmcpserveraillmnpm install joyce-yuan/when2meet-mcp - WilliamCloudQi_matlab-mcp-server 📜 🏠 - Mirror of https://github.com/WilliamCloudQi/matlab-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/WilliamCloudQi_matlab-mcp-server - win4r_browser-use-MCP-Server 📜 🏠 - Mirror of https://github.com/win4r/browser-use-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/win4r_browser-use-MCP-Server - woocommerce-mcp-server-project 📜 🏠 - MCP сервер для управления магазином WooCommerce
javascriptmcpnpm install Vostos007/woocommerce-mcp-server-project - wordware-mcp 📜 🏠 - Local MCP server for running Wordware apps
javascriptmcpservernpm install yuhuangou/wordware-mcp - wp-mcp 📘 🏠 - An MCP server exploration
typescriptmcpservernpm install hafizrahman/wp-mcp - xinghuo-mcp-server 📜 🏠 - A Model Context Protocol server provides access to the Xinghuo BIF Blockchain Test Network
javascriptserverainpm install caict-4iot-dev/xinghuo-mcp-server - wisdom-mcp-gateway 📜 🏠 - A stdio gateway for the Enterpret's Wisdom MCP SSE Server
javascriptmcpservernpm install Hrily/wisdom-mcp-gateway - workflows-mcp-server 📜 🏠 - A server that provides an integration through both direct REST endpoints and Model Context Protocol (MCP) integration to a workflow engine.
javascriptmcpserverrestnpm install popand/workflows-mcp-server - YantaoMou/mcpdroid 🏠 - Facilitates direct control and operation of Android devices by large language models through a standardized interface.
httpgitgithub - zemcp 📜 🏠 - a collection of zero effort MCP servers
javascriptmcpservernpm install aziouiz/zemcp - peteknowsai_remote-mcp-server 📘 🏠 - Mirror of https://github.com/peteknowsai/remote-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/peteknowsai_remote-mcp-server - pgyer-mcp-server 📜 🏠 - PGYER 平台的 MCP Server,支持上传、查询 App 等
javascriptappmcp-serverpgyermcpnpm install PGYER/pgyer-mcp-server - php-universal-mcp-server 📜 🏠 - Um servidor MCP universal para desenvolvimento PHP em qualquer provedor de hospedagem ou nuvem
javascriptmcpnpm install Lucasdoreac/php-universal-mcp-server - RaidShadowLegendsButItsMCP 📘 🏠 - MCP server for Raid Shadow Legneds, Obviously
typescriptmcpserverainpm install MadnessEngineering/RaidShadowLegendsButItsMCP - remote-mcp-creation-foundation 📘 🏠 - This is a foundational code base to understand how to create remote mcp servers in cloudflare using the SPARC framework
typescriptmcpservernpm install mondweep/remote-mcp-creation-foundation - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install growtha/remote-mcp-server - sanity-io_sanity-mcp-server 📘 🏠 - Mirror of https://github.com/sanity-io/sanity-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/sanity-io_sanity-mcp-server - simeji-stampmcp 📘 🏠 - StampMCP-Simeji is a service that Retrieve and return multiple emoticon/sticker images based on text meaning.Creates 1-20 varied images related to the input text.Images are automatically saved to a local folder and the folder opens automatically for easy access.
typescriptmcpnpm install simeji-mcp/simeji-stampmcp - rlymbur_amazon-vpc-lattice-mcp-server 📘 🏠 - Mirror of https://github.com/rlymbur/amazon-vpc-lattice-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/rlymbur_amazon-vpc-lattice-mcp-server - simple-mcp-server 📜 🏠 - Get started with building your first MCP server
javascriptmcpservernpm install muk-shobhit/simple-mcp-server - Simple-Timer-MCP-Server 📘 🏠 - An MCP (Model Context Protocol) Server that provides interval timing functionality using token-based time tracking.
typescriptmcpservernpm install tonyOgbonna/Simple-Timer-MCP-Server - php-hostinger-mcp-server 📜 🏠 - Servidor MCP especializado para desenvolvimento PHP em hospedagem compartilhada com foco em sites e lojas online
javascriptmcpnpm install Lucasdoreac/php-hostinger-mcp-server - plausible-mcp-server 📘 🏠 📇 - A MCP Server for the Plausible API
typescriptmcpserverapinpm install AVIMBU/plausible-mcp-server - playcanvas_editor-mcp-server 📘 🏠 - Mirror of https://github.com/playcanvas/editor-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/playcanvas_editor-mcp-server - poke_api_mcp_rb 💎 🏠 - This project is an MCP server built with mcp_rb for retrieving Pokémon information.
rubymcpservergit clone https://github.com/katakyo/poke_api_mcp_rb - prathammanocha_wordpress-mcp-server 📜 🏠 - Mirror of https://github.com/prathammanocha/wordpress-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/prathammanocha_wordpress-mcp-server - peterparker57_github-mcp-server 📘 🏠 - Mirror of https://github.com/peterparker57/github-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/peterparker57_github-mcp-server - peterparker57_project-hub-mcp-server 📜 🏠 - Mirror of https://github.com/peterparker57/project-hub-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/peterparker57_project-hub-mcp-server - pgpt-dev_MCP-Server-for-MAS-Developments 📜 🏠 - Mirror of https://github.com/pgpt-dev/MCP-Server-for-MAS-Developments
javascriptmcpserverhttpnpm install MCP-Mirror/pgpt-dev_MCP-Server-for-MAS-Developments - polkassembly-api-mcp 📘 🏠 📇 - MCP Server for Polkassembly API
typescriptmcpserverapinpm install interweb-it/polkassembly-api-mcp - postgres-mcp-server 📜 🏠 - MCP server for interacting with a PostgreSQL products database.
javascriptmcpserverdatabasepostgresnpm install michael7736/postgres-mcp-server - ptkmcp 📜 🏠 - mcp server for ptk (Node.js-based)
javascriptmcpservernpm install accelon/ptkmcp - python-mcp-server 🐹 🏠 📇 - Go-based
apiwebhttpaillmgo install giannisalinetti/python-mcp-server@latest - prem-mcp-server 📜 🏠 - Implementation of an MCP Server to use the Prem SDK
javascriptmcpservernpm install ucalyptus/prem-mcp-server - psaboia_mcp-server-playground 📜 🏠 - Mirror of https://github.com/psaboia/mcp-server-playground
javascriptmcpserverhttpnpm install MCP-Mirror/psaboia_mcp-server-playground - PV-Bhat_vibe-check-mcp-server 📘 🏠 - Mirror of https://github.com/PV-Bhat/vibe-check-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/PV-Bhat_vibe-check-mcp-server - Quegenx_supabase-mcp-server 📘 🏠 - Mirror of https://github.com/Quegenx/supabase-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/Quegenx_supabase-mcp-server - Quegenx_vercel-mcp-server 📘 🏠 - Mirror of https://github.com/Quegenx/vercel-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/Quegenx_vercel-mcp-server - ragieai_ragie-mcp-server 📜 🏠 - Mirror of https://github.com/ragieai/ragie-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/ragieai_ragie-mcp-server - rajbos_ghas-mcp-server 📘 🏠 - Mirror of https://github.com/rajbos/ghas-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/rajbos_ghas-mcp-server - recall-docs-mcp 📘 🏠 - A Model Context Protocol (MCP) tool that enables the Cursor AI assistant to reference Recall documentation
typescriptmcpaidocumentationnpm install recallnet/recall-docs-mcp - ramidecodes_mcp-server-notion 📘 🏠 - Mirror of https://github.com/ramidecodes/mcp-server-notion
typescriptmcpserverhttpnpm install MCP-Mirror/ramidecodes_mcp-server-notion - RathodDarshil_mcp-postgres-query-server 📘 🏠 - Mirror of https://github.com/RathodDarshil/mcp-postgres-query-server
typescriptmcpserverhttppostgresnpm install MCP-Mirror/RathodDarshil_mcp-postgres-query-server - redmine-mcp 📘 🏠 - An MCP server for Redmine.
typescriptmcpmcp-serverredmineservernpm install shindi-renuo/redmine-mcp - sst-streaming-http-mcp-server 📘 🏠 - An SST monorepo that deploys MCP streaming HTTP servers via Hono on a Lambda. Currently this doesn't include auth.
typescriptmcpserverauthhttpnpm install madisonbullard/sst-streaming-http-mcp-server - Sunwood-ai-labs_command-executor-mcp-server 📜 🏠 - Mirror of https://github.com/Sunwood-ai-labs/command-executor-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/Sunwood-ai-labs_command-executor-mcp-server - mcp-fm-analyzer 📜 🏠 - The UVL Analyzer MCP is a Model Context Protocol (MCP) server designed to analyze feature models written in the Universal Variability Language (UVL). It provides a variety of tools to process and extract insights from feature models, such as identifying atomic sets, calculating average branching factors, and more.
javascriptmcpservernpm install lbdudc/mcp-fm-analyzer - mcp-github 📘 🏠 📇 - This is a GitHub MCP server designed to enable MCP-compatible LLMs, such as Claude, to communicate with my MCP server and interact with the GitHub API.
typescriptmcpserverapillmnpm install ualUsham/mcp-github - mcp-github-server 📘 🏠 📇 - Standalone MCP server for GitHub API
typescriptmcpserverapinpm install s2005/mcp-github-server - mcp-hello-world 📜 🏠 - Simplest remote MCP server implementation
javascriptmcpservernpm install Moe03/mcp-hello-world - mcp-hello-world-typescript 📘 🏠 - MCP Server with node - Example Project
typescriptmcpservernodenpm install ahierro/mcp-hello-world-typescript - mcp-html-sync-server 📘 🏠 - A real-time HTML syncing server with hot reload capabilities, built using the Model Context Protocol (MCP)
typescripthot-reloadhtmlmcpmcp-servernpm install yujiosaka/mcp-html-sync-server - mcp-index 📜 🏠 - CLI tool to index MCP Servers to mcprepository.com
javascriptindexingmcpmcp-servermodel-context-protocolnpm install mcprepository/mcp-index - mcp-investidor10 📘 🏠 📇 - Investidor10 MCP Server: A Model Context Protocol (MCP) server for interacting with the Status Invest API. Provides tools for fetching stock data and indicators, with a layered architecture and data validation using Zod
typescriptmcpserverapinpm install newerton/mcp-investidor10 - mcp-kubectl-server 📘 🏠 - mcp-k8's-server (TypeScript-based)
typescriptmcpservernpm install bikramjitchawla/mcp-kubectl-server - mcp-local-relay 📘 🏠 - Run your MCP Kit servers in local clients like Claude Desktop
typescriptmcpmcp-clientmcp-serverservernpm install trevoruptain/mcp-local-relay - mcp-mhworld 📘 🏠 📇 - An MCP (Model Context Protocol) server that provides tools and resources for accessing Monster Hunter World game data via the MHW DB API.
typescriptmcpmonster-hunter-worldserverapinpm install likweitan/mcp-mhworld - mcp-kagi-search 📜 🏠 📇 - A MCP server implementation for Kagi's API using npx, so it can easily be run in n8n.
javascriptmcpserverapinpm install goranche/mcp-kagi-search - mcp-LanceDB-node 📜 🏠 - LanceDB MCP Server nodejs
javascriptmcpservernodenpm install vurtnec/mcp-LanceDB-node - mcp-local-file-server 📜 🏠 - Servidor para acessar e manipular arquivos locais usando MCP
javascriptmcpainpm install fmorus/mcp-local-file-server - mcp-loco-app 📜 🏠 - MCP server LOCO repository
javascriptmcpservernpm install expando-repo/mcp-loco-app - mcp-network-sentinel 📘 🏠 - A network monitoring tool for MCP servers that logs all network activities to help identify potential security issues.
typescriptmcpservermonitoringnpm install takeaship/mcp-network-sentinel - mcp-news-server 📘 🏠 📇 - mcp server of a realtime news api
typescriptmcpserverapinpm install devjiel/mcp-news-server - MCP-Developer-Name 📜 🏠 - Use this MCP server to tell AI who are you.
javascriptmcpserverainpm install SeriaWei/MCP-Developer-Name - mcp-duckduckresearch 📘 🏠 - mcp server with duckducksearch, web2md, and web2photo
typescriptmcpserverwebnpm install bkataru-workshop/mcp-duckduckresearch - mcp-emacs-buffers 💎 🏠 - An MCP Server exposing open Emacs buffers as Resources
rubymcpservergit clone https://github.com/kfischer-okarin/mcp-emacs-buffers - mcp-experiment 📜 🏠 - a repo to experiment with mcp client and server
javascriptmcpservernpm install CharlieChenyuZhang/mcp-experiment - mcp-node-server 📜 🏠 - A basic Node.js server for MCP
javascriptmcpservernodenpm install blocksan/mcp-node-server - mcp-on-edge 📘 🏠 - MCP Client and Server Implementation with Functions
typescriptmcpservernpm install icyhd/mcp-on-edge - Gitmaxd_dubco-mcp-server 📜 🏠 - Mirror of https://github.com/Gitmaxd/dubco-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/Gitmaxd_dubco-mcp-server - mcp-forge 📜 🏠 - MCP server for generating other MCP servers in Smithery
javascriptmcpservernpm install chromewillow/mcp-forge - mcp-openai-complete 📜 🏠 - MCP server for OpenAI text completion
javascriptmcpserverainpm install aiamblichus/mcp-openai-complete - mcp-openai-server 📜 🏠 - An mcp-openai-server for connecting via Claude or similar
javascriptmcpserverainpm install marchampson/mcp-openai-server - mcp-perplexity-server 📜 🏠 📇 - Model Context Protocol server implementation for Perplexity API
javascriptserverapinpm install lostmind008/mcp-perplexity-server - mcp-piperun 📜 🏠 - Node.js-based
javascriptnpm install dinhogehm/mcp-piperun - mcp-playground 📘 🏠 - MCP Playground for learning MCP Client and Server
typescriptmcpservernpm install leejss/mcp-playground - mcp-plugable-document-server 📘 🏠 - A simple server implementing the Model Context Protocol for document search
typescriptservernpm install Omerisra6/mcp-document-server - mcp-postgres 📘 🏠 - MCP example for postgres
typescriptmcppostgresnpm install a21071/mcp-postgres - relation-mcp-server 📜 🏠 - Node.js-based
javascriptnpm install Procrustes5/relation-mcp-server - Remote-Command-MCP 📜 🏠 - A Model Context Protocol (MCP) server that enables remote command execution across different operating systems.
javascriptmcpservernpm install deepsuthar496/Remote-Command-MCP - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install KaiLongWu/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install mehmet-arikan/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install CyberTwizted/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install Niell007/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install micksabox/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install tomtev/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install seanlin0324/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install imsardine/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install aninibread/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install shixixiyue/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install peanut996/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install Cam10001110101/remote-mcp-server - remote-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install fenoh3ry/remote-mcp-server - rivers-radar-mcp 📘 🏠 - 基于大模型,提供通过 MCP Tools 对长亭百川云-网站安全监测的数据进行查询、分析和操作的功能。
typescriptmcpnpm install co0ontty/rivers-radar-mcp - robertoamoreno_couchdb-mcp-server 📜 🏠 - Mirror of https://github.com/robertoamoreno/couchdb-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/robertoamoreno_couchdb-mcp-server - rocket-countdown-mcp-server 📜 🏠 - A Model Context Protocol (MCP) server that implements a rocket countdown timer. It allows users to start, stop, and reset a countdown, and displays "BLAST OFF!" when the countdown reaches zero.
javascriptmcpservernpm install WesleyMFrederick/rocket-countdown-mcp-server - rubberduck-mcp 📘 🏠 - TypeScript-based
typescriptnpm install Saml1211/rubberduck-mcp - SAhmadUmass_notion-mcp-server 📘 🏠 - Mirror of https://github.com/SAhmadUmass/notion-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/SAhmadUmass_notion-mcp-server - samihalawa_mcp-server-ai-vision 📜 🏠 - Mirror of https://github.com/samihalawa/mcp-server-ai-vision
javascriptmcpserveraihttpnpm install MCP-Mirror/samihalawa_mcp-server-ai-vision - sample-mcp-server 📘 🏠 - Official tutorial create MCP Server using TypeScript SDK
typescriptmcpservernpm install yutonishi/sample-mcp-server - secure-command-executor-mcp-server 📜 🏠 - A robust command execution service with daily log rotation, designed to securely manage and execute system commands with safety checks and logging.
javascriptailoggingnpm install HappyAny/secure-command-executor-mcp-server - server-run-commands 📘 🏠 - MCP server to run commands on the local OS
typescriptmcpservernpm install anton-107/server-run-commands - sharplygroup_xtb-mcp-server 📘 🏠 - Mirror of https://github.com/sharplygroup/xtb-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/sharplygroup_xtb-mcp-server - shopify-mcp-server 📘 🏠 - TypeScript-based
typescriptnpm install wfilleman/shopify-mcp-server - simple-mcp-server 📘 🏠 - A Simple MCP weather Server written in TypeScript
typescriptmcpservernpm install akaiserg/simple-mcp-server - SirTenzin_autumn-mcp-server 📘 🏠 - Mirror of https://github.com/SirTenzin/autumn-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/SirTenzin_autumn-mcp-server - slack-admin-mcp 📜 🏠 - MCP server for Slack channel administration (create, rename, archive)
javascriptmcpservernpm install xiujiang1987/slack-admin-mcp - slack-mcp-server-sse 📜 🏠 - Slack MCP Server with SSE transport
javascriptmcpservernpm install dVelopment/slack-mcp-server-sse - snaggle-ai_openapi-mcp-server 📘 🏠 📇 - Mirror of https://github.com/snaggle-ai/openapi-mcp-server
typescriptmcpserverapiainpm install MCP-Mirror/snaggle-ai_openapi-mcp-server - souls-mcp-srv 📘 🏠 - mcp server index for souls
typescriptmcpservernpm install johnnyclem/souls-mcp-srv - spheron-mcp-plugin 📘 🏠 - MCP plugin for Spheron Protocol integration with MCP clients like Claude Desktop,Cursor,Windsurf etc
typescriptmcpnpm install saurrx/spheron-mcp-plugin - SpringMT_microcms-mcp-server 📘 🏠 - Mirror of https://github.com/SpringMT/microcms-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/SpringMT_microcms-mcp-server - sprite-codia-mcp 📘 🏠 - SpriteCodia is a tool that leverages the Model Context Protocol (MCP) TypeScript SDK to efficiently crawl and extract sprites from Codia within Figma, simplifying asset retrieval for developers and designers.
typescriptmcpnpm install duyquangnvx/sprite-codia-mcp - steam-mcp 📜 🏠 📇 - MCP Server for Steam Web API Game Statistics
javascriptmcpserverapiwebnpm install algorhythmic/steam-mcp - strava-mcp 📜 🏠 📇 - A Model Context Protocol (MCP) server implementation for Strava API
javascriptmcpserverapinpm install rmarescu/strava-mcp - StuMason_coolify-mcp-server 📜 🏠 - Mirror of https://github.com/StuMason/coolify-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/StuMason_coolify-mcp-server - stun-mcp 📘 🏠 - STUN(RFC8489)のBinding Requestを送って結果を返すMCPサーバー
typescriptmcpmcp-serverstunnpm install kadoshita/stun-mcp - suhail-ak-s_mcp-typesense-server 📘 🏠 - Mirror of https://github.com/suhail-ak-s/mcp-typesense-server
typescriptmcpserveraihttpnpm install MCP-Mirror/suhail-ak-s_mcp-typesense-server - Sunwood-ai-labs_documind-mcp-server 📘 🏠 - Mirror of https://github.com/Sunwood-ai-labs/documind-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/Sunwood-ai-labs_documind-mcp-server - Sunwood-ai-labs_release-notes-generator-iris-mcp-server 📜 🏠 - Mirror of https://github.com/Sunwood-ai-labs/release-notes-generator-iris-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/Sunwood-ai-labs_release-notes-generator-iris-mcp-server - supavec_mcp-server 📘 🏠 - Mirror of https://github.com/supavec/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/supavec_mcp-server - try-mcp-2025 📜 🏠 - Node.js-based
javascriptnpm install ginpei/try-mcp-2025 - ts-def-mcp 📜 🏠 - A Model Context Protocol (MCP) server that helps AI code editors find TypeScript symbol definitions in your codebase.
javascriptmcpserverainpm install runninghare/ts-def-mcp - typescript-mcp-server-usage 📘 🏠 - Source code for creating mcp server using typescript sdk.
typescriptmcpservernpm install americano212/typescript-mcp-server-usage - uday210_salesforce-mcp-server 📘 🏠 - Mirror of https://github.com/uday210/salesforce-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/uday210_salesforce-mcp-server - VapiAI_mcp-server 📘 🏠 📇 - Mirror of https://github.com/VapiAI/mcp-server
typescriptmcpserverapiainpm install MCP-Mirror/VapiAI_mcp-server - vercel-ai-chat-mcp 📘 🏠 - Add mcp servers to vercel's open source ai chat
typescriptmcpserverainpm install andrewhuang427/vercel-ai-chat-mcp - zentala_zntl-mcp-server 📘 🏠 - Mirror of https://github.com/zentala/zntl-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/zentala_zntl-mcp-server - zerosync-co_mcp-server-autoprovisioner 📘 🏠 - Mirror of https://github.com/zerosync-co/mcp-server-autoprovisioner
typescriptmcpserverhttpnpm install MCP-Mirror/zerosync-co_mcp-server-autoprovisioner - vercel-ai-sdk-mcp-project 📘 🏠 - MCP Server for Vercel AI SDK with Figma and magic-mcp integration
typescriptmcpserverainpm install chiziuwaga/vercel-ai-sdk-mcp-project - voxbuilder-mcp-local 📜 🏠 - (Demo) MCP Server to create and draw .vox models file locally
javascriptmcpservernpm install tobylai-toby/voxbuilder-mcp-local - valyu-mcp-js 📘 🏠 📇 - Typescript implementation of MCP server for Valyu Network API (https://docs.valyu.network/api-reference)
typescriptmcpserverapihttpnpm install valyu-network/valyu-mcp-js - waha-api-mcp-server 📜 🏠 📇 - Allow AI to wade through complex OpenAPIs using Simple Language
javascriptapiainpm install gabfr/waha-api-mcp-server - YiyangLi_sms-mcp-server 📜 🏠 - Mirror of https://github.com/YiyangLi/sms-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/YiyangLi_sms-mcp-server - youtube-server-mcp 📜 🏠 - MCP server for youtube! Allows you to directly search and access transcripts on youtube through a single call in the Claude LLM
javascriptmcpserverllmnpm install dongjunhahm/youtube-server-mcp - zbkm_mmnt-mcp-server 📘 🏠 - Mirror of https://github.com/zbkm/mmnt-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/zbkm_mmnt-mcp-server - ZephyrDeng_mcp-server-gitlab 📘 🏠 - Mirror of https://github.com/ZephyrDeng/mcp-server-gitlab
typescriptmcpserverhttpnpm install MCP-Mirror/ZephyrDeng_mcp-server-gitlab - zerodha-mcpserver 📜 🏠 📇 - This is a Cloudflare Worker that serves as an MCP (Model Context Protocol) server for interacting with the Zerodha Kite Connect API.
javascriptclaudemcpstock-marketzerodhanpm install manucr619/zerodha-mcpserver - personal-mcp-server 📘 🏠 - A comprehensive TypeScript implementation of the Model Context Protocol (MCP) server with tools, resources, and prompts for LLM integration. Provides a robust foundation for building AI-powered applications with CLI support.
typescriptmcpserveraillmnpm install jango-blockchained/personal-mcp-server - zhaoxin34_mcp-server-mysql 📘 🏠 - Mirror of https://github.com/zhaoxin34/mcp-server-mysql
typescriptmcpserverhttpmysqlnpm install MCP-Mirror/zhaoxin34_mcp-server-mysql - youtube-mcp-server 📜 🏠 - A Media Control Protocol server for YouTube integration
javascriptservernpm install Tisik79/youtube-mcp-server - Zonos-TTS-MCP-Linux 📘 🏠 - Zonos MCP server modified for Linux and GPU optimizations.
typescriptclaudemcp-serverttsmcpnpm install angrysky56/Zonos-TTS-MCP-Linux - Alesion30_my-mcp-server 📘 🏠 - Mirror of https://github.com/Alesion30/my-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/Alesion30_my-mcp-server - aliargun_mcp-server-gemini 📘 🏠 - Mirror of https://github.com/aliargun/mcp-server-gemini
typescriptmcpserverhttpnpm install MCP-Mirror/aliargun_mcp-server-gemini - AllAboutAI-YT_mcp-servers 📜 🏠 - Mirror of https://github.com/AllAboutAI-YT/mcp-servers
javascriptmcpserveraihttpnpm install MCP-Mirror/AllAboutAI-YT_mcp-servers - amidabuddha_unichat-ts-mcp-server 📘 🏠 - Mirror of https://github.com/amidabuddha/unichat-ts-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/amidabuddha_unichat-ts-mcp-server - apify_mcp-server-rag-web-browser 📜 🏠 📇 - Mirror of https://github.com/apify/mcp-server-rag-web-browser
javascriptmcpserverapiwebnpm install MCP-Mirror/apify_mcp-server-rag-web-browser - apinetwork_piapi-mcp-server 📘 🏠 📇 - Mirror of https://github.com/apinetwork/piapi-mcp-server
typescriptmcpserverapihttpnpm install MCP-Mirror/apinetwork_piapi-mcp-server - benborla_mcp-server-mysql 📜 🏠 - Mirror of https://github.com/benborla/mcp-server-mysql
javascriptmcpserverhttpmysqlnpm install MCP-Mirror/benborla_mcp-server-mysql - Bigsy_Clojars-MCP-Server 📜 🏠 - Mirror of https://github.com/Bigsy/Clojars-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/Bigsy_Clojars-MCP-Server - bmorphism_anti-bullshit-mcp-server 📜 🏠 - Mirror of https://github.com/bmorphism/anti-bullshit-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bmorphism_anti-bullshit-mcp-server - bmorphism_babashka-mcp-server 📜 🏠 - Mirror of https://github.com/bmorphism/babashka-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bmorphism_babashka-mcp-server - bmorphism_marginalia-mcp-server 📜 🏠 - Mirror of https://github.com/bmorphism/marginalia-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bmorphism_marginalia-mcp-server - bmorphism_say-mcp-server 📜 🏠 - Mirror of https://github.com/bmorphism/say-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/bmorphism_say-mcp-server - bmorphism_slowtime-mcp-server 📘 🏠 - Mirror of https://github.com/bmorphism/slowtime-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/bmorphism_slowtime-mcp-server - boilingdata_mcp-server-and-gw 📘 🏠 - Mirror of https://github.com/boilingdata/mcp-server-and-gw
typescriptmcpserverhttpnpm install MCP-Mirror/boilingdata_mcp-server-and-gw - bsmi021_mcp-filesystem-server 📘 🏠 - Mirror of https://github.com/bsmi021/mcp-filesystem-server
typescriptmcpserverhttpnpm install MCP-Mirror/bsmi021_mcp-filesystem-server - bsmi021_mcp-server-webscan 📜 🏠 - Mirror of https://github.com/bsmi021/mcp-server-webscan
javascriptmcpserverwebhttpnpm install MCP-Mirror/bsmi021_mcp-server-webscan - btwiuse_npm-search-mcp-server 📜 🏠 - Mirror of https://github.com/btwiuse/npm-search-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/btwiuse_npm-search-mcp-server - clever-doc-mcp-server 📘 🏠 - This MCP demo Server based on FastMCP, exposes Clever Cloud's Documentation
typescriptmcpserverdocumentationnpm install LostInBrittany/clever-doc-mcp-server - da-okazaki_mcp-neo4j-server 📘 🏠 - Mirror of https://github.com/da-okazaki/mcp-neo4j-server
typescriptmcpserverhttpnpm install MCP-Mirror/da-okazaki_mcp-neo4j-server - danielma-tic_fillout-mcp-server 📘 🏠 - Mirror of https://github.com/danielma-tic/fillout-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/danielma-tic_fillout-mcp-server - delorenj_mcp-server-trello 📘 🏠 - Mirror of https://github.com/delorenj/mcp-server-trello
typescriptmcpserverhttpnpm install MCP-Mirror/delorenj_mcp-server-trello - delorenj_super-win-cli-mcp-server 📘 🏠 - Mirror of https://github.com/delorenj/super-win-cli-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/delorenj_super-win-cli-mcp-server - DennisTraub_minecraft-mcp-server 📘 🏠 - Mirror of https://github.com/DennisTraub/minecraft-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/DennisTraub_minecraft-mcp-server - deus-h_claudeus-wp-mcp 📘 🏠 - Mirror of https://github.com/deus-h/claudeus-wp-mcp
typescriptmcphttpnpm install MCP-Mirror/deus-h_claudeus-wp-mcp - dion-hagan_mcp-server-spinnaker 📘 🏠 - Mirror of https://github.com/dion-hagan/mcp-server-spinnaker
typescriptmcpserverhttpnpm install MCP-Mirror/dion-hagan_mcp-server-spinnaker - divslingerx_mcp-server 📜 🏠 - Mirror of https://github.com/divslingerx/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/divslingerx_mcp-server - DMontgomery40_deepseek-mcp-server 📜 🏠 - Mirror of https://github.com/DMontgomery40/deepseek-mcp-server
javascriptmcpserverhttpgonpm install MCP-Mirror/DMontgomery40_deepseek-mcp-server - doomdagadiggiedahdah_iacr-mcp-server 📜 🏠 - Mirror of https://github.com/doomdagadiggiedahdah/iacr-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/doomdagadiggiedahdah_iacr-mcp-server - drupal-modules-mcp 📜 🏠 - Model Context Protocol (MCP) servers for Drupal development. Includes tools for querying Drupal.org module. Seamlessly integrates with Cline and other MCP-compatible clients to enhance Drupal development workflows.
javascriptmcpservermlnpm install Cleversoft-IT/drupal-modules-mcp - drupal-tools-mcp 📜 🏠 - Model Context Protocol (MCP) servers for Drupal development. Includes tools for querying Drupal.org modules and interacting with Drush commands. Seamlessly integrates with Cline and other MCP-compatible clients to enhance Drupal development workflows.
javascriptmcpservermlnpm install Cleversoft-IT/drupal-tools-mcp - enemyrr_mcp-server-pagespeed 📜 🏠 - Mirror of https://github.com/enemyrr/mcp-server-pagespeed
javascriptmcpserverhttpnpm install MCP-Mirror/enemyrr_mcp-server-pagespeed - MCP-pptr 📜 🏠 - A pptr mcp server for better cursor
javascriptmcpservernpm install RingoTC/MCP-pptr - arre-ankit_notion-mcp-server 📜 🏠 - Mirror of https://github.com/arre-ankit/notion-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/arre-ankit_notion-mcp-server - chatmcp_mcp-server-chatsum 📘 🏠 - Mirror of https://github.com/chatmcp/mcp-server-chatsum
typescriptmcpserverhttpnpm install MCP-Mirror/chatmcp_mcp-server-chatsum - cloudflare_mcp-server-cloudflare 📘 🏠 - Mirror of https://github.com/cloudflare/mcp-server-cloudflare
typescriptmcpserverhttpnpm install MCP-Mirror/cloudflare_mcp-server-cloudflare - CloudSecurityAlliance_csa-mcp-servers 📜 🏠 - Mirror of https://github.com/CloudSecurityAlliance/csa-mcp-servers
javascriptmcpserverhttpnpm install MCP-Mirror/CloudSecurityAlliance_csa-mcp-servers - DMontgomery40_meta-mcp-server 📜 🏠 - Mirror of https://github.com/DMontgomery40/meta-mcp-server
javascriptmcpserverhttpgonpm install MCP-Mirror/DMontgomery40_meta-mcp-server - DynamicEndpoints_huntress-mcp-server 📜 🏠 - Mirror of https://github.com/DynamicEndpoints/huntress-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/DynamicEndpoints_huntress-mcp-server - e2b-dev_mcp-server 📜 🏠 - Mirror of https://github.com/e2b-dev/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/e2b-dev_mcp-server - eliasuran_mcp_server_google_calendar 📘 🏠 - Mirror of https://github.com/eliasuran/mcp_server_google_calendar
typescriptmcpserverhttpgonpm install MCP-Mirror/eliasuran_mcp_server_google_calendar - fireproof-storage_mcp-database-server 📜 🏠 - Mirror of https://github.com/fireproof-storage/mcp-database-server
javascriptmcpserverdatabasehttpnpm install MCP-Mirror/fireproof-storage_mcp-database-server - Flux159_mcp-server-kubernetes 📜 🏠 - Mirror of https://github.com/Flux159/mcp-server-kubernetes
javascriptmcpserverhttpkubernetesnpm install MCP-Mirror/Flux159_mcp-server-kubernetes - fumieval_mcp-server-diceroll 📜 🏠 - Mirror of https://github.com/fumieval/mcp-server-diceroll
javascriptmcpserverhttpnpm install MCP-Mirror/fumieval_mcp-server-diceroll - geelen_workers-mcp-server 📘 🏠 - Mirror of https://github.com/geelen/workers-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/geelen_workers-mcp-server - gentoro-gh_mcp-nodejs-server 📘 🏠 - Mirror of https://github.com/gentoro-gh/mcp-nodejs-server
typescriptmcpserverhttpnodenpm install MCP-Mirror/gentoro-gh_mcp-nodejs-server - gentoro-GT_mcp-nodejs-server 📘 🏠 - Mirror of https://github.com/gentoro-GT/mcp-nodejs-server
typescriptmcpserverhttpnodenpm install MCP-Mirror/gentoro-GT_mcp-nodejs-server - George5562_Jira-MCP-Server 📜 🏠 - Mirror of https://github.com/George5562/Jira-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/George5562_Jira-MCP-Server - github-mcp-server 📘 🏠 - GitHub MCP server with enhanced file management capabilities
typescriptmcpservernpm install peterparker57/github-mcp-server - github-meta-mcp-server 📜 🏠 - An MCP server that enables natural language commands for managing GitHub repositories
javascriptautomationgithub-apimcpnatural-languagenpm install PoliTwit1984/github-meta-mcp-server - mcp-90-mre 📜 🏠 - 🐛 Minimal repro of a bug with Claude Desktop's MCP integration
javascriptmcpnpm install domdomegg/mcp-90-mre - mahawi1992_mcp-documentation-server 📘 🏠 - Mirror of https://github.com/mahawi1992/mcp-documentation-server
typescriptmcpserverhttpdocumentationnpm install MCP-Mirror/mahawi1992_mcp-documentation-server - mcp-eagle 📘 🏠 - MCP server for Eagle app
typescriptmcpservernpm install olegshilin/mcp-eagle - mcp-github-server 📜 🏠 📇 - GitHub APIを使用したModel Context Protocolサーバーの実装
javascriptapinpm install emrum01/mcp-github-server - mcp-json-db-collection-server 📜 🏠 - Use Model Context Protocol with multiple Fireproof JSON document databases
javascriptdatabasejsonnpm install jimpick/mcp-json-db-collection-server - mcp-morpho-server 📜 🏠 - A morpho server for the model context protocol
javascriptservernpm install crazyrabbitLTC/mcp-morpho-server - mcp-server-make-dot-com 📘 🏠 📇 - An MCP server implementation that integrates parts of the Make.com API
typescriptmcpserverapinpm install elitau/mcp-server-make-dot-com - mcppod 📘 🏠 - MCP Pod encapsulates the logic for setting up everything required for a MCP server and running it.
typescriptmcpservernpm install harmonyjs/mcppod - mondweep_youtube-music-mcp-server 📜 🏠 - Mirror of https://github.com/mondweep/youtube-music-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/mondweep_youtube-music-mcp-server - nahmanmate_postgresql-mcp-server 📘 🏠 - Mirror of https://github.com/nahmanmate/postgresql-mcp-server
typescriptmcpserverhttppostgresnpm install MCP-Mirror/nahmanmate_postgresql-mcp-server - openSVM_zig-mcp-server 📜 🏠 - Mirror of https://github.com/openSVM/zig-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/openSVM_zig-mcp-server - perspective-mcp-server 📜 🏠 📇 - A Model Context Protocol (MCP) server that provides tools for interacting with Perspective API
javascriptmcpserverapinpm install mtane0412/perspective-mcp-server - r-huijts_portkey-admin-mcp-server 📘 🏠 - Mirror of https://github.com/r-huijts/portkey-admin-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/r-huijts_portkey-admin-mcp-server - samcfinan_linear-mcp-server 📘 🏠 - Mirror of https://github.com/samcfinan/linear-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/samcfinan_linear-mcp-server - mcp-local-command-server 📜 🏠 - A TypeScript-based MCP server that executes commands and returns structured outputs.
javascriptmcpservernpm install kentaro/mcp-local-command-server - mcp-perplexity-server 📜 🏠 - Perplexity MCP Server for Cline
javascriptmcpservernpm install zenturacp/perplexity-server - mikegehard_isolated-commands-mcp-server 📘 🏠 - Mirror of https://github.com/mikegehard/isolated-commands-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/mikegehard_isolated-commands-mcp-server - MindscapeHQ_mcp-server-raygun 📘 🏠 - Mirror of https://github.com/MindscapeHQ/mcp-server-raygun
typescriptmcpserverhttpnpm install MCP-Mirror/MindscapeHQ_mcp-server-raygun - mongodb-developer_mongodb-mcp-server 📜 🏠 - Mirror of https://github.com/mongodb-developer/mongodb-mcp-server
javascriptmcpserverhttpmongodbnpm install MCP-Mirror/mongodb-developer_mongodb-mcp-server - morinokami_mcp-server-bluesky 📘 🏠 - Mirror of https://github.com/morinokami/mcp-server-bluesky
typescriptmcpserverhttpnpm install MCP-Mirror/morinokami_mcp-server-bluesky - mzxrai_mcp-openai 📜 🏠 - Mirror of https://github.com/mzxrai/mcp-openai
javascriptmcpaihttpnpm install MCP-Mirror/mzxrai_mcp-openai - nicholasq_mcp-server-libsql 📘 🏠 - Mirror of https://github.com/nicholasq/mcp-server-libsql
typescriptmcpserverhttpnpm install MCP-Mirror/nicholasq_mcp-server-libsql - roychri_mcp-server-asana 📘 🏠 - Mirror of https://github.com/roychri/mcp-server-asana
typescriptmcpserverhttpnpm install MCP-Mirror/roychri_mcp-server-asana - ruchernchong_mcp-server-google-analytics 📘 🏠 - Mirror of https://github.com/ruchernchong/mcp-server-google-analytics
typescriptmcpserverhttpgonpm install MCP-Mirror/ruchernchong_mcp-server-google-analytics - run-llama_mcp-server-llamacloud 📜 🏠 - Mirror of https://github.com/run-llama/mcp-server-llamacloud
javascriptmcpserverhttpnpm install MCP-Mirror/run-llama_mcp-server-llamacloud - scorzeth_anki-mcp-server 📜 🏠 - Mirror of https://github.com/scorzeth/anki-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/scorzeth_anki-mcp-server - sergehuber_inoyu-mcp-unomi-server 📜 🏠 - Mirror of https://github.com/sergehuber/inoyu-mcp-unomi-server
javascriptmcpserverhttpnpm install MCP-Mirror/sergehuber_inoyu-mcp-unomi-server - sethbang_mcp-screenshot-server 📜 🏠 - Mirror of https://github.com/sethbang/mcp-screenshot-server
javascriptmcpserverhttpnpm install MCP-Mirror/sethbang_mcp-screenshot-server - shadowpants18_mcpehelper-server 📜 🏠 - Mirror of https://github.com/shadowpants18/mcpehelper-server
javascriptmcpserverhttpnpm install MCP-Mirror/shadowpants18_mcpehelper-server - shaike1_mcp-server-ssh 📘 🏠 - Mirror of https://github.com/shaike1/mcp-server-ssh
typescriptmcpserveraihttpnpm install MCP-Mirror/shaike1_mcp-server-ssh - simple-mcp 📘 🏠 - Simple MCP Server Implementation
typescriptmcpservernpm install devneuratip/simple-mcp - sirmews_mcp-remote-server 📘 🏠 - Mirror of https://github.com/sirmews/mcp-remote-server
typescriptmcpserverhttpnpm install MCP-Mirror/sirmews_mcp-remote-server - stevennevins_architect-mcp-server 📘 🏠 - Mirror of https://github.com/stevennevins/architect-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/stevennevins_architect-mcp-server - stevennevins_mcp-server-template 📘 🏠 - Mirror of https://github.com/stevennevins/mcp-server-template
typescriptmcpserverhttpnpm install MCP-Mirror/stevennevins_mcp-server-template - pocketbase-mcp 📘 🏠 - MCP-compliant PocketBase server implementation
typescriptmcpservernpm install mrbarbosa/pocketbase-mcp - PoliTwit1984_mcp-perplexity-server 📜 🏠 - Mirror of https://github.com/PoliTwit1984/mcp-perplexity-server
javascriptmcpserverhttpnpm install MCP-Mirror/PoliTwit1984_mcp-perplexity-server - PoliTwit1984_second-opinion-mcp-server 📘 🏠 - Mirror of https://github.com/PoliTwit1984/second-opinion-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/PoliTwit1984_second-opinion-mcp-server - pythonpete32_mcp-server-template 📘 🏠 - Mirror of https://github.com/pythonpete32/mcp-server-template
typescriptmcpserverhttppythonnpm install MCP-Mirror/pythonpete32_mcp-server-template - qeinfinity_binance-mcp-server 📘 🏠 - Mirror of https://github.com/qeinfinity/binance-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/qeinfinity_binance-mcp-server - qpd-v_mcp-server-manager 📘 🏠 - Mirror of https://github.com/qpd-v/mcp-server-manager
typescriptmcpserverhttpnpm install MCP-Mirror/qpd-v_mcp-server-manager - r-huijts_ns-mcp-server 📜 🏠 - Mirror of https://github.com/r-huijts/ns-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/r-huijts_ns-mcp-server - ravenwits_mcp-server-arangodb 📘 🏠 - Mirror of https://github.com/ravenwits/mcp-server-arangodb
typescriptmcpserverhttpgonpm install MCP-Mirror/ravenwits_mcp-server-arangodb - rdvo_mcp-server 📜 🏠 - Mirror of https://github.com/rdvo/mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/rdvo_mcp-server - recursechat_mcp-server-apple-shortcuts 📜 🏠 - Mirror of https://github.com/recursechat/mcp-server-apple-shortcuts
javascriptmcpserverhttpnpm install MCP-Mirror/recursechat_mcp-server-apple-shortcuts - rgarcia_mcp-server-server 📘 🏠 - Mirror of https://github.com/rgarcia/mcp-server-server
typescriptmcpserverhttpnpm install MCP-Mirror/rgarcia_mcp-server-server - RichardTheuws_mcp-terminal-server 📘 🏠 - Mirror of https://github.com/RichardTheuws/mcp-terminal-server
typescriptmcpserverhttpnpm install MCP-Mirror/RichardTheuws_mcp-terminal-server - SmallCloudCo_smallcloud-mcp-server 📜 🏠 - Mirror of https://github.com/SmallCloudCo/smallcloud-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/SmallCloudCo_smallcloud-mcp-server - splendasucks_webperfect-mcp-server 📜 🏠 - Mirror of https://github.com/splendasucks/webperfect-mcp-server
javascriptmcpserverwebhttpnpm install MCP-Mirror/splendasucks_webperfect-mcp-server - steel-dev_steel-mcp-server 📜 🏠 - Mirror of https://github.com/steel-dev/steel-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/steel-dev_steel-mcp-server - suekou_mcp-notion-server 📜 🏠 - Mirror of https://github.com/suekou/mcp-notion-server
javascriptmcpserverhttpnpm install MCP-Mirror/suekou_mcp-notion-server - sunsetcoder_flightradar24-mcp-server 📜 🏠 - Mirror of https://github.com/sunsetcoder/flightradar24-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/sunsetcoder_flightradar24-mcp-server - Sunwood-ai-labs_aira-mcp-server 📘 🏠 - Mirror of https://github.com/Sunwood-ai-labs/aira-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/Sunwood-ai-labs_aira-mcp-server - Sunwood-ai-labs_github-kanban-mcp-server 📘 🏠 - Mirror of https://github.com/Sunwood-ai-labs/github-kanban-mcp-server
typescriptmcpserveraihttpnpm install MCP-Mirror/Sunwood-ai-labs_github-kanban-mcp-server - Text2Go_ai-humanizer-mcp-server 📜 🏠 - Mirror of https://github.com/Text2Go/ai-humanizer-mcp-server
javascriptmcpserveraihttpnpm install MCP-Mirror/Text2Go_ai-humanizer-mcp-server - theishangoswami_exa-mcp-server 📜 🏠 - Mirror of https://github.com/theishangoswami/exa-mcp-server
javascriptmcpserverhttpgonpm install MCP-Mirror/theishangoswami_exa-mcp-server - tzolov_mcp-everything-server-docker-image 📘 🏠 - Mirror of https://github.com/tzolov/mcp-everything-server-docker-image
typescriptmcpserverhttpdockernpm install MCP-Mirror/tzolov_mcp-everything-server-docker-image - uddeshya-23_mcp-server-JIRA 📘 🏠 - Mirror of https://github.com/uddeshya-23/mcp-server-JIRA
typescriptmcpserverhttpnpm install MCP-Mirror/uddeshya-23_mcp-server-JIRA - upstash_mcp-server 📘 🏠 - Mirror of https://github.com/upstash/mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/upstash_mcp-server - upstash_mcp-server-upstash 📘 🏠 - Mirror of https://github.com/upstash/mcp-server-upstash
typescriptmcpserverhttpnpm install MCP-Mirror/upstash_mcp-server-upstash - Vic563_Memgpt-MCP-Server 📜 🏠 - Mirror of https://github.com/Vic563/Memgpt-MCP-Server
javascriptmcpserverhttpnpm install MCP-Mirror/Vic563_Memgpt-MCP-Server - vrknetha_mcp-server-firecrawl 📜 🏠 - Mirror of https://github.com/vrknetha/mcp-server-firecrawl
javascriptmcpserverhttpnpm install MCP-Mirror/vrknetha_mcp-server-firecrawl - yonaka15_mcp-server-redmine 📘 🏠 - Mirror of https://github.com/yonaka15/mcp-server-redmine
typescriptmcpserverhttpnpm install MCP-Mirror/yonaka15_mcp-server-redmine - yosider_cosense-mcp-server 📘 🏠 - Mirror of https://github.com/yosider/cosense-mcp-server
typescriptmcpserverhttpnpm install MCP-Mirror/yosider_cosense-mcp-server - yusukebe_my-first-mcp-server 📜 🏠 - Mirror of https://github.com/yusukebe/my-first-mcp-server
javascriptmcpserverhttpnpm install MCP-Mirror/yusukebe_my-first-mcp-server - Zhipu Web Search - Zhipu Web Search MCP Server is a search engine specifically designed for large models. It integrates four search engines, allowing users to flexibly compare and switch between them.
searchwebai - ZubeidHendricks_azure-onenote-mcp-server 📘 🏠 - Mirror of https://github.com/ZubeidHendricks/azure-onenote-mcp-server
typescriptmcpserverhttpazurenpm install MCP-Mirror/ZubeidHendricks_azure-onenote-mcp-server - zxkane_mcp-server-amazon-bedrock 📜 🏠 - Mirror of https://github.com/zxkane/mcp-server-amazon-bedrock
javascriptmcpserverhttpnpm install MCP-Mirror/zxkane_mcp-server-amazon-bedrock
🗄️ Database
- excel-mcp-server 🐍 🏠 (⭐ 2.2k, 🍴 251, 🐛 28) - A Model Context Protocol server for Excel file manipulation
httpgitgithubpythonaipip install git+https://github.com/haris-musa/excel-mcp-server - mysql_mcp_server 🐍 🏠 (⭐ 835, 🍴 187, 🐛 49) - A Model Context Protocol (MCP) server that enables secure interaction with MySQL databases
databasehttpmysqlgitgithubpip install git+https://github.com/designcomputer/mysql_mcp_server - mcp-neo4j 🐍 🏠 (⭐ 668, 🍴 166, 🐛 28) - Model Context Protocol with Neo4j
pythondatabasemcpmcp-serverneo4jpip install git+https://github.com/neo4j-contrib/mcp-neo4j - mongodb-mcp-server 📘 🏠 (⭐ 605, 🍴 109, 🐛 11) - A Model Context Protocol server to connect to MongoDB databases and MongoDB Atlas Clusters.
typescriptmcpmcp-servermongodbmongodb-atlasnpm install mongodb-labs/atlas-mcp-server - mongodb-mcp-server 📘 🏠 (⭐ 605, 🍴 109, 🐛 11) - A Model Context Protocol server to connect to MongoDB databases and MongoDB Atlas Clusters.
typescriptmcpmcp-servermongodbmongodb-atlasnpm install mongodb-js/mongodb-mcp-server - docker-mcp 🐍 🏠 (⭐ 380, 🍴 52, 🐛 8) - A docker MCP Server (modelcontextprotocol)
httpdockeraimlgitpip install git+https://github.com/QuantGeekDev/docker-mcp - mcp-server 📜 🏠 (⭐ 320, 🍴 52, 🐛 4) - Giving Claude ability to run code with E2B via MCP (Model Context Protocol)
httpaigitgithubjavascriptnpm install e2b-dev/mcp-server - airtable-mcp-server 📘 🏠 (⭐ 282, 🍴 82, 🐛 6) - 🗂️🤖 Airtable Model Context Protocol Server, for allowing AI systems to interact with your Airtable bases
databasehttpaigitgithubnpm install domdomegg/airtable-mcp-server - mcp-mongo-server 📘 🏠 (⭐ 262, 🍴 48, 🐛 2) - A Model Context Protocol Server for MongoDB
httpmongodbgitgithubtypescriptnpm install kiliczsh/mcp-mongo-server - mcp-redis 🐍 🏠 (⭐ 230, 🍴 58, 🐛 9) - The official Redis MCP Server is a natural language interface designed for agentic applications to manage and search data in Redis efficiently
httpredisgitgithubpythonpip install git+https://github.com/redis/mcp-redis - xiyan_mcp_server 🐍 🏠 (⭐ 203, 🍴 40, 🐛 10) - A Model Context Protocol (MCP) server that enables natural language queries to databases
pythondatabasemcptext-to-sqlserverpip install git+https://github.com/XGenerationLab/xiyan_mcp_server - MCPBench 🐍 🏠 (⭐ 198, 🍴 11, 🐛 6) - The evaluation benchmark on MCP servers
pythonbenchmarkdatabasemcpmcp-serverpip install git+https://github.com/modelscope/MCPBench - mcp-snowflake-server 🐍 🏠 (⭐ 162, 🍴 72, 🐛 8) - Python-based
databasehttpgitgithubpythonpip install git+https://github.com/isaacwasserman/mcp-snowflake-server - mcp-server-duckdb 🐍 🏠 (⭐ 156, 🍴 15, 🐛 3) - A Model Context Protocol (MCP) server implementation for DuckDB, providing database interaction capabilities
databasehttpgitgithubpythonpip install git+https://github.com/ktanaka101/mcp-server-duckdb - mcp-bigquery-server 📜 🏠 (⭐ 120, 🍴 28, 🐛 7) - A Model Context Protocol (MCP) server that provides secure, read-only access to BigQuery datasets. Enables Large Language Models (LLMs) to safely query and analyze data through a standardized interface.
httpaigitgithubjavascriptnpm install ergut/mcp-bigquery-server - mcp-server-bigquery 🐍 🏠 (⭐ 117, 🍴 31, 🐛 4) - A Model Context Protocol server that provides access to BigQuery
databasehttpgitgithubpythonpip install git+https://github.com/LucasHild/mcp-server-bigquery - mcp-dbutils 🐍 🏠 (⭐ 81, 🍴 9, 🐛 8) - 数读 是一件可以让你的大模型安全连接到数据库的MCP工具。| DButils is an all-in-one MCP service that enables your AI to do data analysis by harnessing versatile types of database (sqlite, mysql, postgres, and more) within a unified configuration of multiple connections in a secured way (like SSL and controlled write access).
databasewebhttppostgressqlitepip install git+https://github.com/donghao1393/mcp-dbutils - mem0-mcp 📜 🏠 (⭐ 71, 🍴 7) - ✨ mem0 MCP Server: A memory system using mem0 for AI applications with model context protocl (MCP) integration. Enables long-term memory for AI agents as a drop-in MCP server.
javascriptagentassistantdatabasellmnpm install pinkpixel-dev/mem0-mcp - legion-mcp 🐍 🏠 (⭐ 65, 🍴 15, 🐛 7) - A server that helps people access and query data in databases using the Legion Query Runner with Model Context Protocol (MCP) in Python.
pythondatabaselegion-aimcpmcp-serverpip install git+https://github.com/TheRaLabs/legion-mcp - go-mcp-mysql 🐹 🏠 (⭐ 43, 🍴 9, 🐛 1) - Zero burden, ready-to-use Model Context Protocol (MCP) server for interacting with MySQL and automation. No Node.js or Python environment needed.
gomcpmcp-servermodel-context-protocolmysqlgo install Zhwt/go-mcp-mysql@latest - mcp-server-tidb 🐍 🏠 (⭐ 22, 🍴 5, 🐛 3) - mcp server for tidb (Python-based)
databasehttpgitgithubpythonpip install git+https://github.com/c4pt0r/mcp-server-tidb - ydb-mcp 🐍 🏠 (⭐ 22, 🍴 6, 🐛 4) - Python-based
databasehttpaigitgithubpip install git+https://github.com/ydb-platform/ydb-mcp - mysql-schema-explorer-mcp 🐹 🏠 (⭐ 19) - Go-based
databasehttpmysqlgitgithubgo install shibayu36/mysql-schema-explorer-mcp@latest - mcp-server-couchbase 🐍 🏠 (⭐ 18, 🍴 17, 🐛 4) - MCP Server to interact with data in Couchbase Clusters
httpgitgithubpythoncouchbasepip install git+https://github.com/Couchbase-Ecosystem/mcp-server-couchbase - mongo-mcp 📘 🏠 (⭐ 12, 🍴 5, 🐛 2) - MCP server that provide tools to LLMs such as claude in cursor to interact with MongoDB
typescriptclaudeclaude-desktopcursorcursorainpm install 1rb/mongo-mcp - alibabacloud-adbpg-mcp-server 🐍 🏠 (⭐ 10, 🍴 2) - Python-based
databasehttppostgresaimlpip install git+https://github.com/aliyun/alibabacloud-adbpg-mcp-server - mcp-mysql-server 📜 🏠 ☁️ (⭐ 9, 🍴 2, 🐛 1) - Node.js-based
databaseremotelocalhttpmysqlnpm install Malove86/mcp-mysql-server - cratedb-mcp 🐍 🏠 (⭐ 8, 🍴 2, 🐛 16) - CrateDB MCP Server for natural-language Text-to-SQL and documentation retrieval.
pythonai-sql-assistantcratedbdocumentation-as-codehuman-computer-interfacepip install git+https://github.com/crate/cratedb-mcp - waii-mcp-server 🐍 🏠 (⭐ 7) - waii mcp server (Python-based)
databasehttpaigitgithubpip install git+https://github.com/waii-ai/waii-mcp-server - avarant/typesense-mcp-server 🐍 🏠 (⭐ 6, 🍴 1) - Facilitates seamless integration with Typesense by managing collections, documents, and search operations through MCP.
httpmlgitgithub - mcp-server-docker 🐚 🏠 (⭐ 6, 🍴 2) - MCP server with Docker, Redis, and TimescaleDB
shellmcpserverredisdockergit clone https://github.com/chuckwilliams37/mcp-server-docker - mcp-neo4j-server-sse 🐍 🏠 (⭐ 5, 🍴 2, 🐛 1) - mcp-neo4j-server-sse is an MCP server that uses Server-Sent Events (SSE) or STDIO as the transport protocol.
pythondatabasemcpmcp-serverneo4jpip install git+https://github.com/dsimile/neo4j-server-remote - dm-mcp-server 🐹 🏠 (⭐ 3, 🐛 1) - Go-based
databasehttpgitgithubgogo install wangzhaobo168/dm-mcp-server@latest - mcp-mongo 📘 🏠 (⭐ 3, 🍴 1) - TypeScript-based
databasehttpmongodbllmgitnpm install achrekarom12/mcp-mongo - mcp-server-postgres-multi-schema 📜 🏠 (⭐ 3, 🍴 3, 🐛 3) - A Model Context Protocol server that provides read-only access to PostgreSQL databases with enhanced multi-schema support.
javascriptmcpmcp-servermodel-context-protocolpostgresnpm install HarjjotSinghh/mcp-server-postgres-multi-schema - mcp-cockroachdb 🐍 🏠 (⭐ 2, 🍴 3, 🐛 1) - The CockroachDB MCP Server is a natural language interface designed for agentic applications to manage, monitor and query data in CockroachDB.
pythoncockroachdbdatabasegenerative-aillmpip install git+https://github.com/amineelkouhen/mcp-cockroachdb - monkdb-mcp 🐍 🏠 (⭐ 2, 🐛 2) - An MCP server 🚀 for MonkDB, licensed under Apache 2.0 📜
pythonai-agentsai-gatewaydatabasellmpip install git+https://github.com/manohar9694/monkdb-mcp - mcp-node-mssql 📘 🏠 (⭐ 2, 🍴 2) - MCP Server for SQL Server using node-mssql
databasehttpmlgitgithubnpm install cwilby/mcp-node-mssql - MCPServerForMSSQL 🐚 🏠 (⭐ 2, 🍴 1) - This is a MCP Server for Claude-Code to connect to you Microsoft SQL Server
shellmcpservergit clone https://github.com/shakunvohradeltek/MCPServerForMSSQL - allizwellai/mysql-mcp-server 📜 🏠 (⭐ 1) - Facilitates secure, read-only access to MySQL databases, enabling users to list databases, tables, and execute queries with robust security features.
databasehttpmysqlaigit - mcp-mysql 📜 🏠 (⭐ 1) - MCP Server para conexión MySQL con túnel SSH
databasehttpmysqlgitgithubnpm install Carlosfpc/mcp-mysql - usqlmcp 🐹 🏠 (⭐ 1, 🐛 1) - A universal SQL MCP (Model Context Protocol).
gomcpsqlgo install thesoulless/usqlmcp@latest - NomotoK/doris-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - Facilitates secure, read-only SQL queries and schema exploration on Apache Doris databases for LLM applications.
databasehttpllmgitgithub - mcp_mongodb 🐍 🏠 (⭐ 1) - Python-based
httpmongodbaimlgitpip install git+https://github.com/tkz24589/mcp_mongodb - mcpmongo 📜 🏠 (⭐ 1, 🍴 1) - This project demonstrates the integration of MongoDB with the Model Context Protocol (MCP) to provide AI assistants with database interaction capabilities.
javascriptgenai-chatbotgoogle-gemini-aimcpmcp-clientnpm install the-sukhsingh/mcpmongo - orlando2019/MCO-postgres 📜 🏠 (⭐ 1) - Enables language models to perform read-only operations on PostgreSQL databases by providing schema inspection and query execution capabilities.
databasehttppostgresgitgithub - redshift-mcp-server 🐍 🏠 (⭐ 1, 🍴 3, 🐛 1) - Python-based
databasehttpaigitgithubpip install git+https://github.com/Moonlight-CL/redshift-mcp-server - SQLMCP 🏠 (⭐ 1) - An MCP Server for Microsoft SQL Server
mcpservergit clone https://github.com/aaaaalexander/SQLMCP - -mysql_mcp_server 🐍 🏠 - Python-based
databasehttpmysqlaigitpip install git+https://github.com/Jite-J/-mysql_mcp_server - MongoDB Lens 🏠 - Full featured MCP Server for MongoDB databases.
databasehttpmongodbgitgithub - PostgreSQL 🏠 - PostgreSQL database integration with schema inspection and query capabilities
databasehttppostgresaigit - SQLite 🏠 - SQLite database operations with built-in analysis features
databasehttpsqliteaigit - Microsandbox⭐ 🏠 - Self-hosted platform for secure execution of AI code. Great for Code Interpreter, Data Analysis, Browser Use.
httpaigitgithub - Neon⭐ 🏠 - Neon MCP Server. Allows natural language interactions with Neon for database management.
databasehttpgitgithubpostgres - Qdrant⭐ 🏠 - A Qdrant MCP server for keeping and retrieving memories in the Qdrant vector search engine.
httpgitgithub - adam2211/neon-mcp-loc 🏠 - Facilitates natural language interaction with Neon Postgres databases, enabling seamless database management and migrations through intuitive commands.
databasehttppostgresmlgit - asirulnik/mcp-law-office-db 🏠 - Facilitates efficient management of law office databases, focusing on client records, case filing, time tracking, and invoice management.
databasehttpgitgithub - aws-ow-pgvector-mcp 🏠 - AWS Aurora Postgres with Pgvector Extension MCP Server.
mcpserverpostgresawsgit clone https://github.com/OpenWorkspace-o1/aws-ow-pgvector-mcp - BioMed-MCP-Server 🏠 - A MCP Server for biomedical Literature Database
mcpserverdatabasegit clone https://github.com/JackKuo666/BioMed-MCP-Server - bram2w/baserow 🏠 - Baserow database integration with table search, list, and row create, read, update, and delete capabilities.
databasehttpgitgithub - db-mcp 🐍 🏠 - Custom made MCP Server for Popular databases (Currently Supporting MYSQL)
pythonfastmcpmcpmcp-servermysqlpip install git+https://github.com/tirthraj07/db-mcp - ChemBL-MCP 🐍 🏠 - Python-based
httpaigitgithubpythonpip install git+https://github.com/BioContext/ChemBL-MCP - cosmosdb-mcp-server 🏠 - Model Context Protocol server implementation for CosmosDB
plpgsqlservergit clone https://github.com/danielmeppiel/cosmosdb-mcp-server - davewind/mysql-mcp-server 🏎️ 🏠 A – user-friendly read-only mysql mcp server for cursor and n8n... 🏠
httpmysqlgitgithub - ferrants/memvid-mcp-server 🐍 🏠 🏠 - Python Streamable HTTP Server you can run locally to interact with memvid storage and semantic search.
localhttpgitgithub - get-convex/convex-backend 📇 ☁️ - Convex database integration to introspect tables, functions, and run oneoff queries (Source)
databasehttpaigitgithub - henilcalagiya/google-sheets-mcp 🐍 🏠 🏠 - Your AI Assistant's Gateway to Google Sheets! 25 powerful tools for seamless Google Sheets automation via MCP.
httpaimlgitgithub - hydrolix/mcp-hydrolix 🎖️ 🐍 ☁️ 🏠 - Hydrolix time-series datalake integration providing schema exploration and query capabilities to LLM-based workflows.
httpllmgitgithub - InfluxData/influxdb3mcpserver 🎖️ 📇 🏠 ☁️ 🏠 - Official MCP server for InfluxDB 3 Core/Enterprise/Cloud Dedicated
httpgitgithub - joshuarileydev/supabase-mcp-server 🏠 - Supabase MCP Server for managing and creating projects and organisations in Supabase
httpgitgithub - jparkerweb/mcp-sqlite 📇 🏠 🏠 - Model Context Protocol (MCP) server that provides comprehensive SQLite database interaction capabilities.
databasewebhttpsqlitegit - jt-atan/Access-COM 🏠 - Facilitates seamless interaction with 32-bit Microsoft Access databases through a Model Context Protocol tool, supporting SQL queries and linked table management.
databasehttpmlgitgithub - MCP_Java_PSQL ☕ 🏠 - MCP for Cursor to connect local PSQL
databasehttppostgresaigitgit clone https://github.com/RichardHFYU/MCP_Java_PSQL - mcp-mysql 🐹 🏠 - MCP server that acts as a MySQL Client implemented in Go language
databasehttpmysqlmlgitgo install cnosuke/mcp-mysql@latest - MCP-MySQL-server-implementation 📘 🏠 - TypeScript-based
databasehttpmysqlllmgitnpm install shensiqi0701/MCP-MySQL-server-implementation - mcp-mysql 🐳 🏠 - MySQL MCP (Model, Controller, Presenter) server implementation using Docker
dockerfilemcpservermysqldockergit clone https://github.com/RyosukeTanaka/mcp-mysql - mcp-mysql-py 🏠 - Quick little template for a local MCP MySQL server.
mcpservermysqlgit clone https://github.com/Martyr2/mcp-mysql-py - MyArxivDB_MCP 🏠 - (bkms1 term project) MCP server for crawling paper from arxiv & manipulating PostgresDB
jupyter notebookmcpserverpostgresgit clone https://github.com/Jongbin-kr/MyArxivDB_MCP - unread-mcp 🐚 🏠 - MCP server for searching Unread RSS reader database
shellmcpserverdatabasegit clone https://github.com/trieloff/unread-mcp - MCP-Server-with-Claude-Ai 🐍 🏠 - Python-based
databasehttpmysqlaigitpip install git+https://github.com/affannahmed/MCP-Server-with-Claude-Ai - vast-db-mcp 🐍 🏠 - An MCP server for agentic integration with the VAST Database and Catalog.
pythondatabasemcp-servervast-datamcppip install git+https://github.com/elementalcollision/vast-db-mcp - mcp-snowflake-reader-ts 📘 🏠 - TypeScript-based
databasehttpgitgithubtypescriptnpm install fnf-deepHeading/mcp-snowflake-reader-ts - mysql-mcp-server 📘 🏠 - TypeScript-based
databasehttpmysqlgitgithubnpm install tqvthu-works/mysql-mcp-server - mysql-mcp-server-modification 📜 🏠 - Node.js-based
databasehttpmysqlgitgithubnpm install shensiqi0701/mysql-mcp-server-modification - neo4j-mcp 🐍 🏠 - Python-based
databasehttpgitgithubpythonpip install git+https://github.com/nature-lover-iv/neo4j-mcp - PostgreSQL - Read-only database access with schema inspection
postgresqldatabasesql - Pratye/MEC-Postgres 📜 🏠 - Facilitates read and write operations on PostgreSQL databases, allowing LLMs to interact with database schemas and execute SQL queries.
databasehttppostgresllmgit - prisma/mcp 📇 ☁️ 🏠 🏠 - Gives LLMs the ability to manage Prisma Postgres databases (e.g. spin up new databases and run migrations or queries).
databasehttppostgresllmgit - rashidazarang/airtable-mcp 🐍 ☁️ 🏠 - Connect AI tools directly to Airtable. Query, create, update, and delete records using natural language. Features include base management, table operations, schema manipulation, record filtering, and data migration through a standardized MCP interface.
httpaigitgithub - s2-streamstore/s2-sdk-typescript 🎖️ 📇 ☁️ 🏠 - Official MCP server for the S2.dev serverless stream platform.
httpgitgithub - sql-mcp 🐍 🏠 - Python-based
databasehttpllmgitgithubpip install git+https://github.com/hmn53/sql-mcp - subnetmarco/pgmcp 🏎️ 🏠 🏠 - Natural language PostgreSQL queries with automatic streaming, read-only safety, and universal database compatibility.
databasehttppostgresgitgithub - wenb1n-dev/mysqlmcpserverpro 🐍 🏠 🏠 - Supports SSE, STDIO; not only limited to MySQL's CRUD functionality; also includes database exception analysis capabilities; controls database permissions based on roles; and makes it easy for developers to extend tools with customization
databasehttpmysqlgitgithub - xexr/mcp-libsql 📇 🏠 ☁️ 🏠 ☁️ - Production-ready MCP server for libSQL databases with comprehensive security and management tools.
databasehttpgitgithubfile - yannbrrd/simplesnowflakemcp 🐍 ☁️ 🏠 - Simple Snowflake MCP server that works behind a corporate proxy. Read and write (optional) operations
httpgitgithub
🔌 API
- mcp-for-beginners 🏠 (⭐ 10.3k, 🍴 3k, 🐛 2) - This open-source curriculum introduces the fundamentals of Model Context Protocol (MCP) through real-world, cross-language examples in .NET, Java, TypeScript, JavaScript, Rust and Python. Designed for developers, it focuses on practical techniques for building modular, scalable, and secure AI workflows from session setup to service orchestration.
jupyter notebookcsharpjavajavascriptjavascript-applicationsgit clone https://github.com/microsoft/mcp-for-beginners - GhidraMCP ☕ 🏠 (⭐ 5.8k, 🍴 423, 🐛 37) - MCP Server for Ghidra
javamcpserverhttpllmgit clone https://github.com/LaurieWired/GhidraMCP - mcp 🔷 🏠 (⭐ 1.6k, 🍴 151, 🐛 259) - Catalog of official Microsoft MCP (Model Context Protocol) server implementations for AI-powered data access and tool integration
c#mcpserveraigit clone https://github.com/microsoft/mcp - quarkus-mcp-servers ☕ 🏠 (⭐ 166, 🍴 43, 🐛 23) - Model Context Protocol Servers in Quarkus
javamcpquarkus-appserverhttpgit clone https://github.com/quarkiverse/quarkus-mcp-servers - quarkus-mcp-server ☕ 🏠 (⭐ 152, 🍴 41, 🐛 9) - This extension enables developers to implement the MCP server features easily.
javaquarkus-extensionmcpserverhttpgit clone https://github.com/quarkiverse/quarkus-mcp-server - alibabacloud-tablestore-mcp-server ☕ 🏠 (⭐ 148, 🍴 36, 🐛 1) - Java-based
javahttpgitgithubgit clone https://github.com/aliyun/alibabacloud-tablestore-mcp-server - anytype-mcp 📘 🏠 📇 (⭐ 148, 🍴 14, 🐛 4) - An MCP server enabling AI assistants to interact with Anytype - a local and collaborative wiki - to organize objects, lists, and more through natural language.
typescriptanytypeapimcpmcp-servernpm install anyproto/anytype-mcp - remote-mcp-functions-dotnet 🏠 (⭐ 102, 🍴 47, 🐛 10) - This is a quickstart template to easily build and deploy a custom remote MCP server to the cloud using Azure functions. You can clone/restore/run on your local machine with debugging, and
azd upto have it in the cloud in a couple minutes. The MCP server is secured by design usingbicepmcpserverrestazuregit clone https://github.com/Azure-Samples/remote-mcp-functions-dotnet - erickwendel-contributions-mcp 📘 🏠 (⭐ 100, 🍴 18, 🐛 3) - A Model Context Protocol (MCP) server that provides tools to query Erick Wendel's contributions across different platforms
typescriptgraphqllarge-language-modelsllmmodel-context-protocolnpm install ErickWendel/erickwendel-contributions-mcp - mcp-dotnet-samples 🔷 🏠 (⭐ 91, 🍴 28, 🐛 5) - A comprehensive set of samples of creating and using MCP servers and clients with .NET
c#dotnetmcpmcp-clientmcp-servergit clone https://github.com/microsoft/mcp-dotnet-samples - GhidraMCP ☕ 🏠 (⭐ 65, 🍴 11, 🐛 1) - Socket based MCP Server for Ghidra
javamcpserverhttpaigit clone https://github.com/13bm/GhidraMCP - mcp-typescribe 📘 🏠 📇 (⭐ 39, 🍴 6) - An MCP server implementation enabling LLMs to work with new APIs and frameworks
typescriptapillmmcp-servertypedocnpm install yWorks/mcp-typescribe - remote-auth-mcp-apim-py 🏠 📇 (⭐ 26, 🍴 12, 🐛 1) - Remote MCP server with auth gated by Azure API Management
bicepmcpserverapiauthgit clone https://github.com/localden/remote-auth-mcp-apim-py - storyblok-mcp-server 🐍 🏠 📇 (⭐ 25, 🍴 2) - A modular, extensible MCP Server for managing Storyblok spaces, stories, components, assets, workflows, and more via the Model Context Protocol (MCP).
pythonapigithubmcpmcp-serverpip install git+https://github.com/Kiran1689/storyblok-mcp-server - mcp-java-sdk-examples ☕ 🏠 (⭐ 22, 🍴 3, 🐛 1) - A collection of MCP server examples developed by various Java SDKs
javaexamplejava17mcpmcp-servergit clone https://github.com/codeboyzhou/mcp-java-sdk-examples - airflow-mcp-server 🐍 🏠 📇 (⭐ 21, 🍴 4, 🐛 2) - MCP Server for Apache Airflow
pythonairflowapache-airflowapillmpip install git+https://github.com/abhishekbhakat/airflow-mcp-server - luma-api-mcp 🐍 🏠 📇 (⭐ 20, 🍴 8, 🐛 2) - Powered by Ray (video) and Photon (image) models by Luma AI
pythonapigenaiimagelumapip install git+https://github.com/lumalabs/luma-api-mcp - taoke-mcp 🐳 🏠 📇 (⭐ 20, 🍴 2, 🐛 1) - 淘宝客,京东客,多多客专用MCP,支持全平台所以API接口的工具,转链接,搜索等等
dockerfilemcpapigit clone https://github.com/liuliang520530/taoke-mcp - gemsuite-mcp 📘 🏠 📇 (⭐ 18, 🍴 6, 🐛 2) - Professional Gemini API integration for Claude and all MCP-compatible hosts with intelligent model selection and advanced file handling | Smithery.ai verified
typescriptagentai-toolsapiclaude-desktopnpm install PV-Bhat/gemsuite-mcp - mcp-declarative-java-sdk ☕ 🏠 (⭐ 18, 🍴 7, 🐛 1) - Easily and Quickly Define, Develop and Integrate your MCP Resources, Prompts and Tools with Java annotations. Built on the official MCP Java SDK, but no Spring.
javaai-agentsannotation-drivendeclarativemcpgit clone https://github.com/codeboyzhou/mcp-declarative-java-sdk - openapi-to-mcp 🔷 🏠 📇 (⭐ 17, 🍴 5, 🐛 4) - An MCP server for your API
c#mcpserverapipythongit clone https://github.com/ouvreboite/openapi-to-mcp - swagger-to-mcp-generator ☕ 🏠 📇 (⭐ 17, 🍴 2, 🐛 2) - A Java program that generates a Quarkus MCP server form an Open API Swagger file
javamcpserverapigit clone https://github.com/LostInBrittany/swagger-to-mcp-generator - aj-mcp ☕ 🏠 (⭐ 16, 🍴 4, 🐛 2) - Simple MCP SDK in Java
javajava-mcpjava8mcpmcp-clientgit clone https://github.com/lightweight-component/aj-mcp - MCPSqlServer 🔷 🏠 (⭐ 14, 🍴 5) - SQL Server MCP Server for Windsurf IDE - A standalone MCP server providing SQL Server integration capabilities
c#mcpservergit clone https://github.com/ian-cowley/MCPSqlServer - keycloak-mcp-server ☕ 🏠 (⭐ 12, 🍴 2) - An MCP server for Keycloak, designed to work with Keycloak for identity and access management, covering, Users, Realms, Clients, Roles, Groups, IDPs, Authentication. Searching keycloak discourse, Native builds available.
javakeycloakmcp-serverquarkusmcpgit clone https://github.com/sshaaf/keycloak-mcp-server - backstage-mcp ☕ 🏠 (⭐ 11, 🍴 1) - A simple backstage mcp server using quarkus-backstage
javamcpservergit clone https://github.com/iocanel/backstage-mcp - CursorMCPMonitor 🔷 🏠 (⭐ 11, 🍴 2) - Real-time monitoring tool for Model Context Protocol (MCP) interactions in Cursor AI editor. Track, analyze, and debug AI context exchanges between LLM clients and servers. Supports log rotation, pattern matching, and color-coded event visualization.
c#cursordotnet-toollogmcpgit clone https://github.com/willibrandon/CursorMCPMonitor - meta-api-mcp-server 📜 🏠 📇 (⭐ 11, 🍴 2) - A user-friendly editor tool has been developed to create or edit JSON configuration files:
javascriptapimcp-serverpostman-collectionjsonnpm install savhascelik/meta-api-mcp-server - oracle-mcp-server ☕ 🏠 (⭐ 11, 🍴 3) - A Model Context Protocol (MCP) server implementation for Oracle database operations
javamcpserverdatabasegit clone https://github.com/yyue9527/oracle-mcp-server - tencent-send-article-mcp-server ☕ 🏠 (⭐ 10, 🍴 3) - 这是一个基于 MCP (Model Context Protocol) 协议的服务器,专门用于自动化发布文章到腾讯云开发者社区。通过集成 Spring Boot 3.x 和 Spring AI,为 AI 助手提供了与腾讯云开发者社区交互的能力,实现文章的自动发布和管理。
javamcpaigit clone https://github.com/yangbuyiya/tencent-send-article-mcp-server - mcp-jdbc-server ☕ 🏠 (⭐ 9, 🍴 5, 🐛 1) - Java based Model Context Procotol (MCP) Server for JDBC
javamcpserverdatabasehttpgit clone https://github.com/OpenLinkSoftware/mcp-jdbc-server - get-mcp-keys 📜 🏠 📇 (⭐ 9, 🍴 2) - A lightweight utility that securely loads API keys for Cursor MCP servers from your home directory, preventing accidental exposure of secrets in repositories. Keep your credentials safe while maintaining seamless integration with AI coding assistants.
javascriptapicredential-cursordevsecopsnpm install StuMason/get-mcp-keys - DotnetMCPServer 🔷 🏠 📇 (⭐ 8, 🍴 3) - Exemplo de MCP Server desenvolvido em .NET acessando uma API para consulta/cadastro de livros
c#mcpserverapigit clone https://github.com/andreluizsecco/DotnetMCPServer - mcp-server 📜 🏠 (⭐ 8, 🐛 1) - A MCP server for Cappt
javamcpaipythonjavascriptgit clone https://github.com/destiny-say/mcp-server - xperience-community-mcp-server 🔷 🏠 (⭐ 8, 🐛 3) - ASP.NET Core MCP server for Xperience by Kentico projects
c#mcpservergit clone https://github.com/seangwright/xperience-community-mcp-server - spring-io-api-mcp ☕ 🏠 📇 (⭐ 8, 🍴 5) - MCP server implementation that serves up-to-date information about projects from api.spring.io
javamcpserverapigit clone https://github.com/martinlippert/spring-io-api-mcp - DotNetMetadataMcpServer 🔷 🏠 (⭐ 7, 🍴 5) - A Model Context Protocol (MCP) server that provides detailed type information from .NET projects for AI coding agents.
c#mcpserveraigit clone https://github.com/V0v1kkk/DotNetMetadataMcpServer - mcp-spring-ai-demo ☕ 🏠 (⭐ 7) - mcp-spring-ai-demo (Java-based)
javamcpaigit clone https://github.com/Shamee99/mcp-spring-ai-demo - cloud-foundry-mcp ☕ 🏠 (⭐ 6, 🍴 7) - Cloud Foundry MCP Server
javamcpservergit clone https://github.com/cpage-pivotal/cloud-foundry-mcp - RhinoMCPServer 🔷 🏠 (⭐ 6, 🍴 1) - .NET-based
c#git clone https://github.com/4kk11/RhinoMCPServer - PiecesMCPNet 🔷 🏠 (⭐ 5) - An MCP server to interact with Pieces LTM
c#mcpservergit clone https://github.com/jimbobbennett/PiecesMCPNet - tsql-mcp-server 🔷 🏠 (⭐ 5, 🍴 1) - SQL Server MCP Server - Provides SQL Server database access via Model Context Protocol
c#mcpserverdatabasegit clone https://github.com/Popplywop/mssql-mcp-server - bitpin-mcp-server 🔷 🏠 (⭐ 5, 🍴 1) - This repository provides a comprehensive implementation of the Bitpin cryptocurrency exchange API through an MCP (Model Context Protocol) server.
c#bitcoinbitpincryptocurrencyexchange-apigit clone https://github.com/Kamyab7/bitpin-mcp-server - linux-mcp-server ☕ 🏠 (⭐ 4) - support execute shell on a remote linux or local machine
javagit clone https://github.com/MartinDai/linux-mcp-server - MarketPricesMCP 🔷 🏠 (⭐ 4, 🍴 1) - This tool helps you find the store offering the best price for a specific product among various chain markets in Turkey. The system fetches real-time data from different markets and returns the best price along with the corresponding store name.
c#consoleappcsharpcsharp-mcpenesssw7git clone https://github.com/Eneswunbeaten/MarketPricesMCP - mcpo-docker 🐳 🏠 📇 (⭐ 4, 🍴 4) - An example Docker image for mcpo, a tool that exposes MCP (Model Context Protocol) servers as OpenAPI-compatible HTTP endpoints for OpenWebUI.
dockerfilemcpserverapiwebgit clone https://github.com/lkoujiu/mcpo-docker - mssqlMCP 🔷 🏠 (⭐ 4, 🍴 2, 🐛 1) - MCP Server for MSSQL (Microsoft SQL Server)
c#mcpservergit clone https://github.com/MCPRUNNER/mssqlMCP - NugetMcpServer 🔷 🏠 (⭐ 4, 🍴 4) - Local MCP server demo
c#mcpservergit clone https://github.com/DimonSmart/LocalMcpServer - opendata-mcp-lab 🔷 🏠 📇 (⭐ 4, 🐛 11) - Makes UK parliament public open data APIS available as a MCP server
c#mcpserverapiaigit clone https://github.com/chrisbrooksbank-parliament/opendata-mcp-lab - spring-ai-mcp-server ☕ 🏠 (⭐ 4, 🍴 2, 🐛 1) - 스프링부트와 AI를 활용한 엑셀, PPT 생성 서버
javaserveraimcpllmgit clone https://github.com/thrkrdk/spring-ai-mcp-server - KnowledgeBaseServer 🔷 🏠 (⭐ 4, 🍴 1) - Model Context Protocol (MCP) server allowing LLMs to store and search knowledge in a SQLite database
c#mcpserverdatabasellmgit clone https://github.com/mbcrawfo/KnowledgeBaseServer - reavorse-mcp 🔷 🏠 (⭐ 4) - An enhanced Unity package to communicate with a local MCP Client via a Python server, with extended material, particle, lighting, UI and physics features.
c#mcpserverpythongit clone https://github.com/HuangChILun/reavorse-mcp - rocketmq-mcp ☕ 🏠 (⭐ 4, 🍴 1) - RocketMQ Mcp Server (Java-based)
javamcpservergit clone https://github.com/francisoliverlee/rocketmq-mcp - spring-boot-ai-confluence-mcp-server ☕ 🏠 (⭐ 3) - A Spring Boot AI-powered Model Context Protocol Server for interacting with Confluence Cloud
javamcpmcp-servermodel-context-protocolspring-aigit clone https://github.com/BootcampToProd/spring-boot-ai-confluence-mcp-server - spring-boot-bitcoin-mcp-server-2025 ☕ 🏠 📇 (⭐ 3, 🍴 1) - A demonstration of A Spring Boot/AI MCP Server that tracks Bitcoin prices using CoinGecko APIs (api.coingecko.com/api/v3)
javamcpserverapiaigit clone https://github.com/nlinhvu/spring-boot-bitcoin-mcp-server-2025 - mcp-server-spring-java ☕ 🏠 (⭐ 3, 🍴 2, 🐛 1) - MCP Server using Spring Boot Java
javamcpservergit clone https://github.com/mtwn105/mcp-server-spring-java - qualis-mcp-server 🔷 🏠 (⭐ 3, 🍴 1) - Este projeto é uma aplicação em C# com .NET 9.0, containerizada com Docker. Ele inclui um servidor (
QualisMcpServer) que processa dados de classificações de conferências acadêmicas (Qualis) e um cliente (QualisMcpClient) para interação via Docker. Manipula informações sobre eventos acadêmicos, rankings e notas.c#mcpserveraidockergit clone https://github.com/yanjustino/qualis-mcp-server - knowledge-mcp 🔷 🏠 (⭐ 3) - MCP Server that serves knowledge from a Neo4J Database
c#mcpserverdatabasegit clone https://github.com/simon-k/knowledge-mcp - tpapi-mcp-server 🎯 🏠 📇 (⭐ 3, 🍴 2) - ThemeParks.wiki API MCP Server
kotlinmcpserverapigit clone https://github.com/habuma/tpapi-mcp-server - descartes-mcp ☕ 🏠 (⭐ 2, 🍴 1) - MCP server for java. Deep introspection and REPL out of the box
javamcpservergit clone https://github.com/widoriezebos/descartes-mcp - OsqueryMcpServer ☕ 🏠 (⭐ 2, 🍴 3) - MCP wrapper for osquery
javamcpgit clone https://github.com/kousen/OsqueryMcpServer - ColorsMCP 🔷 🏠 (⭐ 2, 🍴 3) - MCP Server for Colors
c#mcpservergit clone https://github.com/markharrison/ColorsMCP - fhir-mcp-server 🔷 🏠 (⭐ 2) - A C#-based Model Context Protocol (MCP) server for FHIR
c#mcpservergit clone https://github.com/quiquemz/fhir-mcp-server - springinitializr-mcp ☕ 🏠 (⭐ 2) - MCP server for Spring Initializr
javamcpserverhttpaigit clone https://github.com/hpalma/springinitializr-mcp - java-mcp-server 🏠 (⭐ 2, 🍴 1) - 一个基于官网MCP-JAVA-SDK开发的一个DEMO案例
mcpgit clone https://github.com/kobeyk/java-mcp-server - jcrawl4ai-mcp-server ☕ 🏠 (⭐ 2, 🍴 1) - Java implementation of MCP Server for Crawl4ai
javamcpserveraigit clone https://github.com/rainyheart/jcrawl4ai-mcp-server - mcp-binlog-tool 🔷 🏠 (⭐ 2) - A Model Context Protocol server binary that exposes information inside an MSBuild Binary Log to LLMs to aid build analysis.
c#binlogmcpmsbuildservergit clone https://github.com/baronfel/mcp-msbuild-host - mcp-csharp-sdk-client 🔷 🏠 (⭐ 2, 🍴 1) - Sample client for x64dbg MCP server
c#mcpservergit clone https://github.com/AgentSmithers/mcp-csharp-sdk-client - MCPServerCSharp 🔷 🏠 (⭐ 2) - MCP Server com C# + Firebird
c#mcpservergit clone https://github.com/BoscoBecker/MCPServerCSharp - ModelContextProtocolClient ☕ 🏠 (⭐ 2, 🍴 2) - Host with MCP client to call MCP servers for MCP development
javamcpservergit clone https://github.com/InnoBridge/ModelContextProtocolClient - web-scraping-api-mcp 🏠 (⭐ 2)
git clone https://github.com/zeeb0tt/web-scraping-api-mcp - mcp-coding-server-demo-app ☕ 🏠 (⭐ 2, 🍴 2) - Esperimento di sviluppo Java EE automatizzato con Claude + MCP
javamcpgit clone https://github.com/lamemind/mcp-coding-server-demo-app - mcp-server-sql ☕ 🏠 (⭐ 2) - 这是一个基于Spring Boot的SQL服务应用,用于执行SQL查询并将结果写入文件。该服务作为Spring AI MCP(Model, Chat, Prompt)框架的一部分,提供了SQL查询和更新操作的功能。
javamcpaigit clone https://github.com/cherry-SC/mcp-server-sql - NetMcpServers 🔷 🏠 (⭐ 2, 🍴 2, 🐛 1) - Collection of my MCP (Model Context Protocol) servers written in .NET
c#mcpservergit clone https://github.com/Redth/NetMcpServers - spring-ai-mcp-test ☕ 🏠 (⭐ 2, 🍴 2) - Showcases how to integrate Spring AI's support for MCP (Model Context Protocol) within Spring Boot applications, covering both server-side and client-side implementations.
javamcpmcp-clientmcp-serverspringgit clone https://github.com/oalles/spring-ai-mcp-test - open-mcp-server ☕ 🏠 📇 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) for numerous third-party software and third-party APIs. Once deployed, this service can offer enhanced support for your AI platform, such as enabling you to use Dofi to complete your platform
javamcpapiaigit clone https://github.com/changsong/open-mcp-server - esp-mcp-server ☕ 🏠 (⭐ 1) - esp-mcp-server (Java-based)
javamcpservergit clone https://github.com/kolipakakondal/esp-mcp-server - jdbc-mcp ☕ 🏠 (⭐ 1) - JDBC MCP modified from quarkus-mcp-servers
javamcpservergit clone https://github.com/guanghuang/jdbc-mcp - jmcpx ☕ 🏠 (⭐ 1) - CLI client for interacting with MCP servers.
javamcpservergit clone https://github.com/Ernyoke/jmcpx - mcp-server-patent 🏠 📇 (⭐ 1, 🍴 2) - MCP Server configuration with patent API integrations
mcpserverapigit clone https://github.com/myownipgit/mcp-server-patent - mcp-server-useful-tools ☕ 🏠 (⭐ 1) - MCP Server useful tools, Spring AI MCP, Weather MCP, Stock MCP, Weather tool, Stock tool. https://mcphub.tools
javamcpmcp-serverserveraigit clone https://github.com/tmstack/mcp-server-useful-tools - mysql-mcp-server-by-cdata ☕ 🏠 (⭐ 1) - This read-only MCP Server allows you to connect to MySQL data from Claude Desktop through CData JDBC Drivers. Free (beta) read/write servers available at https://www.cdata.com/solutions/mcp
javamcpserveraihttpgit clone https://github.com/CDataSoftware/mysql-mcp-server-by-cdata - mcp-zenodo 🐍 🏠 📇 (⭐ 1) - Tool-based LLM integration with Zenodo via the Model Context Protocol (MCP)
pythonapifastapilangchainlanggraphpip install git+https://github.com/MSKazemi/mcp-zenodo - my-mcp-stdio-server ☕ 🏠 (⭐ 1) - Spring AI MCP Weather STDIO Server - A Spring Boot starter project demonstrating how to build a Model Context Protocol (MCP) server that provides weather-related tools
javamcpserveraigit clone https://github.com/cloud4java/my-mcp-stdio-server - Simple-Model-Context-Protocol-MCP- 🔷 🏠 (⭐ 1) - This is a minimal demonstration project for the Model Context Protocol (MCP) — a simple standard for exchanging model context between clients and servers. It is designed to be easy to understand, lightweight, and practical for integration with OpenAI-compatible clients.
c#mcpserveraigit clone https://github.com/myonathanlinkedin/Simple-Model-Context-Protocol-MCP- - verbwire-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 1, 🐛 1) - An MCP server implementation that provides tools for interacting with the Verbwire API, allowing for blockchain operations like deploying smart contracts, minting NFTs, and managing IPFS storage.
javascriptapiblockchainmcp-servermodelcontextprotocolnpm install verbwire/verbwire-mcp-server - azure-devops-mcp 🔷 🏠 (⭐ 1, 🐛 1) - Remote Azure DevOps MCP Server
c#mcpserverazuregit clone https://github.com/jmnbc/azure-devops-mcp - azure-devops-pullrequest-mcp-server 🔷 🏠 (⭐ 1) - mcp server for ADO pull requests
c#mcpservergit clone https://github.com/oshvartz/azure-devops-pullrequest-mcp-server - mcp-java-sample ☕ 🏠 (⭐ 1) - Sample of an MCP server using Spring AI with Java
javamcpserveraigit clone https://github.com/Saularch97/mcp-java-sample - ModelContextProtocolServer ☕ 🏠 (⭐ 1, 🍴 1) - MCP server to provide tools
javamcpservergit clone https://github.com/InnoBridge/ModelContextProtocolServer - spring-boot-ai-mcp-client ☕ 🏠 (⭐ 1) - A Spring Boot application for interacting with MCP servers using Spring AI Chat Client and Rest Controller
javamcpmodel-context-protocolmodel-context-protocol-clientspring-ai-mcpgit clone https://github.com/BootcampToProd/spring-boot-ai-mcp-client - azurehelp-mcp-server 🔷 🏠 📇 (⭐ 1) - This is MCP server for Azure Help APIs for Guided Troubleshooter
c#mcpserverapiazuregit clone https://github.com/akshaykokane/azurehelp-mcp-server - chronos-mcp-server 🔷 🏠 (⭐ 1) - Simple .NET Core based mcp server for retrieving the current time.
c#mcpservergit clone https://github.com/aadversteeg/chronos-mcp-server - fastexcel-mcp-server ☕ 🏠 (⭐ 1) - Model Context Protocol (MCP) for Excel.
javamcpgit clone https://github.com/bengbengbalabalabeng/fastexcel-mcp-server - jbang-mcp-examples ☕ 🏠 (⭐ 1, 🍴 1, 🐛 7) - Learning how to interact with LLM from MCP Servers with JBang, Quarkus & Langchain4j
javamcpserveraillmgit clone https://github.com/jabrena/jbang-mcp-examples - mcp_Server ☕ 🏠 (⭐ 1) - Trying out new MCP server feature using spring boot
javamcpservergit clone https://github.com/yash-a11y/mcp_Server - mcp-all ☕ 🏠 (⭐ 1, 🍴 1) - Building MCP Servers and Clients with Spring AI
javamcpserveraigit clone https://github.com/yyykf/mcp-all - mcp-devto 🔷 🏠 (⭐ 1, 🍴 1, 🐛 1) - mcp server to publish dev.to article automatically. In .NET 9
c#dotnetdotnet9hacktoberfestmcpgit clone https://github.com/extinctsion/mcp-devto - spring-boot-ai-cloudflare-r2-mcp-server ☕ 🏠 (⭐ 1) - Spring Boot AI Cloudflare R2 MCP Server - 一个基于Spring Boot和Spring AI的Cloudflare R2对象存储MCP服务器实现
javamcpserveraigit clone https://github.com/lskun/spring-boot-ai-cloudflare-r2-mcp-server - spring-boot-ai-mongo-mcp-server ☕ 🏠 (⭐ 1) - A Spring Boot AI-powered Model Context Protocol Server for interacting with MongoDB
javamcpmcp-servermodel-context-protocolspring-aigit clone https://github.com/BootcampToProd/spring-boot-ai-mongo-mcp-server - weather-mcp-server-java ☕ 🏠 (⭐ 1) - A simple weather MCP server implementation in Java
javamcpservergit clone https://github.com/chrischiedo/weather-mcp-server-java - proxy-pool-mcp-server ☕ 🏠 (⭐ 1) - 🌐 ElfProxy-MCP Bridge: AI-Optimized Web Interaction Framework with Dynamic IP Infrastructure.
javamcp-serverproxyproxy-listproxypoolgit clone https://github.com/ElfProxy/proxy-pool-mcp-server - agentcare-mcp-azalea 🏠 📇 - Agent Care MCP Server configured for Azalea Health FHIR API integration
mcpserverapigit clone https://github.com/vlcosent/agentcare-mcp-azalea - Anthropic
httpanthropic - aps-aecdm-mcp-dotnet 🏠 📇 - .NET MCP Server to connect with Claude Desktop and AEC Data Model API
mcpserverapigit clone https://github.com/JoaoMartins-callmeJohn/aps-aecdm-mcp-dotnet - dynamics-365-mcp-server-by-cdata ☕ 🏠 - This read-only MCP Server allows you to connect to Dynamics 365 data from Claude Desktop through CData JDBC Drivers. Free (beta) read/write servers available at https://www.cdata.com/solutions/mcp
javamcpserveraihttpgit clone https://github.com/CDataSoftware/dynamics-365-mcp-server-by-cdata - google-calendars-mcp-server-by-cdata ☕ 🏠 - This read-only MCP Server allows you to connect to Google Calendars data from Claude Desktop through CData JDBC Drivers. Free (beta) read/write servers available at https://www.cdata.com/solutions/mcp
javamcpserveraihttpgit clone https://github.com/CDataSoftware/google-calendars-mcp-server-by-cdata - image-search-mcp-server ☕ 🏠 - 图片搜索MCP服务 (Java-based)
javamcpgit clone https://github.com/heihei-c/image-search-mcp-server - jira-mcp ☕ 🏠 - Atlassian Jira MCP (Java-based)
javamcpgit clone https://github.com/guanghuang/jira-mcp - jira-mcp-server-by-cdata ☕ 🏠 - This read-only MCP Server allows you to connect to Jira data from Claude Desktop through CData JDBC Drivers. Free (beta) read/write servers available at https://www.cdata.com/solutions/mcp
javamcpserveraihttpgit clone https://github.com/CDataSoftware/jira-mcp-server-by-cdata - mcp ☕ 🏠 - Steadybit MCP-Server
javamcpserverhttpgitgit clone https://github.com/steadybit/mcp - mcp-human-resources ☕ 🏠 - Spring Boot MCP Server implementation focused on exposing Human Resources department data
javamcpservergit clone https://github.com/dbrown725/mcp-human-resources - mcpserver ☕ 🏠 - a simple mcp server exposing a list of colors
javamcpservergit clone https://github.com/mrwylan/mcpserver - kubernetes-mcp-server-spring-ai ☕ 🏠 - Spring AI implementation of a Kubernetes MCP Server
javamcpserveraikubernetesgit clone https://github.com/willschipp/kubernetes-mcp-server-spring-ai - langchain4j-mcp-client ☕ 🏠 - Model Context Protocol: Client application with Langchain4j for spring boot ai mcp server
javamcpserveraigit clone https://github.com/thrkrdk/langchain4j-mcp-client - linuxSshMcpServer ☕ 🏠 - establish ssh connection and send shell command or file to target linux server.
javaservergit clone https://github.com/shiyi25928988/linuxSshMcpServer - mcp-server-demo ☕ 🏠 - 简单的 MCP Server 示例项目 (Java-based)
javamcpservergit clone https://github.com/oneinstepGO/mcp-server-demo - mcp-server-spring-boot ☕ 🏠 - MCP server that showcases two tools - WeatherService and UserService
javamcpservergit clone https://github.com/iyerajesh/mcp-server-spring-boot - azd-mcp-csharp 🏠 - An AZD template to deploy a Model Context Protocol (MCP) server written in C# to Azure Container Apps using SSE Transport.
bicepmcpserveraiazuregit clone https://github.com/powergentic/azd-mcp-csharp - buildinglink-mcp 📜 🏠 📇 - MCP server for BuildingLink
javascriptapibuildinglinkhoamcpnpm install johnagan/buildinglink-mcp - azure-devops-mcp 🔷 🏠 - Azure DevOps MCP C# server and client code
c#mcpserverazuregit clone https://github.com/Novaes/azure-devops-mcp - azure-devops-mcp-server-2024 🏠 📇 - MCP Server for the Azure DevOps API, enabling project management, repository operations, and more.
mcpserverapiazuregit clone https://github.com/ZubeidHendricks/azure-devops-mcp-server-2024 - course-mcp-server ☕ 🏠 - MCP Server for the Courses, enabling search functionality, and more.
javamcpservergit clone https://github.com/reinertisa/course-mcp-server - java_mcp_server ☕ 🏠 - Java 환경에서 MCP 서버를 구축하여 Claude Client와 연결해보자
javamcpgit clone https://github.com/seonghoo1217/java_mcp_server - carsmcpserver ☕ 🏠 - Basic MCP server example with Spring AI
javamcpserveraigit clone https://github.com/amarpreetbhatia/carsmcpserver - ComedyMcpServer 🔷 🏠 📇 - DEPLOYED: MCP server using C# SDK to enhance comments with jokes from JokeAPI.
c#mcpserverapigit clone https://github.com/Tanner253/ComedyMcpServer - Gemini
apihttpai - GitLab - GitLab API, enabling project management
gitlabapiproject-management - java-sdk-mcp-server ☕ 🏠 - Este projeto demonstra como criar um Model Context Protocol (MCP) Server usando somente o Java SDK. O MCP é um protocolo que permite que ferramentas de IA conversem com sistemas externos de forma padronizada.
javamcpservergit clone https://github.com/moises-paschoalick/java-sdk-mcp-server - gmail-mcp-java-server ☕ 🏠 - Gmail MCP Server using Java and Spring Boot
javamcpserveraigit clone https://github.com/christo707/gmail-mcp-java-server - golf-course-project-mcp-server 🔷 🏠 - Golf Course Project MCP Server
c#mcpservergogit clone https://github.com/Golf-Course-Project/golf-course-project-mcp-server - java-spring-mysql-mcp-server ☕ 🏠 - Java-based
javagit clone https://github.com/angelo848/java-spring-mysql-mcp-server - jira-mcp-server ☕ 🏠 - MCP server for JIRA
javamcpservergit clone https://github.com/AzamMehr/jira-mcp-server - kotlin-mcp-server 🎯 🏠 📇 - 基于Kotlin的MCP服务端实现,并接入业务API
kotlinmcpapigit clone https://github.com/lenzSR/kotlin-mcp-server - java-jira-claude-mcp ☕ 🏠 - Java-based
javagit clone https://github.com/Chase-Bullock/java-jira-claude-mcp - mcp 🏠 📇 - MCP server that provides tools for interacting with the Fluidattacks API
mcpserverapigraphqlhttpgit clone https://github.com/fluidattacks/mcp - MCP_Server 🔷 🏠 - Testing MCP Server (.NET-based)
c#mcpservertestinggit clone https://github.com/Kasper1985/MCP_Server - mcp-module ☕ 🏠 - Implementation of mcp server/client
javamcpservergit clone https://github.com/Dpun/mcp-module - mcp-4-tf-quickstarts ☕ 🏠 - An example of an MCP server for quickstarts of Timefold
javamcpservergit clone https://github.com/TomCools/mcp-4-tf-quickstarts - mcp-investments-sample 🔷 🏠 - Sample MCP server for securities prices, historical information, etc.
c#mcpservergit clone https://github.com/CodeRunRepeat/mcp-investments-sample - mcp-llm-auto-email-registration 🔷 🏠 📇 - This project automates email-based user registration for LLM apps using the Model Context Protocol (MCP). It acts as a simple backend that receives email addresses from users, registers them with an MCP-compatible LLM server, and returns the generated API key or access token.
c#mcpserverapiaigit clone https://github.com/myonathanlinkedin/mcp-llm-auto-email-registration - mcp-server 🔷 🏠 - It is a project that seeks to express the implementation of model context protocol MCP in the official Anthropic base SDK for dotnet 9
c#mcpgit clone https://github.com/AmpolStack/mcp-server - mcp-server-demo ☕ 🏠 - mcp-server-demo (Java-based)
javamcpservergit clone https://github.com/vivitrip/mcp-server-demo - mcp-server-fintechapp ☕ 🏠 📇 - A sample MCP Server for exposing Bank API
javamcpserverapigit clone https://github.com/ConnectingDotsTech7/mcp-server-fintechapp - mcp_hello_world ☕ 🏠 - A repository created using the MCP server
javamcpservergit clone https://github.com/JavaProgrammerLB/mcp_hello_world - mcp-server-appointment-management ☕ 🏠 - This project is a Java-based MCP (Model-Context-Protocol) server designed to manage appointment data from the database.It provides a modular framework that exposes internal tools for data access and manipulation, with built-in support for AI-driven features
javamcpserverdatabaseaigit clone https://github.com/tszwalaw/mcp-server-appointment-management - mcp-server-howto ☕ 🏠 - Instructions for an AI on how to create a Java based mcp server and client
javamcpserveraigit clone https://github.com/jayessdeesea/mcp-server-howto - MCP-Server-Practice ☕ 🏠 - MCP Server Practice (Java-based)
javamcpservergit clone https://github.com/oh980225/MCP-Server-Practice - mcp-server-weixin ☕ 🏠 - mcp-server-weixin (Java-based)
javamcpservergit clone https://github.com/jerryqx/mcp-server-weixin - mcp-swagger 🏠 📇 - enable mcp server to use swagger description to call api
mcpserverapigit clone https://github.com/francoishamy/mcp-swagger - mcp-test-repo 🏠 📇 - Testing mcp server via apim
mcpserverapitestinggit clone https://github.com/clarenceb/mcp-test-repo - mcp-weather-oauth2-server ☕ 🏠 - Reference https://github.com/spring-projects/spring-ai-examples/tree/main/model-context-protocol/weather/starter-webmvc-oauth2-server
javaserverwebaiauthgit clone https://github.com/akshay12390/mcp-weather-starter-webmvc-oauth2-server - mcp-weatherapi ☕ 🏠 📇 - Simple implementation of MCP Server for WeatherAPI.com using SpringBoot
javamcpserverapigit clone https://github.com/khalidmnor/mcp-weatherapi - mcpspinner-api 🏠 📇 - API component for mcpspinner - unified access to MCP servers with a single API key
mcpserverapigit clone https://github.com/devendershekhawat/mcpspinner-api - minecraft-rcon-mcp ☕ 🏠 - a tiny minecraft mcp server, using the rcon interface
javamcpminecraftrconspring-aigit clone https://github.com/deemkeen/minecraft-rcon-mcp - my-server-mcp 🏠 📇 - Un serveur MCP pour gérer les interactions avec l'API GitHub
mcpapigit clone https://github.com/French-Team/my-server-mcp - NetStoneMCP 🔷 🏠 📇 - MCP tools for FFXIV using NetStone and external APIs via LLMs.
c#mcpapillmgit clone https://github.com/dks50217/NetStoneMCP - poop-mcp-server ☕ 🏠 - Poop MCP Server provides an MCP (Model Control Protocol) server for AI tools. This server enables AI models to interact with external services through a standardized protocol.
javamcpserveraigit clone https://github.com/AlienMCP/poop-mcp-server - office-mcp-server ☕ 🏠 - Office MCP Server (Java-based)
javamcpservergit clone https://github.com/lescoggi/office-mcp-server - niuyin-mcp-server ☕ 🏠 - 芝士学爆mcp服务 (Java-based)
javamcpgit clone https://github.com/niuyin-server/niuyin-mcp-server - OpenLinkSoftware_mcp-jdbc-server ☕ 🏠 - Mirror of https://github.com/OpenLinkSoftware/mcp-jdbc-server
javamcpserverhttpgit clone https://github.com/MCP-Mirror/OpenLinkSoftware_mcp-jdbc-server - paypal-java-mcp-server ☕ 🏠 - PayPal-Java-MCP Server
javamcpservergit clone https://github.com/kumartheashwani/paypal-java-mcp-server - Nikogenia_Java-MCPlugin-ChallengeServerBungeePlugin ☕ 🏠 - Mirror of https://github.com/Nikogenia/Java-MCPlugin-ChallengeServerBungeePlugin
javamcpserverhttpgit clone https://github.com/MCP-Mirror/Nikogenia_Java-MCPlugin-ChallengeServerBungeePlugin - OpenAI
remotehttpaiopenai - roo-mcp-server 🏠 📇 - Roo MCP Server - Real-world automation for web scraping and browser control
mcpserverapiwebgit clone https://github.com/mows21/roo-mcp-server - slack-mcp-server-by-cdata ☕ 🏠 - This read-only MCP Server allows you to connect to Slack data from Claude Desktop through CData JDBC Drivers. Free (beta) read/write servers available at https://www.cdata.com/solutions/mcp
javamcpserveraihttpgit clone https://github.com/CDataSoftware/slack-mcp-server-by-cdata - teamretro-mcp-server 📘 🏠 📇 - Model Context Protocol (MCP) server for TeamRetro integration.
typescriptapiintegrationmcpmeetingnpm install adepanges/teamretro-mcp-server - simple-vertx-mcp-server ☕ 🏠 - Simple MCP Server Implemented in Vertx
javaclaudeclaude-desktopmcpn8ngit clone https://github.com/cch0/simple-vertx-mcp-server - spring-ai-mcp-server ☕ 🏠 - spring-ai-mcp-server
javamcpserveraigit clone https://github.com/Ohanvi/spring-ai-mcp-server - vmSexed-mcp-server ☕ 🏠 - 性教育内容mcp服务 (Java-based)
javamcpgit clone https://github.com/gediaogege/vmSexed-mcp-server - sample-mcp-server ☕ 🏠 - A simple example of MCP server.
javamcpservergit clone https://github.com/tadayosi/sample-mcp-server - weather-mcp-server 🏠 📇 - A weather MCP server that provides weather alerts and forecasts using the National Weather Service API
powershellmcpserverapigit clone https://github.com/aryankarn/weather-mcp-server - zerodha-spring-mcp ☕ 🏠 📇 - A Java implementation of Zerodha's Kite trading API as a Model Context Protocol (MCP) server using Spring Boot. This project enables AI agents to interact with the Kite trading platform through a standardized protocol, providing authentication and portfolio data access tools. Inspired by the official Go implementation.
javamcpserverapiaigit clone https://github.com/Kartikhub/zerodha-spring-mcp - quarkiverse_quarkus-mcp-servers ☕ 🏠 - Mirror of https://github.com/quarkiverse/quarkus-mcp-servers
javamcpserverhttpgit clone https://github.com/MCP-Mirror/quarkiverse_quarkus-mcp-servers - salesforce-mcp-docker 🐚 🏠 📇 - Dockerized Salesforce MCP Server for REST API integration
shellmcpserverapirestgit clone https://github.com/Yusful33/salesforce-mcp-docker - Search1API - One API for Search, Crawling, and Sitemaps
searchcrawlingapi - spring-ai-mcp-server-demo ☕ 🏠 - MCP Server demo providing Book Reviews
javamcpservergit clone https://github.com/savoirtech/spring-ai-mcp-server-demo - stopwatch-mcp ☕ 🏠 - StopWatch MCP Server
javamcpmcp-servermcp-server-javaservergit clone https://github.com/jabrena/stopwatch-mcp - wof-utilization-mcp-server 🔷 🏠 - A mcp server that knows the current utilization of WOF gyms
c#mcpservergit clone https://github.com/iste2/wof-utilization-mcp-serverr - spring-mcp-server-sample ☕ 🏠 - MCP Server Sample (Java-based)
javamcpservergit clone https://github.com/ricken07/spring-mcp-server-sample - spullara_mcp-server ☕ 🏠 - Mirror of https://github.com/spullara/mcp-server
javamcpserverhttpgit clone https://github.com/MCP-Mirror/spullara_mcp-server - stock-analytics-mcp-server 🏠 📇 - A server for stock analytics using MCP and Yahoo Finance API.
mcpserverapigit clone https://github.com/SavanRajyaguru/stock-analytics-mcp-server - svatky-adresa-info-mcp-dotnet 🔷 🏠 - MCP server for svatky.adresa.info
c#mcpservergit clone https://github.com/segeda/svatky-adresa-info-mcp-dotnet - unity-mcp-server 🔷 🏠 - I am building probably the first Claude MCP Server for Unity Editor that's on the internet.
c#mcpservergit clone https://github.com/propenster/unity-mcp-server - voxta-mcp 🔷 🏠 - Voxta provider that enables communication with Model Context Protocol (MCP) servers
c#mcpservergit clone https://github.com/vega-holdings/voxta-mcp - quarkiverse_quarkus-mcp-server ☕ 🏠 - Mirror of https://github.com/quarkiverse/quarkus-mcp-server
javamcpserverhttpgit clone https://github.com/MCP-Mirror/quarkiverse_quarkus-mcp-server - Java-MCPlugin-ChallengeServerBungeePlugin ☕ 🏠 - The Java Minecraft Plugin (BungeeCord) for the Challenge Server.
javaservergit clone https://github.com/Nikogenia/Java-MCPlugin-ChallengeServerBungeePlugin
⚙️ DevOps
- mcp-go 🐹 🏠 (⭐ 7.1k, 🍴 722, 🐛 142) - A Go implementation of the Model Context Protocol (MCP), enabling seamless integration between LLM applications and external data sources and tools.
gomcpmlllmgo install mark3labs/mcp-go@latest - mcp 🐍 🏠 (⭐ 6.2k, 🍴 828, 🐛 181) - AWS MCP Servers — helping you get the most out of AWS, wherever you use MCP.
pythonawsmcpmcp-clientmcp-clientspip install git+https://github.com/awslabs/mcp - mcp-grafana 🐹 🏠 (⭐ 1.5k, 🍴 142, 🐛 32) - MCP server for Grafana
gomcpserverhttpgitgo install grafana/mcp-grafana@latest - mcphost 🐹 🏠 (⭐ 1.3k, 🍴 197, 🐛 12) - A CLI host application that enables Large Language Models (LLMs) to interact with external tools through the Model Context Protocol (MCP).
gomcpllmgo install mark3labs/mcphost@latest - mcptools 🐹 🏠 (⭐ 1.2k, 🍴 84, 🐛 24) - A command-line interface for interacting with MCP (Model Context Protocol) servers using both stdio and HTTP transport.
gomcpmcp-servermodelcontextprotocolservergo install f/mcptools@latest - mcp-golang 🐹 🏠 (⭐ 1.1k, 🍴 111, 🐛 42) - Write Model Context Protocol servers in few lines of go code. Docs at https://mcpgolang.com . Created by https://metoro.io
gomcpserverhttpgo install metoro-io/mcp-golang@latest - mcp-server-kubernetes 📘 🏠 (⭐ 1k, 🍴 171, 🐛 13) - MCP Server for kubernetes management commands
typescriptinfrastructurekubernetesmcpservernpm install Flux159/mcp-server-kubernetes - terraform-mcp-server 🐹 🏠 (⭐ 908, 🍴 78, 🐛 16) - The Terraform MCP Server provides seamless integration with Terraform ecosystem, enabling advanced automation and interaction capabilities for Infrastructure as Code (IaC) development.
gomcpservermlhttpgo install hashicorp/terraform-mcp-server@latest - go-mcp 🐹 🏠 (⭐ 618, 🍴 96, 🐛 8) - Go-MCP is a powerful Go(Golang) version of the MCP SDK that implements the Model Context Protocol (MCP) to facilitate seamless communication between external systems and AI applications.
gomcpaimlgo install ThinkInAIXYZ/go-mcp@latest - kubernetes-mcp-server 🐹 🏠 (⭐ 572, 🍴 109, 🐛 33) - Model Context Protocol (MCP) server for Kubernetes and OpenShift
gocontainerscontextkuberneteskubernetes-mcpgo install manusa/kubernetes-mcp-server@latest - mcp-link 🐹 🏠 📇 (⭐ 529, 🍴 63, 🐛 8) - Convert Any OpenAPI V3 API to MCP Server
goagentsmcpmcp-serverservergo install automation-ai-labs/mcp-link@latest - mcp-proxy 🐹 🏠 (⭐ 511, 🍴 61, 🐛 11) - An MCP proxy server that aggregates and serves multiple MCP resource servers through a single HTTP server.
goclaudemcpmcp-clientmcp-servergo install TBXark/mcp-proxy@latest - excel-mcp-server 🐹 🏠 (⭐ 488, 🍴 67, 🐛 12) - A Model Context Protocol (MCP) server that reads and writes MS Excel data
gomcpservergo install negokaz/excel-mcp-server@latest - Godot-MCP 🏠 (⭐ 321, 🍴 33, 🐛 16) - An MCP for Godot that lets you create and edit games in the Godot game engine with tools like Claude
gdscriptclaudegamedevgodotmcpgit clone https://github.com/ee0pdt/Godot-MCP - mcprouter 🐹 🏠 📇 (⭐ 284, 🍴 40, 🐛 4) - api router for MCP Servers
gochatmcpmcpmcproutermcpserversgo install chatmcp/mcprouter@latest - db-mcp-server 🐹 🏠 (⭐ 281, 🍴 34, 🐛 10) - A powerful multi-database server implementing the Model Context Protocol (MCP) to provide AI assistants with structured access to databases.
godatabase-mcp-servermcp-servermcpservergo install FreePeak/db-mcp-server@latest - code-sandbox-mcp 🐹 🏠 (⭐ 262, 🍴 30, 🐛 13) - An MCP server to create secure code sandbox environment for executing code within Docker containers. This MCP server provides AI applications with a safe and isolated environment for running code while maintaining security through containerization.
gomcpserveraidockergo install Automata-Labs-team/code-sandbox-mcp@latest - telegram-mcp 🐹 🏠 📇 (⭐ 197, 🍴 21, 🐛 5) - Telegram MCP for managing dialogs, messages, drafts, read statuses, and more.
gomcpmcp-servermtprototelegramgo install chaindead/telegram-mcp@latest - kite-mcp-server 🐹 🏠 (⭐ 167, 🍴 55, 🐛 26) - Zerodha Kite MCP server
gomcpservergo install rhnvrm/kite-mcp-server@latest - k8s-mcp-server 🐍 🏠 (⭐ 166, 🍴 31, 🐛 4) - K8s-mcp-server is a Model Context Protocol (MCP) server that enables AI assistants like Claude to securely execute Kubernetes commands. It provides a bridge between language models and essential Kubernetes CLI tools including kubectl, helm, istioctl, and argocd, allowing AI systems to assist with cluster management, troubleshooting, and deployments
pythonai-assistantargocdclaudedevopspip install git+https://github.com/alexei-led/k8s-mcp-server - auto-mcp 🐹 🏠 📇 (⭐ 165, 🍴 16, 🐛 17) - Transform any OpenAPI/Swagger definition into a fully-featured Model Context Protocol (MCP) server
gomcpserverapigo install brizzai/auto-mcp@latest - aws-mcp-server 🐍 🏠 (⭐ 161, 🍴 26, 🐛 8) - A lightweight service that enables AI assistants to execute AWS CLI commands (in safe containerized environment) through the Model Context Protocol (MCP). Bridges Claude, Cursor, and other MCP-aware AI tools with AWS CLI for enhanced cloud infrastructure management.
pythonai-assistantawsaws-automationclaudepip install git+https://github.com/alexei-led/aws-mcp-server - protoc-gen-go-mcp 🐹 🏠 (⭐ 154, 🍴 20, 🐛 13) - Go protobuf compiler extension to turn any gRPC service into an MCP server
gomcpservergo install redpanda-data/protoc-gen-go-mcp@latest - mcp-server-weaviate 🐹 🏠 (⭐ 149, 🍴 39, 🐛 5) - MCP (Model Context Protocol) server for Weaviate
gomcpserverhttpgitgo install weaviate/mcp-server-weaviate@latest - mcp-1panel 🐹 🏠 (⭐ 142, 🍴 20, 🐛 4) - mcp-1panel is an implementation of the Model Context Protocol (MCP) server for 1Panel.
go1panelmcpmcp-serverservergo install 1Panel-dev/mcp-1panel@latest - openapi-mcp 🐹 🏠 📇 (⭐ 131, 🍴 28, 🐛 3) - Dockerized MCP Server to allow your AI agent to access any API with existing api docs
gomcpserverapiaigo install ckanthony/openapi-mcp@latest - mcp-k8s 🐹 🏠 (⭐ 124, 🍴 24) - A Kubernetes MCP (Model Control Protocol) server that enables interaction with Kubernetes clusters through MCP tools.
godebugkubernetesmcpmcp-servergo install silenceper/mcp-k8s@latest - foxy-contexts 🐹 🏠 (⭐ 107, 🍴 6) - Foxy contexts is a library for building context servers supporting Model Context Protocol
goserverhttpgitgithubgo install strowk/foxy-contexts@latest - swagger-mcp 📘 🏠 (⭐ 101, 🍴 19, 🐛 5) - Swagger to MCP server
gomcpservertypescriptgo install danishjsheikh/swagger-mcp@latest - godoc-mcp 🐹 🏠 (⭐ 83, 🍴 10, 🐛 3) - go doc mcp server
gogolangmcpserverfilego install mrjoshuak/godoc-mcp@latest - remote-mcp-functions 🏠 (⭐ 80, 🍴 22, 🐛 3) - Landing page for Remote MCP Server efforts in Azure Functions with links to all language stack specific repos.
mcpserverazuregit clone https://github.com/Azure-Samples/remote-mcp-functions - azure-cli-mcp ☕ 🏠 (⭐ 78, 🍴 15, 🐛 1) - Talk with Azure using MCP
javaazuremcpmcp-serverhttpgit clone https://github.com/jdubois/azure-cli-mcp - vantage-mcp-server 🐹 🏠 (⭐ 75, 🍴 3) - MCP Server to fetch costs and usage data from your Vantage account.
gomcpserverhttpgitgo install vantage-sh/vantage-mcp-server@latest - mcp-kafka 🐹 🏠 (⭐ 72, 🐛 2) - A Model Context Protocol Server to perform Kafka client operations
goservergo install kanapuli/mcp-kafka@latest - azure-cosmos-mcp-server-samples 🐹 🏠 (⭐ 60, 🍴 24, 🐛 3) - This repository contains a collection of sample implementations of the MCP across multiple programming languages, all backed by Azure Cosmos DB. These examples demonstrate how to create, query, update, and delete documents using the Azure Cosmos DB SDKs
gomcpaiazurego install AzureCosmosDB/azure-cosmos-mcp-server@latest - portainer-mcp 🐹 🏠 (⭐ 60, 🍴 12, 🐛 6) - Portainer MCP server
gomcpserveraihttpgo install portainer/portainer-mcp@latest - mcp-trino 🐹 🏠 (⭐ 59, 🍴 22, 🐛 5) - A high-performance Model Context Protocol (MCP) server for Trino implemented in Go.
gomcpmcp-servertrinoservergo install tuannvm/mcp-trino@latest - mcp-server-axiom 🐹 🏠 (⭐ 58, 🍴 9, 🐛 5) - Axiom Model Context Protocol Server
goserverhttpgitgithubgo install axiomhq/mcp-server-axiom@latest - mcp-server-axiom 🐹 🏠 (⭐ 58, 🍴 9, 🐛 5) - Axiom Model Context Protocol Server
goservergo install axiomhq/axiom-mcp@latest - gin-mcp 🐹 🏠 📇 (⭐ 49, 🍴 11) - Enable MCP features for any Gin API with a line of code
gomcpapiwebhttpgo install ckanthony/gin-mcp@latest - mcp-oauth2-aws-cognito 📜 🏠 (⭐ 48, 🍴 7, 🐛 3) - MCP Server Authorization Example with AWS Cognito
javascriptawscognitomcpoauth2npm install empires-security/mcp-oauth2-aws-cognito - mcp-compose 🐹 🏠 (⭐ 43, 🍴 3, 🐛 1) - Run and manage MCP servers as Docker containers with a unified HTTP endpoint. Inspired by Docker compose.
gomcpserveraihttpgo install phildougherty/mcp-compose@latest - mcp-google-spreadsheet 🐹 🏠 (⭐ 41, 🍴 4) - MCP Server for Google Spreadsheet
gomcpservergo install kazz187/mcp-google-spreadsheet@latest - mcp-gopls 🐹 🏠 (⭐ 39, 🍴 4, 🐛 1) - Go-based
gomcpserveraigo install Yantrio/mcp-gopls@latest - mcp-kubernetes 🐹 🏠 (⭐ 39, 🍴 10) - A Model Context Protocol (MCP) server that enables AI assistants to interact with Kubernetes clusters. It serves as a bridge between AI tools (like Claude, Cursor, and GitHub Copilot) and Kubernetes
gokubernetesmcp-servermodel-context-protocolmcpgo install Azure/mcp-kubernetes@latest - mcp-gitee 🐹 🏠 📇 (⭐ 38, 🍴 10, 🐛 2) - mcp-gitee is a Model Context Protocol (MCP) server implementation for Gitee. It provides a set of tools that interact with Gitee's API, allowing AI assistants to manage repository, issues, pull requests, etc.
gogiteemcpmcp-serverservergo install oschina/mcp-gitee@latest - mcp-netbird 🐹 🏠 (⭐ 38, 🍴 3, 🐛 1) - MCP Server for Netbird
gomcpserverhttpgitgo install aantti/mcp-netbird@latest - temporal-mcp 🐹 🏠 (⭐ 36, 🍴 6, 🐛 2) - Empowering AI with Workflow Orchestration
godurable-executiongolangmcp-servertemporalgo install Mocksi/temporal-mcp@latest - mcp-nats 🐹 🏠 (⭐ 32) - A Model Context Protocol (MCP) server for NATS messaging system integration
gomcp-servernatsnats-iomcpgo install sinadarbouy/mcp-nats@latest - FastDomainCheck-MCP-Server 🐹 🏠 (⭐ 29, 🍴 3, 🐛 2) - A Model Context Protocol for checking domain name registration status in bulk.
gogolangmcp-serveraigo install bingal/FastDomainCheck-MCP-Server@latest - mcp-cyclops 🐹 🏠 (⭐ 29, 🍴 3, 🐛 2) - Model Context Protocol server for Cyclops
gocyclopsdevopskubernetesmcpgo install cyclops-ui/mcp-cyclops@latest - azure-container-apps-ai-mcp 📘 🏠 📇 (⭐ 28, 🍴 13, 🐛 5) - This project showcases how to use the MCP protocol with Azure OpenAI. It provides a simple example to interact with OpenAI's API seamlessly via an MCP server and client.
typescriptagentsazurellmmcpnpm install manekinekko/azure-openai-mcp-example - mcp-launcher 🐹 🏠 (⭐ 28, 🍴 3, 🐛 1) - 🐳🧩 Easy to use MCP builder & launcher for all possible MCP servers, just like Ollama for models!
gomcpmcp-serverollamaservergo install moeru-ai/mcp-launcher@latest - mcp-wecombot-server 🐹 🏠 (⭐ 28, 🍴 6, 🐛 1) - An MCP server application that sends various types of messages to the WeCom group robot.
gomcpservergo install gotoolkits/mcp-wecombot-server@latest - podman-mcp-server 🐹 🏠 (⭐ 27, 🍴 7, 🐛 1) - Model Context Protocol (MCP) server for container runtimes (Podman and Docker)
gocontainer-runtimecontainerscontextdockergo install manusa/podman-mcp-server@latest - godoc-mcp-server 🐹 🏠 (⭐ 26, 🍴 3) - A mcp server provide infomation from pkg.go.dev. For all golang programmers
gomcpmcp-servermodelcontextprotocolservergo install yikakia/godoc-mcp-server@latest - gomcp 🐹 🏠 (⭐ 26, 🍴 6, 🐛 3) - Lightpanda MCP server written in Go
gomcpserverwebhttpgo install lightpanda-io/gomcp@latest - mcp-k8s-eye 🐹 🏠 (⭐ 25, 🍴 6, 🐛 1) - MCP Server for kubernetes management and diagnose your cluster and applications
gomcpserverkuberneteshttpgo install wenhuwang/mcp-k8s-eye@latest - mcp-server 📘 🏠 📇 (⭐ 25, 🍴 12, 🐛 3) - Vapi MCP Server (TypeScript-based)
gomcpservertypescriptaigo install eminetto/mcp-server@latest - mcp-toolbox-sdk-go 🐹 🏠 (⭐ 21, 🍴 8, 🐛 4) - Go SDK for interacting with the MCP Toolbox for Databases.
godatabasesgenai-gogenkit-gogolanggo install googleapis/mcp-toolbox-sdk-go@latest - mcp-server-aws-resources-python 🐍 🏠 (⭐ 20, 🍴 12, 🐛 1) - A Python-based MCP server that lets Claude run boto3 code to query and manage AWS resources. Execute powerful AWS operations directly through Claude with proper sandboxing and containerization. No need for complex setups - just pass your AWS credentials and start interacting with all AWS services.
pythonawsmcp-servermcpserverpip install git+https://github.com/baryhuang/mcp-server-aws-resources-python - vision-one-mcp-server 🐹 🏠 📇 (⭐ 20, 🍴 7, 🐛 3) - The Trend Vision One Model Context Protocol (MCP) Server enables natural language interaction between your favourite AI tooling and the Trend Vision One web APIs. This allows users to harness the power of Large Language Models (LLM) to interpret and respond to security events.
gomcpserverapiwebgo install trendmicro/vision-one-mcp-server@latest - playwright-mcp-docker 🐳 🏠 (⭐ 19, 🍴 10, 🐛 1) - This project provides a Docker Compose environment to run the '@playwright/mcp' server.
dockerfilemcpserverdockergit clone https://github.com/iuill/playwright-mcp-docker - tasker-mcp 🐹 🏠 (⭐ 19, 🍴 3) - An MCP server for Android's Tasker automation app.
gogolangmcpmcp-servertaskergo install dceluis/tasker-mcp@latest - aqara-mcp-server 🐹 🏠 (⭐ 18, 🍴 4, 🐛 1) - Aqara's official MCP Server
gomcpservergo install aqara/aqara-mcp-server@latest - mcp-human 📜 🏠 (⭐ 18, 🍴 3, 🐛 1) - Human Assistance for AI Assistants
javascriptawsaws-mturkllmmcpnpm install olalonde/mcp-human - mcp-recon 🐹 🏠 (⭐ 18, 🍴 5) - Tellix is a conversational recon interface powered by httpx and LLMs. Just ask.
gollmhttpaigitgo install nickpending/mcp-recon@latest - mcp-searxng-enhanced 🐍 🏠 📇 (⭐ 18, 🍴 4) - Enhanced MCP server for SearXNG: category-aware web-search, web-scraping, and date/time retrieval.
pythoncitationsdatetimedockerdocker-imagepip install git+https://github.com/OvertliDS/mcp-searxng-enhanced - user-prompt-mcp 🐹 🏠 (⭐ 17, 🍴 3, 🐛 1) - A Model Context Protocol (MCP) server for Cursor that enables requesting user input during generation
gomcpserverhttpgitgo install nazar256/user-prompt-mcp@latest - go-go-mcp 🐹 🏠 (⭐ 16, 🍴 3, 🐛 1) - Anthropic MCP go implementation
gomcpgo install go-go-golems/go-go-mcp@latest - azure-mcp 📘 🏠 (⭐ 15, 🍴 6, 🐛 4) - A Model Context Protocol (MCP) implementation that enables Claude Desktop to interact with Azure services. This integration allows Claude to query and manage Azure resources directly through natural language conversations.
typescriptazureclaudemcpnodenpm install Streen9/azure-mcp - MCP-Think 🐹 🏠 (⭐ 15) - MCP Think tool prebuilt binaries and code
gomcpgo install iamwavecut/MCP-Think@latest - MCPChain 🐹 🏠 (⭐ 14, 🐛 5) - MCPChain brings the Model Context Protocol to Web3 by anchoring agent tools, trust registries, and attestable executions on-chain.
goaiagentsblockchaincometbftcosmos-sdkgo install Deeptanshu-sankhwar/MCPChain@latest - grpcurl-mcp 🐹 🏠 (⭐ 13, 🍴 7) - Model Context Protocol (MCP) server to interact with gRPC services using the grpcurl tool
gomcpservergo install wricardo/grpcurl-mcp@latest - mcp-server-kintone 🐹 🏠 (⭐ 12, 🍴 2) - MCP server for kintone
gokintonemcpmodelcontextprotocolservergo install macrat/mcp-server-kintone@latest - luno-mcp 🐹 🏠 📇 (⭐ 11, 🍴 3, 🐛 12) - MCP Server for the Luno Cryptocurrency API
goarbitragecryptocurrencymcptradinggo install luno/luno-mcp@latest - mcp-server 🐹 🏠 (⭐ 11, 🍴 8, 🐛 8) - This is the official repo for the Harness MCP server
gomcpserverhttpgitgo install harness/mcp-server@latest - dlv-mcp 🐹 🏠 (⭐ 10, 🍴 1) - MCP Server that exposes Golang's Delve Debugger, enable AI to self-debug
gomcpserveraigo install xhd2015/dlv-mcp@latest - mcp-nutanix 🐹 🏠 (⭐ 10, 🍴 4, 🐛 1) - MCP Server for Nutanix
gomcpserverhttpgitgo install thunderboltsid/mcp-nutanix@latest - mermaid-mcp-server 📜 🏠 (⭐ 10, 🍴 1) - An MCP server providing tools for validating and rendering Mermaid diagrams.
pythonagentsdockerllmmcppip install git+https://github.com/andrewginns/mermaid-mcp-server - ocireg-mcp 🐹 🏠 (⭐ 10, 🍴 2, 🐛 1) - An MCP (Model Context Protocol) server that provides tools for querying OCI registries and image references.
gomcpserverhttpaigo install StacklokLabs/ocireg-mcp@latest - reportportal-mcp-server 🐹 🏠 (⭐ 10, 🍴 14, 🐛 5) - MCP server for ReportPortal
gomcpserverhttpllmgo install reportportal/reportportal-mcp-server@latest - unsplash-mcp-server 🐹 🏠 (⭐ 10, 🍴 2) - 🔎 A MCP server for Unsplash image search.
gomcp-gomcp-servermcpservergo install douglarek/unsplash-mcp-server@latest - go-mcp-server-example 🐹 🏠 (⭐ 10, 🍴 2) - Example how to make a DIY MCP server in Go
goexamplegolangmcp-servermcpgo install BearHuddleston/go-mcp-server-example@latest - unsplash-mcp-server-go 🐹 🏠 (⭐ 10, 🍴 1, 🐛 1) - a Swift implementation of hellokaton/unsplash-mcp-server, with additional features like get_photo and random_photo
gomcpservergo install okooo5km/unsplash-mcp-server-swift@latest - GOATsolana-mcp 🏠 (⭐ 10, 🍴 4, 🐛 1) - A Model Context Protocol (MCP) server that enables Claude to access, analyze, and visualize Solana blockchain data through natural language conversations.
mcpserveraigit clone https://github.com/FarseenSh/GOATsolana-mcp - linear-mcp-go 🐹 🏠 📇 (⭐ 9, 🍴 5, 🐛 1) - linear MCP server based on mcp-go
gomcpserverapihttpgo install geropl/linear-mcp-go@latest - mcp-helm 🐹 🏠 (⭐ 9, 🍴 1, 🐛 2) - MCP server for Helm package manager
gohelmkubernetesmcpservergo install zekker6/mcp-helm@latest - pinner-mcp 🐹 🏠 (⭐ 9, 🍴 4) - Model Context Protocol (MCP) server to pin components to their immutable version
gomcpserverhttpaigo install safedep/pinner-mcp@latest - kubernetes-mcp-server 🐹 🏠 📇 (⭐ 9, 🍴 2) - A Model Context Protocol (MCP) server for the Kubernetes API.
gomcpserverapikubernetesgo install Blankcut/kubernetes-mcp-server@latest - mcp-untappd-server-dotnet 🏠 (⭐ 9) - An example MCP Azure Function in F#
f#azure-functionsdotnetfsharpmodelcontextprotocolgit clone https://github.com/jtucker/mcp-untappd-server-dotnet - feed-mcp 🐹 🏠 (⭐ 8, 🐛 8) - MCP Server for RSS, Atom, and JSON Feeds
gomcpserverjsongo install richardwooding/feed-mcp@latest - mcp-argo-server 🐹 🏠 (⭐ 8, 🍴 1, 🐛 2) - An MCP server for running Argo workflows, written in Golang
gomcpservergo install jakkaj/mcp-argo-server@latest - mcp-kubernetes-server 🐍 🏠 (⭐ 8, 🍴 3, 🐛 1) - A Model Context Protocol (MCP) server that enables AI assistants to interact with Kubernetes clusters. It serves as a bridge between AI tools (like Claude, Cursor, and GitHub Copilot) and Kubernetes, translating natural language requests into Kubernetes operations and returning the results in a format the AI tools can understand.
pythonclaudekubernetesmcpmcp-serverpip install git+https://github.com/feiskyer/mcp-kubernetes-server - ms-sentinel-mcp-server 🐍 🏠 (⭐ 8, 🍴 5, 🐛 1) - MCP server for Microsoft Sentinel. Enables access to Sentinel logs, incidents, analytics, and Entra ID data via a modular, queryable interface. Strictly non-production. Designed for use with Claude and other LLMs.
pythonazurellm-integrationlog-analyticsmcppip install git+https://github.com/dstreefkerk/ms-sentinel-mcp-server - opslevel-mcp 🐹 🏠 (⭐ 8, 🍴 6, 🐛 9) - Model Context Protocol (MCP) server for OpsLevel
gomcpserverhttpgitgo install opslevel/opslevel-mcp@latest - time-mcp-server 🐹 🏠 (⭐ 8, 🍴 3) - A Model Context Protocol server that provides time-related capabilities.
goservergo install okooo5km/time-mcp-server@latest - mcp-filesystem 📘 🏠 (⭐ 7, 🍴 1, 🐛 7) - A secure Model Context Protocol (MCP) server providing filesystem access within predefined directories
gomcpservertypescriptfilesystemgo install isaacphi/mcp-filesystem@latest - mcpenetes 🐹 🏠 (⭐ 7, 🍴 2, 🐛 1) - If you're tired of manually editing config files for different MCP-compatible clients whenever you want to switch servers, mcpenetes is here to save your day.
goclimcp-servermcpservergo install tuannvm/mcpenetes@latest - xk6-mcp 🐹 🏠 (⭐ 7) - Test MCP servers with k6
goxk6mcpservergo install dgzlopes/xk6-mcp@latest - go-mcp-postgres 🐹 🏠 (⭐ 6, 🍴 1, 🐛 1) - Zero burden, ready-to-use Model Context Protocol (MCP) server for interacting with postgresql and automation with sse / stdio mode and i18n support
gomcpserverpostgresgo install guoling2008/go-mcp-postgres@latest - mcp-alapi-cn 🐹 🏠 📇 (⭐ 6, 🍴 1) - 这是一个基于 ALAPI 的 MCP (Model Control Protocol) 服务器实现,可以通过MCP协议直接调用ALAPI的接口
gomcpmcp-gomcp-serverapigo install ALAPI-SDK/mcp-alapi-cn@latest - mcp-daemonize 🐹 🏠 (⭐ 6, 🍴 2) - A Model Context Protocol server for seamless management and monitoring of long-running daemons via AI agents
gomcpmcp-serverserveraigo install mackee/mcp-daemonize@latest - mcp-go-starter 🐹 🏠 (⭐ 6, 🍴 6) - A starter repo for building a go MCP server
gomcpservergo install SamMorrowDrums/mcp-go-starter@latest - mcp-iot-go 🐹 🏠 (⭐ 6) - MCP Server for Sensors
gomcpservergo install sukeesh/mcp-iot-go@latest - mcp-notify 🐹 🏠 (⭐ 6, 🍴 1) - A simple MCP server for sending desktop notifications.
gomcpservergo install 5n7/mcp-notify@latest - mcp-vscode-tutorial 🐹 🏠 (⭐ 6, 🍴 1) - A tutorial to build an MCP server and use vscode as an MCP client
gomcpservergo install msalemor/mcp-vscode-tutorial@latest - santa-mcp 🐹 🏠 (⭐ 6, 🍴 1) - A PoC MCP Server for Santa
gomcpservergo install pmarkowsky/santa-mcp@latest - gh-github-mcp-server 🐹 🏠 (⭐ 5) - GitHub CLI extension for GitHub MCP Server with automatic authentication
gomcpserverauthgo install MayorFaj/gh-github-mcp-server@latest - go-dev-mcp 🐹 🏠 (⭐ 5, 🍴 1, 🐛 2) - A MCP server for Golang development
gomcpservergo install fpt/go-dev-mcp@latest - mcp_cosmosdb_go 🐹 🏠 (⭐ 5, 🍴 1) - Sample implementation of a MCP server for Cosmos DB built using the Go SDK
goazure-cosmos-dbgolangmcpmcp-servergo install abhirockzz/mcp_cosmosdb_go@latest - terminal_mcp 🐹 🏠 (⭐ 5) - A Model Context Protocol (MCP) server written in Go that provides secure terminal command execution with configurable timeouts and platform-specific support.
gomcpservergo install iris-networks/terminal_mcp@latest - typesense-mcp-server 🐍 🏠 (⭐ 5, 🍴 1) - MCP server for Typesense
gomcpserverpythonmcp-servergo install sourabh-khot65/typesense-mcp-server@latest - mcp-filesystem-server 🐹 🏠 (⭐ 5, 🍴 1) - A Go implementation of the Model Context Protocol (MCP), enabling seamless integration between LLM applications and external data sources and tools
gomcpmlllmgo install qiangmzsx/mcp-filesystem-server@latest - go_mcp_server_youtube_search 🐹 🏠 (⭐ 4, 🍴 1) - A simple MCP (Model Context Protocol) server that provides tools for searching and retrieving information from YouTube videos. This server can be used with AI assistants that support the MCP protocol.
gomcp-serveryoutubeyoutube-searchmcpgo install hightemp/go_mcp_server_youtube_search@latest - kroki-mcp 🐹 🏠 (⭐ 4, 🍴 1) - Kroki-MCP is a Go-based Model Context Protocol tool that converts textual diagram definitions (PlantUML, Mermaid, and more) into images via a Kroki backend. Designed for simplicity and flexibility, it supports both local and remote Kroki servers, offers configurable settings, and outputs multiple formats – making it ideal for developers building AI
godiagram-mcpkrokimcp-gomcp-servergo install utain/kroki-mcp@latest - kwdb-mcp-server 🐹 🏠 (⭐ 4, 🍴 2) - KWDB MCP Server (Go-based)
gomcpserverdatabasehttpgo install KWDB/kwdb-mcp-server@latest - mcp-cloud-compliance ☕ 🏠 (⭐ 4) - Conversational cloud security compliance auditing. MCP server enabling natural language queries about AWS security posture via Claude and other AI assistants.
javaawscis-benchmarkcloud-securitycompliancegit clone https://github.com/uprightsleepy/mcp-cloud-compliance - mcp-hetzner-go 🐹 🏠 📇 (⭐ 4, 🐛 1) - A Go Model Context Protocol (MCP) server for interacting with the Hetzner Cloud API.
gomcpserverapigo install MahdadGhasemian/mcp-hetzner@latest - oauth2-authorization-server ☕ 🏠 (⭐ 4, 🍴 1, 🐛 1) - OAuth2 Authorization Server with Spring Boot 3 and Java 24
javaai-advisoraot-compilationarchunit-junit5coordinated-restore-at-checkpointgit clone https://github.com/musabbozkurt/oauth2-authorization-server - mcp-go-sdk 🐹 🏠 (⭐ 4, 🍴 3) - This SDK provides a Go implementation of the Machine Control Protocol (MCP), enabling bidirectional communication between clients and servers for tool execution, resource access, and prompt handling. Based on https://github.com/modelcontextprotocol SDK
gomcpserverhttpgo install SetiabudiResearch/mcp-go-sdk@latest - promptz-mcp 📘 🏠 (⭐ 4, 🍴 6, 🐛 6) - MCP Server implementation for promptz.dev
typescriptamazon-q-developerawsmcp-servermcpnpm install cremich/promptz-mcp - remote-mcp-host-ec2 📘 🏠 (⭐ 4, 🍴 1) - Build and deploy Remote Model Context Protocol (MCP) servers to AWS EC2
typescriptawscontextec2mcpnpm install tadeodonegana/remote-mcp-host-ec2 - adls-mcp-server 🐍 🏠 (⭐ 4, 🍴 5, 🐛 3) - Microsoft Azure Data Lake Storage MCP Server
pythonadlsazuremcpmcp-serverpip install git+https://github.com/erikhoward/adls-mcp-server - mcp-cbs-cijfers-open-data 🐹 🏠 (⭐ 4, 🍴 1) - MCP server for working with CBS Cijfers Open Data
gocbsmcpopendataoverheidgo install dstotijn/mcp-cbs-cijfers-open-data@latest - mcp-server-pipecd 🐹 🏠 (⭐ 4, 🍴 3) - An MCP Server for PipeCD
gogolangmcpmodelcontextprotocolservergo install Warashi/mcp-server-pipecd@latest - mcp-codepipeline-server 📘 🏠 (⭐ 4, 🍴 4, 🐛 2) - This is a Model Context Protocol (MCP) server that integrates with AWS CodePipeline, allowing you to manage your pipelines through Windsurf and Cascade. The server provides a standardized interface for interacting with AWS CodePipeline services.
typescriptawsaws-codepipelinecodepiplinemcp-servernpm install cuongdev/mcp-codepipeline-server - dgraph-mcp-server 🐹 🏠 (⭐ 3, 🍴 2) - A Model Context Protocol (MCP) server implementation for Dgraph graph database, built using the mcp-go library.
gomcpserverdatabasehttpgo install johnymontana/dgraph-mcp-server@latest - ergo-mcp 🏠 📇 (⭐ 3, 🍴 1)
roffapihttpaigitgit clone https://github.com/marctheshark3/ergo-mcp - favicon-mcp-server 🐹 🏠 (⭐ 3, 🍴 1) - A MCP server for converting input images into favicon
gomcpservergo install elliotxx/favicon-mcp-server@latest - gcp-mcp-server 🐹 🏠 (⭐ 3) - A MCP server implementation for Google Cloud using Go and Cobra.
gocobra-cligcpgolangmcp-servergo install lreimer/gcp-mcp-server@latest - go-mcp-server-financeiro 🐹 🏠 📇 (⭐ 3, 🍴 1) - Exemplo prático de construção de um MCP Server em Go, com registro dinâmico de ferramentas financeiras, consultas reais à API Alpha Vantage e exposição de metadados para agentes clientes. Projeto focado em modularidade, extensibilidade e padronização seguindo o Model Context Protocol (MCP).
gomcpserverapiaigo install tadrianonet/go-mcp-server-financeiro@latest - goose-with-mcp-servers 🏠 (⭐ 3, 🍴 2) - Codename goose docker image with mcp servers
mcpserverdockergogit clone https://github.com/elsewhat/goose-with-mcp-servers - mcp-remote-go 🐹 🏠 (⭐ 3) - This Go implementation allows MCP clients that only support local (stdio) connections to connect to remote MCP servers with authentication support.
gomcpserverauthgo install naotama2002/mcp-remote-go@latest - pmcp 🐹 🏠 (⭐ 3, 🍴 1, 🐛 5) - 🚀 A Prometheus Model Context Protocol Server.
gomcpprometheusserverhttpgo install yshngg/pmcp@latest - go-mcp-demo 🐹 🏠 (⭐ 3) - mcp server and client
gomcpservergo install Patrick7241/go-mcp-demo@latest - hyper-mcp-hackernews-tool 🐹 🏠 (⭐ 3, 🍴 1) - hacker news mcp plugin
gomcpgo install hungran/hyper-mcp-hackernews-tool@latest - mcp-autotest 🐹 🏠 (⭐ 3) - Utility for autotesting MCP servers
gomcpservertestinggo install strowk/mcp-autotest@latest - zero-mcp-github 🐹 🏠 (⭐ 3, 🍴 1) - github mcp server built on go-zero mcp capabilities
gomcpservergo install zhoushuguang/zero-mcp-github@latest - dockerServerMangerGoMCP 🐹 🏠 (⭐ 3) - dockerServerMangerGoMCP
gomcpserverdockergo install ThreatFlux/dockerServerMangerGoMCP@latest - k8s-mcp-server 🐹 🏠 📇 (⭐ 3) - The Kubernetes MCP Server is a Model Context Protocol (MCP) server that provides seamless integration with Kubernetes APIs, enabling advanced automation and interaction capabilities for developers, operators, and AI tools.
goai-agentskubernetesmcpmcp-servergo install briankscheong/k8s-mcp-server@latest - mcp-server-gohilvl 🏠 (⭐ 3, 🍴 3) - A set of tools to connect gohighlevel data to your LLMs
llmgogit clone https://github.com/delorenj/mcp-server-gohilvl - kubevirt-mcp-server 🐹 🏠 (⭐ 2, 🍴 1) - A simple Model Context Protocol server for KubeVirt
goservergo install lyarwood/kubevirt-mcp-server@latest - mcp-server-starter 📜 🏠 (⭐ 2, 🍴 2) - This repository contains a ready-to-use Model Context Protocol (MCP) server that supercharges your development workflow. As a new developer, I created this tool to consolidate documentation and streamline my development process—now I'm sharing it with you.
javascriptawsmcpopenaisupabasenpm install mgesteban/mcp-server-starter - caddy-mcp 🐹 🏠 (⭐ 2) - Caddy MCP server (Go-based)
gomcpservergo install lum8rjack/caddy-mcp@latest - cloudstack-mcp 🐹 🏠 (⭐ 2, 🐛 3) - proof of concept MCP server for apache cloudstack
gocloudstackcursormcpservergo install walteh/cloudstack-mcp@latest - clarifai-mcp-server-local 🐹 🏠 (⭐ 2, 🍴 2) - Local MCP server for clarifai.com
gomcpserveraigo install tot-ra/clarifai-mcp-server-local@latest - confluence-mcp 🐹 🏠 📇 (⭐ 2, 🍴 3, 🐛 3) - A Go-based Model Context Protocol (MCP) server for integrating AI assistants with Atlassian Confluence. This tool provides a seamless interface for interacting with the Confluence API through the standardized MCP, enabling AI models to search, retrieve, create, and update Confluence content.
gomcpmcp-serverserverapigo install nguyenvanduocit/confluence-mcp@latest - filesys 🐹 🏠 (⭐ 2, 🍴 1) - Enhanced FileSystem MCP server
gomcpservergo install gomcpgo/filesys@latest - mcp_kusto 🐹 🏠 (⭐ 2, 🍴 1) - Vibe querying with MCP server for Azure Data Explorer (Kusto)
goazuregolangkustolarge-language-modelsgo install abhirockzz/mcp_kusto@latest - mcp-grpc-transport 🐹 🏠 (⭐ 2, 🍴 1) - gRPC transport for MCP servers
gogolanggrpcmcpservergo install rustycl0ck/mcp-grpc-transport@latest - mcp-stdio-to-sse-wrapper 🐳 🏠 (⭐ 2) - A wrapper to convert MCP STDIO servers to SSE
dockerfilemcpservergit clone https://github.com/Macmee/mcp-stdio-to-sse-wrapper - s3-mcp 🐍 🏠 (⭐ 2, 🍴 1, 🐛 1) - AWS S3 Model Context Protocol Server (MCP) To Fully Provision And Control Cloud Infra
gomcpserverpythonawsgo install diabloneo/s3-mcp@latest - mcp-email-docker 📘 🏠 (⭐ 2, 🍴 1) - 基于Typescript实现的Notify MCP Server,支持Docker一键部署到remote|local
typescriptdockeremailmcp-servermcpnpm install fantasy-lotus/mcp_email_ts - ufo-mcp-server 🐹 🏠 (⭐ 2) - MCP server for Dynatrace UFO
gomcpservergo install rhoegg/ufo-mcp-server@latest - mcp-fetch 🐹 🏠 (⭐ 2) - Go-based
gogo install cnosuke/mcp-fetch@latest - email-mcp 🐹 🏠 (⭐ 2) - A lightweight Model Context Protocol (MCP) server that enables AI to automatically send mass emails via SMTP for you.
gomcpserveraigo install Allenxuxu/email-mcp@latest - Google-Calendar-MCP-Server 📘 🏠 (⭐ 2) - MCP server for Google Calendar integration with AI assistants
typescriptagentai-assistantcalendadockernpm install daemonX10/Google-Calendar-MCP-Server - mcp-go-sse-server 🐹 🏠 (⭐ 2, 🐛 3) - A simple MCP server exposed via SSE with examples tools, resources and prompts
gomcpservergo install davidferlay/mcp-go-sse-server@latest - mcp-server-admintasks 🐹 🏠 (⭐ 2, 🍴 1) - MCP Server implementing various tools to execute admin tasks on a Linux system.
gomcpservergo install mge1512/mcp-server-admintasks@latest - openrouter-websearch-mcp 🐹 🏠 (⭐ 2, 🍴 1, 🐛 1) - An MCP server providing websearch using openrouter :online
gomcpserverwebgo install ChristianSch/openrouter-websearch-mcp@latest - kb-cloud-mcp-server 🐹 🏠 (⭐ 2, 🐛 4) - MCP server for KubeBlocks Cloud
gomcpservergo install apecloud/kb-cloud-mcp-server@latest - Marshal-MCP 🐹 🏠 (⭐ 2, 🍴 1, 🐛 1) - Mcp services by marshal
goeasmmcp-securitymcp-servervulnscannergo install XTeam-Wing/Marshal-MCP@latest - outlookmcp 🐹 🏠 📇 (⭐ 2) - MCP server for accessing Outlook Calendar events via API
gomcpserverapigo install kgatilin/outlookmcp@latest - istio-mcp 🐹 🏠 (⭐ 2, 🍴 2, 🐛 1) - A tool library that encapsulates istio mcp client/server
gomcpservergo install slime-io/istio-mcp@latest - negokaz_excel-mcp-server 🐹 🏠 (⭐ 1) - Mirror of https://github.com/negokaz/excel-mcp-server
gomcpserverhttpgo install MCP-Mirror/negokaz_excel-mcp-server@latest - ObsiMCP 🐹 🏠 (⭐ 1) - A obsidian server for the model context protocol (MCP)
gomcpservergo install IAMLEIzZ/ObsiMCP@latest - osmmcp 🐹 🏠 (⭐ 1, 🍴 1) - OpenStreetMap MCP server providing precision geospatial tools for LLMs via Model Context Protocol. Features geocoding, routing, nearby places, neighborhood analysis, EV charging stations, and more.
goanthropic-claudeev-charginggeocodinggeospatialgo install NERVsystems/osmmcp@latest - urfave-cli-mcp 🐹 🏠 (⭐ 1) - Expose https://github.com/urfave/cli app as an MCP server
gogolang-librarymodel-context-protocolurfave-climcpgo install thepwagner/urfave-cli-mcp@latest - arduino-mcp-server 🐹 🏠 (⭐ 1) - An arduino mcp server written in go
gomcpservergo install dido18/arduino-mcp-server@latest - aws-serverless-mcp 📜 🏠 (⭐ 1) - MCP Server implementation with AWS Serverless services.
javascriptawsaws-apigatewayaws-lambdamcp-servernpm install daaru00/aws-serverless-mcp - duckdb-mcp 🐹 🏠 (⭐ 1, 🐛 3) - MCP Server for DuckDB
gomcpservergo install richardwooding/duckdb-mcp@latest - fs-mcp 🐹 🏠 (⭐ 1) - A Go MCP server enabling file system interactions.
gomcpservergo install lealre/fs-mcp@latest - github-mcp-custom 🐹 🏠 (⭐ 1, 🍴 1, 🐛 2) - Cross-platform NPX-wrappable GitHub MCP Server for Windows, Linux, and macOS. No Docker required!
gomcpserverdockergo install idletoaster/github-mcp-custom@latest - k8s-mcp-server 🐹 🏠 (⭐ 1, 🍴 1) - MCP server for all of your needs in k8s ☸️
gomcpservergo install MayukhSobo/k8s-mcp-server@latest - mcp-go 🐹 🏠 (⭐ 1) - A library for establishing MCP server.
gomcpservergo install OkutaniDaichi0106/mcp-go@latest - mcp-openapi-explorer 🐹 🏠 📇 (⭐ 1) - MCP server for interacting with open api spec files
gomcpserverapigo install KrypticIO/mcp-openapi-explorer@latest - mcp-uuid-go 🐹 🏠 (⭐ 1) - An MCP server which responses UUID value.
gomcpservergo install manaty226/mcp-uuid-go@latest - mcp-server-email 🐹 🏠 (⭐ 1, 🍴 1) - mcp-server demo about send email by golang
gomcpserveraigo install CocaineCong/mcp-server-email@latest - mcphost-server 🐹 🏠 (⭐ 1) - MCP server for ollama, openai, and anthropic bridging
gomcpserveraigo install JinsonWu/mcphost-server@latest - mark3labs_mcp-filesystem-server 🐹 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/mark3labs/mcp-filesystem-server
gomcpserverhttpgo install MCP-Mirror/mark3labs_mcp-filesystem-server@latest - MasterGO-McpServer 🏠 (⭐ 1, 🍴 1) - 基于MasterGO构建MCP服务
mcpgogit clone https://github.com/ClyingDeng/MasterGO-McpServer - mcp-command-exec 🐹 🏠 (⭐ 1) - Go-based
gogo install cnosuke/mcp-command-exec@latest - mcp-gateway2 🐹 🏠 📇 (⭐ 1, 🍴 1) - MCP-Gateway is a service that provides MCP Server unified management capabilities, helping AI Agents quickly connect to various data sources. Through MCP Server, AI Agents can easily access databases, REST APIs, and other external services without worrying about specific connection details.
gomcpserverapidatabasego install adcwa/mcp-gateway2@latest - mymcp 🐹 🏠 (⭐ 1) - Your MCP server hosting service
gomcpservergo install tk103331/mymcp@latest - stablemcp 🐹 🏠 (⭐ 1, 🐛 5) - Simple MCP Server to generate iamges using Stable Diffusion
gomcpservergo install mkm29/stablemcp@latest - mcpcalculator 🐹 🏠 (⭐ 1, 🍴 1) - A Go implementation of MCP server with calculator and greeting functionality
gomcpservergo install akhidasTech/mcpcalculator@latest - omnillm-mcp 🏠 (⭐ 1, 🍴 1) - OmniLLM: A Model Context Protocol (MCP) server that enables Claude to access and integrate responses from multiple LLMs including ChatGPT, Azure OpenAI, and Google Gemini, creating a unified AI knowledge hub.
mcpserveraillmazuregit clone https://github.com/sabpap/omnillm-mcp - go-mcp-server-service 🐹 🏠 (⭐ 1, 🍴 2) - A JSON-RPC 2.0 compliant server implementing the Model Context Protocol (MCP) for note management (as an example)
gomcpserverjsongo install AndrewDonelson/go-mcp-server-service@latest - AvailMCP 🐹 🏠 - An MCP server to interact with Avail DA
gomcpserveraigo install dhananjaypai08/AvailMCP@latest - crypto-price-tracker-mcp 🐍 🏠 📇 - This repository contains files for Crypto Price Tracker MCP Server using Coingecko API.
pythondockergoogle-sheets-apimcp-servermcppip install git+https://github.com/RoystonDAlmeida/crypto-price-tracker-mcp - 4devs-mcp 🐹 🏠 - A repository with an implementation of MCP server for https://www.4devs.com.br tools using golang for study
gomcpserverhttpgo install renanmedina/4devs-mcp@latest - agents-mcp-demo 🐍 🏠 - A template for how to build an MCP server
pythondockermcpmcp-serverpostgresqlpip install git+https://github.com/Alexander-Nestor-Bergmann/agents-mcp-demo - AML-watcher-MCP-Server 🏠 📇 - MCP Server for the AML Watcher API, enabling AML screening for individuals, companies, organizations, crypto wallets, vessels, and aircraft across various categories such as Sanctions, PEP Level 1, PEP Level 2, PEP Level 3, PEP Level 4, SIP, SIE, etc.
mcpserverapiaimlgit clone https://github.com/Tech-AML/AML-watcher-MCP-Server - bitcoin-mcp 🐹 🏠 - A Bitcoin MCP Server
gomcpservergo install moncho/bitcoin-mcp@latest - AndrewDonelson_go-mcp-server-service 🐹 🏠 - Mirror of https://github.com/AndrewDonelson/go-mcp-server-service
gomcpserverhttpgo install MCP-Mirror/AndrewDonelson_go-mcp-server-service@latest - Anthropic-MCP-Server 🏠 - Server for Posting Tweets from X (Twitter) Using a Google Sheet as a source
servergogit clone https://github.com/CoderSoumya007/Anthropic-MCP-Server - application-insights-mcp 🏠 - Azure Application Insights MCP Server
mcpserverazuregit clone https://github.com/furoTmark/application-insights-mcp - aws-avp-mcp 🏠 - An MCP server which connects with Amazon Verified Permissions.
mcpservergit clone https://github.com/manaty226/aws-avp-mcp - dcr-mcp 🐹 🏠 - DCR MCP Server - An MCP server implementation using mcp-go
gomcpservergo install cybersiddhu/dcr-mcp@latest - GAnalytics-MCP-server 🏠 - Google Analytics MCP server for accessing analytics data through tools and resources
mcpservergogit clone https://github.com/Kirill812/GAnalytics-MCP-server - google-calendar-mcp-server 🏠 - GoogleカレンダーのためのMCPサーバーです。
mcpgogit clone https://github.com/asakaicode/google-calendar-mcp-server - linkerd2-mcp 🐹 🏠 📇 - An MCP server over the Linkerd2 Proxy API
gomcpserverapigo install eli-nomasec/linkerd2-mcp@latest - gophermcp 🐹 🏠 - An MCP server to help LLM:s write better Go code
gomcpserverllmgo install njern/gophermcp@latest - google-workspace-mcp 🐹 🏠 - mcp server for google workspace
gomcpservergo install orvice/google-workspace-mcp@latest - harvester-mcp-server 🐹 🏠 - Model Context Protocol (MCP) server for Harvester HCI
gogolangharvester-hcikubernetesmcpgo install starbops/harvester-mcp-server@latest - hello-gomcp 🐹 🏠 - The minimal Golang MCP server implementation with mcp-go.
gomcpservergo install bioerrorlog/hello-gomcp@latest - kr-mcp-server 🐹 🏠 - 这是一个基于 [MCP-Go] 框架开发的MCP 服务的项目,提供了一系列工具和功能。
gomcpgo install kirikoko1213/kr-mcp-server@latest - isaacphi_mcp-language-server 🐹 🏠 - Mirror of https://github.com/isaacphi/mcp-language-server
gomcpserverhttpgo install MCP-Mirror/isaacphi_mcp-language-server@latest - gotoolkits_mcp-difyworkflow-server 🐹 🏠 - Mirror of https://github.com/gotoolkits/mcp-difyworkflow-server
gomcpserverhttpgo install MCP-Mirror/gotoolkits_mcp-difyworkflow-server@latest - kmcp 🏠 - 🚀 A MCP Server for Kubernetes.
kubernetesmcpservergit clone https://github.com/yshngg/kmcp - mcp 🐹 🏠 - mcp server example (Go-based)
gomcpservergo install dchf12/mcp@latest - mcp-acronym-lookup 🐹 🏠 - A lightweight, configuration-driven MCP server that ingests a CSV of acronyms and initialisms to expose a lookup tool for their full meanings and descriptions.
gomcp-servermcpservergo install UnitVectorY-Labs/mcp-acronym-lookup@latest - mcp-calculator-server 🐹 🏠 - A Model Context Protocol (MCP) server that provides calculator functionality for MCP clients.
gomcp-calculator-servermcp-clientmcp-gomcp-servergo install yinebebt/mcp-calculator-server@latest - github-mcp-go 🐹 🏠 - Model Context Protocol (MCP) server for GitHub based on mcp-go
gomcpservergo install geropl/github-mcp-go@latest - go_mcp_server_github_api 🐹 🏠 📇 - MCP server for working with GitHub repository via API.
gogithubgithub-apigithub-repositorygolanggo install hightemp/go_mcp_server_github_api@latest - go_mcp_server_searxng 🐹 🏠 - A Model Context Protocol (MCP) server for integrating with SearXNG metasearch engine.
gogolangmcpmcp-serversearxnggo install hightemp/go_mcp_server_searxng@latest - go-mcp 🐹 🏠 - Make your own MCP servers with Golang
gomcpservergo install virgoC0der/go-mcp@latest - mcp 🐹 🏠 - A GO based MCP server for use with AmazonQ or any other MCP capable LLM Agent
gomcpserverllmgo install richard-senior/mcp@latest - mcp-dutch-postal-codes 🐹 🏠 - MCP server for querying Dutch postal codes
gomcpservergo install dstotijn/mcp-dutch-postal-codes@latest - go-sui-mcp 🐹 🏠 📇 - A Go-based management control plane server for Sui blockchain, providing REST APIs to interact with local Sui client commands.
gogolangmcpmcp-serversuigo install hawkli-1994/go-sui-mcp@latest - mcp 🐹 🏠 - mcp server (Go-based)
gomcpservergo install celsoRodrigues/mcp@latest - mcp-atlassian-server 🐹 🏠 - Go port of sooperset/mcp-atlassian
gomcpgo install bdwyertech/mcp-atlassian-server@latest - bnm-mcp 🐹 🏠 📇 - This is a MCP (Model Context Provider) server for BNM (Bank Negara Malaysia) OpenAPI. It only covers a subset of the BNM API.
gomcpserverapigo install hongster/bnm-mcp@latest - mcp 🐹 🏠 - mcp server for me (Go-based)
gomcpservergo install candy12t/mcp@latest - docker-container-mcp 🐹 🏠 - An MCP (Model Context Protocol) server to create docker containers.
gomcpserveraidockergo install emresahna/docker-container-mcp@latest - github-agentic-chat-mcp 🐹 🏠 - An MCP server implementation for GitHub agentic chat using Go
gomcpservergo install akhidasTech/github-agentic-chat-mcp@latest - github-mcp-server-sse 🐹 🏠 - GitHub MCP Server (SSE)
gomcpservergo install yamagai/github-mcp-server-sse@latest - go-mcp 🐹 🏠 - Golang Model Context Protocol (MCP) server that allows to call 'go list' and 'go doc' commands to get information about a package
gomcpservergo install wricardo/go-mcp@latest - mcp 🐹 🏠 - Golang MCP Server
gomcpservergo install vishymakthal/mcp@latest - mcp_server 🏠 - Go mcp server
mcpservergogit clone https://github.com/HyperLiar/mcp_server - mcp_servers 🏠 - DevOps MCP Servers
mcpservergit clone https://github.com/derisk-ai/mcp_servers - mcp-go-github 🐹 🏠 - Go-based MCP server that connects GitHub to Claude Desktop, enabling direct repository operations from Claude's interface.
goclaude-desktopgithub-mcp-servermcpservergo install scopweb/github-go-server-mcp@latest - mcp-godo 🐹 🏠 - Simple mcp server for handling todo lists, for sake of practice and education
gomcpservergo install lvturner/mcp-godo@latest - mcp-google-calendar 🏠 - MCP Server for Google Calendar
mcpservergogit clone https://github.com/bpirvu/mcp-google-calendar - mcp-k8s-sse-server 🐹 🏠 - mcp tools for k8s resources management using cursor agent
gomcpgo install beastpu/mcp-k8s-sse-server@latest - mcp-greeting 🐹 🏠 - Go-based
gogo install cnosuke/mcp-greeting@latest - mcp-haystack-google-maps 🏠 - Demo for using MCP Servers in a Haystack Pipeline
jupyter notebookmcpservergit clone https://github.com/oryx1729/mcp-haystack-google-maps - mcp-search 🐹 🏠 - Go-based
gogo install cnosuke/mcp-search@latest - mcp-server-moke-gongwen 🏠 - MokeGongWen is an AI-powered writing tool for government and corporate entities, supporting 15 state-mandated document types. Features format templates, compliance verification, contextual requirement analysis, and style optimization to ensure precise, regulation-aligned official documentation.
aigodocumentationgit clone https://github.com/gzfutureai/mcp-server-moke-gongwen - mcp-trino 🐹 🏠 - A high-performance Model Context Protocol (MCP) server for Trino implemented in Go. mcp, mcp-server, trino
gomcpservergo install heavenlycolle/mcp-trino@latest - mcp-server-scanner 🐹 🏠 - detect exposed mcp servers over the internet and enumerate their tools
gomcpservergo install m-q-t/mcp-server-scanner@latest - mcp-server-test 🐹 🏠 - MCP Server Test Repository
gomcpservergo install rainemng/mcp-server-test@latest - mcp-servers 🏠 - Docker 기반 MCP 서버
mcpdockergit clone https://github.com/krdn/mcp-servers - morelogin-mcp-golang 🐹 🏠 - mcp server by golang
gomcpservergo install MoreLoginBrowser/morelogin-mcp-golang@latest - myshoes-mcp-server 🐹 🏠 - The myshoes MCP Server is Model Context Protocol (MCP) compliant server for the whywaita/myshoes.
gomyshoesmcpserveraigo install whywaita/myshoes-mcp-server@latest - mcp-dev-on-azure-lab 🏠 - how to develop mcp server and debugging from local to azure
jupyter notebookmcpserverazuregit clone https://github.com/huqianghui/mcp-dev-on-azure-lab - oas-mcp 🐹 🏠 📇 - openapi to mcp server
gomcpserverapigo install nonchan7720/oas-mcp@latest - mcp-bigquery-server 🐹 🏠 - MCP BigQuery Server is a server that allows you to query BigQuery tables using MCP.
gomcpservergo install monochromegane/mcp-bigquery-server@latest - mcp-developer-overheid-api-register 🐹 🏠 📇 - Model Context Protocol (MCP) server for the Developer Overheid API.
gomcpserverapigo install dstotijn/mcp-developer-overheid-api-register@latest - MCP-WASMPython-Runner 🐍 🏠 - A safe MCP Python Runner with Docker Image
pythoncode-runnercode-runner-imagedockerdocker-composepip install git+https://github.com/OrbitZore/MCP-WASMPython-Runner - mcp-wsdot 🐹 🏠 📇 - mcp server for the wsdot api
gomcpserverapigo install michaelpeterswa/mcp-wsdot@latest - omcp 🐹 🏠 - (WIP)A tool to deploy mcp server, like ollama
gomcpmcp-serverservergo install jyz0309/omcp@latest - portkey-mcp-server 🐹 🏠 - MCP Server for Portkey
gomcpservergo install rvoh-emccaleb/portkey-mcp-server@latest - sui-butler-backend 📘 🏠 - Serverless-based MCP server implementation for Sui blockchain using zkLogin
typescriptamplifyawsclaudemcpgit clone https://github.com/tamago-labs/sui-serverless-mcp - sai-mcp 🐹 🏠 - Sai Mcp Server (Go-based)
gomcpserveraigo install example42/sai-mcp@latest - sample-mcp 🐹 🏠 - Sample Code to Build MCP Server using golang
gomcpservergo install jasoet/sample-mcp@latest - skopeo-mcp-server 🐹 🏠 - MCP server that runs skopeo
gomcpservergo install Prashanth684/skopeo-mcp-server@latest - yokai-mcp-template 🐹 🏠 - MCP server template based on the Yokai Go framework.
godependency-injectionframeworkgolangmcpgo install ankorstore/yokai-mcp-template@latest - manusa_kubernetes-mcp-server 🐹 🏠 - Mirror of https://github.com/manusa/kubernetes-mcp-server
gomcpserverhttpkubernetesgo install MCP-Mirror/manusa_kubernetes-mcp-server@latest - script-mcp 🐹 🏠 - MCP server to for running script
gomcpservergo install nguyenvanduocit/script-mcp@latest - simple-mcp-server-in-go 🏠 - A simple MCP server built using Go for concurrency
mcpservergogit clone https://github.com/mahimairaja/simple-mcp-server-in-go - temporal-mcp 🐹 🏠 - Temporal.io Model Context Protocol server to list and describe workflows.
goservergo install wricardo/temporal-mcp@latest - test_mcp_server 🐹 🏠 - MCP server for test (Go-based)
gomcpservergo install heat1024/test_mcp_server@latest - macrat_mcp-ayd-server 🐹 🏠 - Mirror of https://github.com/macrat/mcp-ayd-server
gomcpserverhttpgo install MCP-Mirror/macrat_mcp-ayd-server@latest - macrat_mcp-server-kintone 🐹 🏠 - Mirror of https://github.com/macrat/mcp-server-kintone
gomcpserverhttpgo install MCP-Mirror/macrat_mcp-server-kintone@latest - mcp-ayd-server 🐹 🏠 - MCP (Model Context Protocol) Server for Ayd status monitoring service.
goaydmcpmodelcontextprotocolservergo install macrat/mcp-ayd-server@latest - metoro-io_metoro-mcp-server 🐹 🏠 - Mirror of https://github.com/metoro-io/metoro-mcp-server
gomcpserverhttpgo install MCP-Mirror/metoro-io_metoro-mcp-server@latest - Vercel - Access logs, search docs, and manage projects and deployments
deploymenthostingwebhttp
💬 Communication
- mcp-atlassian 🐍 🏠 (⭐ 3k, 🍴 570, 🐛 106) - MCP server for Atlassian tools (Confluence, Jira)
httpgitgithubpythonatlassianpip install git+https://github.com/sooperset/mcp-atlassian - slack-mcp-server 🐹 🏠 (⭐ 614, 🍴 80, 🐛 7) - The most powerful MCP Slack Server with no permission requirements, Apps support, multiple transports Stdio and SSE, DMs, Group DMs and smart history fetch logic.
httpgitgithubslackgogo install korotovsky/slack-mcp-server@latest - line-bot-mcp-server 📘 🏠 📇 (⭐ 445, 🍴 72, 🐛 13) - MCP server that integrates the LINE Messaging API to connect an AI Agent to the LINE Official Account.
apihttpaigitgithubnpm install line/line-bot-mcp-server - linear-mcp-server 📜 🏠 📇 (⭐ 327, 🍴 58, 🐛 18) - A server that integrates Linear's project management system with the Model Context Protocol (MCP) to allow LLMs to interact with Linear.
httpgitgithubjavascriptanthropicnpm install jerhadf/linear-mcp-server - mcp-server-email 🐍 🏠 (⭐ 52, 🍴 11, 🐛 9) - 一个基于 MCP (Model Context Protocol) 的邮件服务,支持 LLM 发送带附件的电子邮件及在指定目录中搜索文件。提供安全的 SMTP 传输、多收件人支持和附件模式匹配搜索功能,适用于 Gmail、Outlook、Yahoo、QQ 邮箱和网易 126 邮箱等主流邮箱服务。
pythonemailmcpmcp-clientmcp-serverpip install git+https://github.com/Shy2593666979/mcp-server-email - ntfy-me-mcp 📜 🏠 (⭐ 38, 🍴 9, 🐛 1) - An ntfy MCP server for sending/fetching ntfy notifications to any/self-hosted ntfy.sh server from AI Agents 📤 (supports secure token auth & more - use with npx or docker!)
authhttpdockeraigitnpm install gitmotion/ntfy-me-mcp - coda-mcp 📘 🏠 (⭐ 26, 🍴 14) - MCP Server for Coda (TypeScript-based)
httpgitgithubtypescriptmcpnpm install orellazri/coda-mcp - authenticator_mcp 📘 🏠 (⭐ 21, 🍴 7) - A secure MCP (Model Context Protocol) server that enables AI agents to interact with the Authenticator App.
authhttpaigitgithubnpm install firstorderai/authenticator_mcp - tituslhy/sturdy-octo-fortnight 🐍 🏠 (⭐ 18, 🍴 4) - Facilitates seamless integration with Atlassian's Confluence and Jira through a robust MCP server, enabling efficient content management and issue tracking.
httpmlgitgithub - Inbox-MCP 📜 🏠 (⭐ 15, 🍴 5, 🐛 3) - A Model Context Protocol (MCP) server for email integration via Nylas. Enables AI assistants to effortlessly batch-triage, organize, and automate email through natural language interactions.
javascriptemailgmailinboxmcpnpm install darinkishore/Inbox-MCP - telnyx-mcp-server 🐍 🏠 ☁️ 📇 (⭐ 15, 🍴 2, 🐛 3) - Official Telnyx Local Model Context Protocol (MCP) Server that enables interaction with powerful telephony, messaging, and AI assistant APIs. This server allows MCP clients like Claude Desktop, Cursor, Windsurf, OpenAI Agents and others to manage phone numbers, send messages, make calls, and create AI assistants.
apihttpaigitgithubpip install git+https://github.com/team-telnyx/telnyx-mcp-server - biomcp-examples 🏠 (⭐ 14) - Example chats from running BioMCP for demonstrations
mcpgit clone https://github.com/genomoncology/biomcp-examples - multi-chat-mcp-server 🐍 🏠 (⭐ 12, 🍴 4, 🐛 1) - Google Chat MCP server that lets AI assistants like Claude and Cursor participate directly in team conversations - search messages, help teammates, share files, and coordinate across chat platforms.
pythonclaude-aicommunicationcursor-aiextendable-frameworkpip install git+https://github.com/siva010928/multi-chat-mcp-server - zammad-mcp-go 🐹 🏠 📇 (⭐ 8, 🍴 3, 🐛 2) - MCP Server for Zammad API
apihttpgitgithubgogo install arush15june/zammad-mcp-go@latest - discord-notification-mcp 📘 🏠 (⭐ 6) - Simple MCP server to send you notifications on discord
typescriptclaude-codecloudflare-agentsdiscordmcpnpm install kstonekuan/discord-notification-mcp - mcp-status-observer 📘 🏠 (⭐ 5, 🍴 5, 🐛 1) - Model Context Protocol server for monitoring Operational Status of major digital platforms in Claude Desktop.
httpgitgithubmonitoringtypescriptnpm install imprvhub/mcp-status-observer - webhook-tester-mcp 🐍 🏠 📇 (⭐ 5, 🍴 4, 🐛 3) - FastMCP server for managing and testing webhooks via webhook-test.com API
webhttpgitgithubpythonpip install git+https://github.com/alimo7amed93/webhook-tester-mcp - wechaty-mcp-sse 📘 🏠 (⭐ 4, 🐛 1) - 一个Wechaty的MCP封装,可以在此模板基础上继续添加自己的功能
httpmlgitgithubtypescriptnpm install atorber/wechaty-mcp-sse - WA-MCP 📘 🏠 (⭐ 3, 🐛 1) - MCP client for Whatsapp
webhttpgitgithubtypescriptnpm install operation-hp/WA-MCP - tlon-mcp-server 📜 🏠 (⭐ 3) - An MCP (Model Context Protocol) server that provides tools for interacting with Tlon agents.
httpgitgithubjavascriptmcpnpm install jamesacklin/tlon-mcp-server - fast-mcp-telegram 🐍 🏠 📇 (⭐ 2, 🍴 1) - AI-powered Telegram automation via MCP protocol. Search messages, send automated replies, manage contacts - enable your AI assistant with full Telegram API access through FastMCP.
apihttpmlgitgithubpip install git+https://github.com/leshchenko1979/tg_mcp - ERAV3-GMAILMCP 🐍 🏠 📇 (⭐ 2) - Python-based
apihttpaimlgitpip install git+https://github.com/sudhakarmlal/ERAV3-GMAILMCP - sipgateio-mcp 📜 🏠 📇 (⭐ 2, 🍴 1, 🐛 2) - MCP Server for the sipgate API
httpaigitgithubjavascriptnpm install BlackMac/sipgateio-mcp - mcp_email_reader 🐍 🏠 (⭐ 1) - Model Context Protocol (MCP) server to connect to an email server and to read emails
httpaigitgithubemailpip install git+https://github.com/karateboss/mcp_email_reader - Discord-webhook-MCP 📘 🏠 (⭐ 1) - TypeScript-based
webhttpgitgithubdiscordnpm install futuyu/Discord-webhook-MCP - dooray-mcp 🐍 🏠 📇 (⭐ 1, 🍴 1, 🐛 2) - Dooray API 활용한 MCP 서버
apihttpgitgithubpythonpip install git+https://github.com/mskim8717/dooray-mcp - spring-ai-mcp 📘 🏠 (⭐ 1) - AI-powered chat assistant for banking microservices using Spring AI and Model Context Protocol (MCP). Interact with your microservices through natural language chat, view accounts, personal details, and transactions—all in one unified interface.
typescriptchatmcp-servermodel-context-protocolspring-ainpm install rifatcakir/spring-ai-mcp - hiworks-mcp 📜 🏠 (⭐ 1, 🍴 1) - Node.js-based
httpaigitgithubemailnpm install beylessai/hiworks-mcp - webhook-mcp 📜 🏠 (⭐ 1, 🍴 2) - A Model Context Protocol (MCP) server that sends webhook notifications when called.
webhttpgitgithubjavascriptnpm install noobnooc/webhook-mcp - alertmcp 🐍 🏠 (⭐ 1) - Python-based
httpaigitgithubpythonpip install git+https://github.com/kousunh/alertmcp - plivo-mcp-server 🐍 🏠 📇 (⭐ 1) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/varunwahi-plivo/plivo-mcp-server - whatsapp-mcp 🐍 🏠 (⭐ 1) - Python-based
httpmlgitgithubpythonpip install git+https://github.com/Escorza07/whatsapp-mcp - mcp-chat-demo 🏠 (⭐ 1, 🍴 1, 🐛 1) - A sample chat application demonstrating integration with Model Context Protocol (MCP) servers
mcpservergit clone https://github.com/ehartye/mcp-chat-demo - Carbon Voice⭐ 🏠 - MCP Server that connects AI Agents to Carbon Voice. Create, manage, and interact with voice messages, conversations, direct messages, folders, voice memos, AI actions and more in Carbon Voice.
httpaigitgithub - agentmail-toolkit/mcp 🐍 💬 🏠 - An MCP server to create inboxes on the fly to send, receive, and take actions on email. We aren't AI agents for email, but email for AI Agents.
httpaigitgithubemail - areweai/tsgram-mcp 🏠 - TSgram: Telegram + Claude with local workspace access on your phone in typescript. Read, write, and vibe code on the go!
localhttpaigitgithub - Danielpeter-99/calcom-mcp 🐍 🏠 🏠 - MCP server for Calcom. Manage event types, create bookings, and access Cal.com scheduling data through LLMs.
httpllmgitgithub - findymail-mcp-server 📜 🏠 📇 - findymail-mcp-server
apihttpaigitgithubnpm install Meerkats-Ai/findymail-mcp-server - gerkensm/callcenter.js-mcp 📇 ☁️ 🏠 📇 - An MCP server to make phone calls using VoIP/SIP and OpenAI's Realtime API and observe the transcript.
apihttpaiopenaigit - gotoolkits/wecombot 🚀 ☁️ 🏠 - An MCP server application that sends various types of messages to the WeCom group robot.
httpgitgithub - i-am-bee/acp-mcp 🐍 💬 🏠 - An MCP server acting as an adapter into the ACP ecosystem. Seamlessly exposes ACP agents to MCP clients, bridging the communication gap between the two protocols.
httpmlgitgithub - Infobip/mcp 🎖️ ☁️ 🏠 - Official Infobip MCP server for integrating Infobip global cloud communication platform. It equips AI agents with communication superpowers, allowing them to send and receive SMS and RCS messages, interact with WhatsApp and Viber, automate communication workflows, and manage customer data, all in a production-ready environment.
httpaigitgithub - khan2a/telephony-mcp-server 🐍 💬 🏠 📇 - MCP Telephony server for automating voice calls with Speech-to-Text and Speech Recognition to summarize call conversations. Send and receive SMS, detect voicemail, and integrate with Vonage APIs for advanced telephony workflows.
apihttpaigitgithub - mcp-server-whatsapp-message 🐍 🏠 📇 - MCP to send message using Meta whatsapp API
apihttpgitgithubpythonpip install git+https://github.com/deuslirio/mcp-server-whatsapp-message - mcp-gmail-extension 📜 🏠 - Node.js-based
authhttpaimlgitnpm install Escorza07/mcp-gmail-extension - mcp-http-proxy 🏠 - An HTTP/SSE proxy server for Model Context Protocol (MCP) applications using stdio. Supports raw JSON-RPC commands via HTTP and implements direct stdio communication without an MCP SDK.
mcpserverhttpjsongit clone https://github.com/spontaneous-order/mcp-http-proxy - mcp-jira-cloud-v2 📘 🏠 - MCP Server using Jira Client v2 to handle Jira Issues
httpgitgithubtypescriptmcpnpm install scho-to/mcp-jira-cloud-v2 - mcp-server-monday-qi 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/YajieQi123/mcp-server-monday-qi - Napier-mcp 🐹 🏠 📇 - mcp for whatsapp (Go-based)
apiweblocalhttpaigo install va99/Napier-mcp@latest - OverQuotaAI/chatterboxio-mcp-server 📇 ☁️ 🏠 - MCP server implementation for ChatterBox.io, enabling AI agents to send bots to online meetings (Zoom, Google Meet) and obtain transcripts and recordings.
httpaigitgithub - whatsapp-mcp-n8n 🐍 🏠 📇 - Python-based
apiwebhttpmlgitpip install git+https://github.com/TharanaBope/whatsapp-mcp-n8n - wyattjoh/imessage-mcp 📇 🏠 🍎 🏠 - A Model Context Protocol server for reading iMessage data from macOS.
httpgitgithub - YCloud-Developers/ycloud-whatsapp-mcp-server 📇 🏠 🏠 - MCP server for WhatsApp Business Platform by YCloud.
httpgitgithub - zendesk-mcp-server-kon 🐍 🏠 - 이 프로젝트는 reminia/zendesk-mcp-server(https://github.com/reminia/zendesk-mcp-server) 를 포크하여 추가 기능과 개선사항을 추가한 버전입니다.
httpgitgithubpythonmcppip install git+https://github.com/nicekon/zendesk-mcp-server-kon - ztxtxwd/open-feishu-mcp-server 📇 ☁️ 🏠 🏠 ☁️ - A Model Context Protocol (MCP) server with built-in Feishu OAuth authentication, supporting remote connections and providing comprehensive Feishu document management tools including block creation, content updates, and advanced features.
remoteauthoauthhttpgit
📁 File Management
- mcp-filesystem-server 🐹 🏠 (⭐ 504, 🍴 72, 🐛 16) - Go server implementing Model Context Protocol (MCP) for filesystem operations.
filelocalhttpgitgithubgo install mark3labs/mcp-filesystem-server@latest - mcp-everything-search 🐍 🏠 (⭐ 236, 🍴 27, 🐛 12) - Python-based
filehttpgitgithubpythonpip install git+https://github.com/mamertofabian/mcp-everything-search - fast-filesystem-mcp 📘 🏠 (⭐ 21, 🍴 10, 🐛 1) - Advanced filesystem operations with large file handling capabilities and Claude-optimized features. Provides fast file reading/writing, sequential reading for large files, directory operations, file search, and streaming writes with backup & recovery.
filehttpgitgithub - Windows-MCP-Server-Installation-Verification-Guide 🏠 (⭐ 20, 🍴 5, 🐛 1) - Windows MCP server setup differs from Mac by requiring absolute file paths and explicit node.exe references instead of npx commands. The installation requires verifying npm and installing packages globally to the AppData\Roaming\npm\node_modules directory. Running servers needs complete paths for both node.exe and the server's index.js file.
mcpservernodegit clone https://github.com/trevorwilkerson/Windows-MCP-Server-Installation-Verification-Guide - MCPJavaFileSystem ☕ 🏠 (⭐ 20, 🍴 8, 🐛 1) - Java-based
webfilelocalhttpllmgit clone https://github.com/stephanj/MCPJavaFileSystem - mcp-storage-server 📘 🏠 (⭐ 12, 🍴 6, 🐛 12) - Storacha MCP storage server - self-sovereign data for your AI applications.
typescriptdecentralized-storagefilecoinipfsmcp-servernpm install storacha/mcp-storage-server - mcp-ipfs 📘 🏠 (⭐ 11, 🍴 11, 🐛 3) - 🪐 MCP IPFS Server (TypeScript-based)
httpmlgitgithubtypescriptnpm install alexbakers/mcp-ipfs - MCP-SynoLink 📜 🏠 (⭐ 11, 🍴 7, 🐛 2) - MCP server for Synology NAS file operations
filehttpaigitgithubnpm install Do-Boo/MCP-SynoLink - Filesystem-MCP-Server-SSE 📜 🏠 (⭐ 10, 🍴 2, 🐛 1) - The SSE version of the MCP service is modified from the Filesystem MCP server
filehttpgitgithubjavascriptnpm install ysthink/Filesystem-MCP-Server-SSE - MCP-Backup-Server 📜 🏠 (⭐ 8, 🍴 4) - A Model Context Protocol (MCP) server implementation that provides file backup and restoration capabilities
fileresthttpaigitnpm install hexitex/MCP-Backup-Server - mcp-server-wsl-filesystem 📜 🏠 (⭐ 8, 🍴 4) - filesystem MCP server for accessing WSL distributions from Windows
webfilehttpmlgitnpm install webconsulting/mcp-server-wsl-filesystem - gabrielmaialva33/mcp-filesystem 📘 🏠 (⭐ 7, 🍴 1, 🐛 10) - Provides secure filesystem access for AI models with strict path validation and predefined directory constraints.
filehttpaigitgithub - oss-mcp 📘 🏠 (⭐ 6, 🍴 2, 🐛 2) - 阿里云OSSMCP服务器,用于将文件上传到阿里云OSS,支持多配置和目录指定
filehttpmlgitgithubnpm install 1yhy/oss-mcp - filesystem-mcp 📘 🏠 (⭐ 6, 🍴 2, 🐛 15) - Node.js Model Context Protocol (MCP) server providing secure, relative filesystem access for AI agents like Cline/Claude.
filehttpaigitgithubnpm install sylphlab/filesystem-mcp - filesystem-mcp 📘 🏠 (⭐ 6, 🍴 2, 🐛 15) - Node.js Model Context Protocol (MCP) server providing secure, relative filesystem access for AI agents like Cline/Claude.
mcptypescriptai-agentclaude-aiclinegit clone https://github.com/QRRRRRRH/filesystem-mcp - mcp-file-server 🐍 🏠 (⭐ 5, 🍴 1) - MCP server for reading and writing local files
filelocalhttpaigitpip install git+https://github.com/abhishekloiwal/mcp-file-server - diganto-deb/localfileorganizer 🐍 🏠 (⭐ 3) - A Python-based system that organizes and manages files across directories using the Model Context Protocol framework.
filelocalhttpgitgithub - mateicanavra/mcp-filesystem 📘 🏠 (⭐ 3, 🍴 1) - Node.js server for secure and controlled filesystem operations using the Model Context Protocol.
filehttpgitgithub - SDILogin/filesystem-android 🐍 🏠 (⭐ 2, 🍴 2, 🐛 3) - A Claude MCP server facilitating secure access to Android project files for AI-assisted code navigation and analysis.
filehttpaigitgithub - filesystem-server 📜 🏠 (⭐ 2) - 基于Model Context Protocol(MCP)的文件系统操作服务器,提供对本地文件系统的访问和操作能力
filelocalhttpgitgithubnpm install yinzhouzhi/filesystem-server - go-mcp-file-server 🐹 🏠 ☁️ 📇 (⭐ 2) - Go-based
apifileremotelocalhttpgo install linimbus/go-mcp-file-server@latest - mcp-clojure-server-deps-new 🏠 (⭐ 1) - A deps-new based template for quickly creating MCP Servers in Clojure
makefilemcpservergit clone https://github.com/unravel-team/mcp-clojure-server-deps-new - readonly-filesystem-mcp 📜 🏠 (⭐ 1, 🐛 1) - Node.js-based
filehttpgitgithubjavascriptnpm install danielsuguimoto/readonly-filesystem-mcp - mcp-ipfs-server 📘 🏠 (⭐ 1, 🍴 1) - TypeScript-based
httpaigitgithubtypescriptnpm install AleksanStark/mcp-ipfs-server - FileSystem1 🏠 - Direct local file system access
filelocalhttpaigit - llm-context 🏠 - Share code context with LLMs via Model Context Protocol or clipboard
filehttpllmgitgithub - FileStash 🏠 ☁️ - Remote Storage Access: SFTP, S3, FTP, SMB, NFS, WebDAV, GIT, FTPS, gcloud, azure blob, sharepoint, etc...
webfileremotehttpazure - 8b-is/smart-tree 🦀 🏠 🍎 🪟 🐧 🏠 - AI-native directory visualization with semantic analysis, ultra-compressed formats for AI consumption, and 10x token reduction. Supports quantum-semantic mode with intelligent file categorization.
filehttpaigitgithub - alexissinglaire/filesystemcustom-test 📜 🏠 - Node.js server for executing filesystem operations via Model Context Protocol, enabling file manipulation, directory management, and metadata retrieval.
filehttpaigitgithub - alexissinglaire/filesystemcustomfinal 📜 🏠 - Node.js server for executing filesystem operations via Model Context Protocol, enabling file manipulation and directory management within specified boundaries.
filehttpaigitgithub - asirulnik/mcpserverfilesystem01 🏠 - Facilitates AI-driven file system operations within a project directory, enabling seamless code interaction and management.
filehttpaimlgit - box/mcp-server-box-remote 🎖️ ☁️ 🏠 ☁️ - The Box MCP server allows third party AI agents to securely and seamlessly access Box content and use tools such as search, asking questions from files and folders, and data extraction.
fileremotehttpaiml - claude-mcp-get 🏠 - A comprehensive toolkit for installing and configuring Model Context Protocol (MCP) servers on Windows systems
batchfilemcpservergit clone https://github.com/PWereh/claude-mcp-get - example-cool-mcp-server 🏠 - A Github Template for creating Clojure MCP Servers quickly
makefilemcpservergit clone https://github.com/unravel-team/example-cool-mcp-server - filesystem-mcp 📜 🏠 - Node.js-based
filehttpgitgithubjavascriptnpm install axlwolf/filesystem-mcp - filesystem-mcp 🐍 🏠 - Python-based
filehttpgitgithubpythonpip install git+https://github.com/0kenx/filesystem-mcp - filesystem@quarkiverse/quarkus-mcp-servers ☕ 🏠 🏠 - A filesystem allowing for browsing and editing files implemented in Java using Quarkus. Available as jar or native image.
filehttpaigitgithub - fileSystemMCP 🏠 - An MCP server config to manage the file system of any directory in my PC
mcpservergit clone https://github.com/AgarwalSiddhant1996/fileSystemMCP - isaacphi/mcp-gdrive 📇 ☁️ 🏠 - Model Context Protocol (MCP) Server for reading from Google Drive and editing Google Sheets.
httpgitgithub - jeannier/homebrew-mcp 🐍 🏠 🍎 🏠 - Control your macOS Homebrew setup using natural language via this MCP server. Simply manage your packages, or ask for suggestions, troubleshoot brew issues etc.
httpgitgithub - mcp_cli_filesystem 🐍 🏠 - Python-based
filehttpmlllmgitpip install git+https://github.com/RIKTESH89/mcp_cli_filesystem - mcp-file-navigator 📜 🏠 - A secure Model Context Protocol (MCP) server for file system operations. Enables AI assistants like Claude and Cursor to access, read, write, and manage files on your system with robust path validation and dynamic storage location management.
filehttpaigitgithubnpm install Priyonuj/mcp-file-navigator - mcp-filesys 📘 🏠 - Simple file system Model Context Protocol server application
filehttpjsonaigitnpm install DenizkarayusufogluGit/mcp-filesys - mcp-filesystem-extended 📘 🏠 - TypeScript-based
filehttpgitgithubtypescriptnpm install CyberT33N/mcp-filesystem-extended - mcp-server-config 🏠 - MCP server configuration files
mcpservergit clone https://github.com/erer92/mcp-server-config - mcp-server-curio 🏠 - The MCP server is used for the Curio project of Filecoin ecosystem.
mcpservergit clone https://github.com/xiaoliwe/mcp-server-curio - mcp-server-disk-usage 🏠
httpaigitgithubmonitoringgit clone https://github.com/u1i/mcp-server-disk-usage - mcp-server-ufile 🏠 - Model Context Protocol server help you access ufile.ca for income tax returns
servergit clone https://github.com/hdcola/mcp-server-ufile - MCPJavaFileSystem 🏠
webfilehttpllmgitgit clone https://github.com/arunjavagithub/MCPJavaFileSystem - microsoft/markitdown 🎖️ 🐍 🏠 🏠 ☁️ - MCP tool access to MarkItDown -- a library that converts many file formats (local or remote) to Markdown for LLM consumption.
fileremotelocalhttpai - MVA-MCP-servers/filesystem 📘 🏠 - Node.js server for advanced filesystem operations using Model Context Protocol, featuring smart file management and directory navigation.
filehttpgitgithub - save-filesystem-mcp 📘 🏠 - mcp server to modify files savely in a root directory where user should not be able to escapce from
fileauthhttpaigitnpm install sebastianbachmaier/save-filesystem-mcp
🔐 Authentication
- open-mcp-auth-proxy 🐹 🏠 (⭐ 75, 🍴 17, 🐛 7) - Authentication and Authorization Proxy for MCP Servers
goauthorizationmcpoauthservergo install wso2/open-mcp-auth-proxy@latest - mcp-security-audit 📘 🏠 ☁️ (⭐ 45, 🍴 8) - A powerful MCP (Model Context Protocol) Server that audits npm package dependencies for security vulnerabilities. Built with remote npm registry integration for real-time security checks.
typescriptauditmodel-context-protocolnpmsecuritynpm install qianniuspace/mcp-security-audit - strava-mcp 📘 🏠 (⭐ 17, 🍴 2) - A Model Context Protocol (MCP) server with Strava OAuth integration, built on Cloudflare Workers. Enables secure authentication and tool access for MCP clients like Claude and Cursor through Strava login. Perfect for developers looking to integrate Strava authentication with AI tools.
typescriptauthenticationcloudflare-workersmcpmodel-context-protocolnpm install kw510/strava-mcp - mcp-salesforce 📜 🏠 (⭐ 4) - 🚀 Complete MCP (Model Context Protocol) server for Salesforce integration with Claude Desktop. Provides seamless OAuth authentication, universal CRUD operations on any Salesforce object.
javascriptapi-integrationclaude-desktopcrmlinuxnpm install AiondaDotCom/mcp-salesforce - zeropath-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - Open-source MCP server for querying ZeroPath security issues, patches, and scans using Claude, Cursor, Windsurf, or any AI assistant.
pythonappsecdevsecopsmcp-serversecuritypip install git+https://github.com/ZeroPathAI/zeropath-mcp-server - mcp_subfinder_server 🐹 🏠 📇 (⭐ 2) - Model Context Protocol (MCP) server that wraps ProjectDiscovery's subfinder tool for powerful subdomain enumeration through a JSON-RPC API.
gomcpmcp-serversecuritysubfindergo install copyleftdev/mcp_subfinder_server@latest
📊 Monitoring
- dynatrace-mcp 📘 🏠 (⭐ 129, 🍴 36, 🐛 17) - MCP server for Dynatrace Observability
typescriptclaudeclinecopilotdynatracenpm install dynatrace-oss/dynatrace-mcp - jvm-diagnostics-mcp ☕ 🏠 (⭐ 69, 🍴 8) - Java-based
localhttpgitgithubjavagit clone https://github.com/brunoborges/jvm-diagnostics-mcp - mcp-monitor 🐹 🏠 (⭐ 64, 🍴 15) - A system monitoring tool that exposes system metrics via the Model Context Protocol (MCP). This tool allows LLMs to retrieve real-time system information through an MCP-compatible interface.
gocomputermcpmcp-servermonitorgo install seekrays/mcp-monitor@latest - last9-mcp-server 🐹 🏠 (⭐ 44, 🍴 8, 🐛 4) - Last9 MCP Server (Go-based)
goclaudecursormcpmonitoringgo install last9/last9-mcp-server@latest - metoro-mcp-server 🐹 🏠 (⭐ 43, 🍴 11, 🐛 3) - Metoro MCP Server (Go-based)
httpkubernetesgitgithubgogo install metoro-io/metoro-mcp-server@latest - loki-mcp 🐹 🏠 (⭐ 35, 🍴 5, 🐛 3) - An MCP ( Model Context Protocol ) Server for Grafana Loki
httpgitgithubgoagentic-aigo install scottlepp/loki-mcp@latest - alibabacloud-observability-mcp-server 🐍 🏠 (⭐ 32, 🍴 17, 🐛 11) - Python-based
httpmlgitgithubmonitoringpip install git+https://github.com/aliyun/alibabacloud-observability-mcp-server - pprof-analyzer-mcp 🐹 🏠 (⭐ 29, 🍴 3) - This is a Model Context Protocol (MCP) server implemented in Go, providing a tool to analyze Go pprof performance profiles.
filehttpgitgithubgogo install ZephyrDeng/pprof-analyzer-mcp@latest - infisical-mcp-server 📜 🏠 📇 (⭐ 27, 🍴 6, 🐛 6) - Infisical's official MCP server.
apihttpgitgithubjavascriptnpm install Infisical/infisical-mcp-server - mcp-server-raygun 📘 🏠 📇 (⭐ 17, 🍴 11, 🐛 11) - TypeScript-based
apihttpgitgithubmonitoringnpm install MindscapeHQ/mcp-server-raygun - otx-mcp 🐍 🏠 (⭐ 17, 🍴 7, 🐛 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/mrwadams/otx-mcp - kibana-mcp 🐍 🏠 (⭐ 10, 🍴 2, 🐛 1) - MCP Server for Kibana SecOps
httpaigitgithubpythonpip install git+https://github.com/ggilligan12/kibana-mcp - querypie-mcp-server 🐹 🏠 (⭐ 9) - The MCP server for QueryPie for administrators to manage it.
httpgitgithubmonitoringgogo install querypie/querypie-mcp-server@latest - air-mcp 📘 🏠 (⭐ 7, 🍴 3, 🐛 1) - Binalyze AIR MCP Server
httpaigitgithubtypescriptnpm install binalyze/air-mcp - VictoriaMetrics-mcp-server 📜 🏠 (⭐ 7, 🍴 5, 🐛 2) - MCP Server for the VictoriaMetrics.
httpgitgithubmetricsjavascriptnpm install yincongcyincong/VictoriaMetrics-mcp-server - mcp-rollbar-server 📘 🏠 📇 (⭐ 6, 🍴 3) - MCP server implementation for Rollbar API integration
httpaillmgitgithubnpm install hiyorineko/mcp-rollbar-server - groundlight-mcp-server 🐍 🏠 (⭐ 4, 🐛 1) - MCP Server for Groundlight
httpgitgithubpythoncomputer-visionpip install git+https://github.com/groundlight/groundlight-mcp-server - simple-loki-mcp 📘 🏠 (⭐ 4, 🍴 4, 🐛 3) - TypeScript-based
httpaigitgithubtypescriptnpm install ghrud92/simple-loki-mcp - suzieq-mcp 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/PovedaAqui/suzieq-mcp - cloudrun-logs-mcp 🐹 🏠 (⭐ 2) - Go-based
httpaigitgithubgogo install maito1201/cloudrun-logs-mcp@latest - mcp-telemetry 🐍 🏠 (⭐ 2) - Observability helps. This MCP server adds tracing to all your conversations on Claude (or suitable MCP client) so that you can trace, understand, debug and report on your all your interactions.
httpllmgitgithubpythonpip install git+https://github.com/xprilion/mcp-telemetry - mcp-sbom-server 🐍 🏠 (⭐ 2, 🍴 3, 🐛 3) - MCP server to perform a scan and produce an SBOM
httpgitgithubpythonmcppip install git+https://github.com/gkhays/mcp-sbom-server - PodscanMcpServer 📘 🏠 📇 (⭐ 1) - TypeScript-based
apihttpmlgitgithubnpm install JordanDalton/PodscanMcpServer - honeybadger-mcp 🐍 🏠 (⭐ 1) - Python-based
httpaigitgithubmonitoringpip install git+https://github.com/bobtista/honeybadger-mcp - mcp-redash 📘 🏠 📇 (⭐ 1) - TypeScript-based
apihttpgitgithubtypescriptnpm install yuki9541134/mcp-redash - akhq-mcp-server 📜 🏠 (⭐ 1) - Experimental Model Context Protocol server for Kafka monitoring tool AKHQ
httpaigitgithubmonitoringnpm install saarw/akhq-mcp-server - aws-cost-notifier-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - AWS Cost Notifier MCP Server - Daily AWS cost monitoring and reporting tool
httpawsaigitgithubnpm install enomoto11/aws-cost-notifier-mcp-server - shadow-cljs-mcp 📜 🏠 (⭐ 1, 🍴 4, 🐛 3) - A Model Context Protocol server for monitoring shadow-cljs builds
filehttpllmgitgithubnpm install Bigsy/shadow-cljs-mcp - Signoz 🏠 📇 - Comprehensive integration with Signoz APIs and documentation for monitoring, observability, and debugging tasks related to your Signoz instances.
apihttpaigitgithub - VictoriaMetrics 🏠 📇 - Comprehensive integration with VictoriaMetrics APIs and documentation for monitoring, observability, and debugging tasks related to your VictoriaMetrics instances.
apihttpgitgithubmonitoring - sslmon 🏠 - Domain/HTTPS/SSL domain registration information and SSL certificate monitoring capabilities. Query domain registration and expiration information, and SSL certificate information and validity status for any domain.
httpaigitgithubmonitoring - Sentry 🏠 - Sentry.io integration for error tracking and performance monitoring
httpaigitgithubmonitoring - cline/cline-community 🏠 - Facilitates seamless issue reporting from Cline to GitHub by automating metadata extraction and providing a preview feature.
httpmlgitgithub - edgedelta/edgedelta-mcp-server 🎖️ 🏎️ ☁️ 🏠 - Interact with Edge Delta anomalies, query logs / patterns / events, and pinpoint root causes and optimize your pipelines.
httpgitgithub - impact-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install jalexspringer/impact-mcp-server - inspektor-gadget/ig-mcp-server 🏎️ ☁️ 🏠 🐧 🪟 🍎 🏠 - Debug your Container and Kubernetes workloads with an AI interface powered by eBPF.
httpkubernetesaigitgithub - loginmqv/mcp-server-prometheus 📇 ☁️ 🏠 - MCP server for interacting with Prometheus, enabling AI assistants to query and analyze metrics data.
httpaigitgithubmetrics - mcp_pagerduty 🐍 🏠 - An Model Context Protocol (MCP) server with PagerDuty support
httpgitgithubpythonmcppip install git+https://github.com/naveen09/mcp_pagerduty - mcp-glances 🐍 🏠 📇 - 通过 MCP 服务与大语言模型(LLM)结合,调用 Glances API 获取并分析服务器监控数据,实时反馈系统状态。已在 Cursor 和 Cline 客户端测试通过。
apihttpllmgitgithubpip install git+https://github.com/Lee-1024/mcp-glances - Polar Signals Remote MCP 🐍 ☁️ - MCP server for Polar Signals Cloud continuous profiling platform, enabling AI assistants to analyze CPU performance, memory usage, and identify optimization opportunities in production systems.
remotehttpai - scottlepp/tempo-mcp-server 🏠 - Enables AI assistants to query and analyze distributed tracing data from Grafana Tempo using the Model Context Protocol.
httpaigitgithub - srcgrp/sentry-mcp-server 🏠 - Integrate Sentry error tracking into your development workflow by accessing release health data and issue details directly within your MCP-enabled environment.
httpaigitgithub - weather-mcp-server 📘 🏠 - Implementation of MCP documentation's "quickstart" server
httpgitgithubtypescriptmcpnpm install Chazzychouse/weather-mcp-server
✅ Testing
- mcp-server 📘 🏠 (⭐ 89, 🍴 25, 🐛 14) - BrowserStack's Official MCP Server
typescriptaccessibilityautomationbrowserstackmcp-servernpm install browserstack/mcp-server - VibeShift 🐍 🏠 (⭐ 57, 🍴 5, 🐛 3) - [MCP Server] The Security Agent for AI assisted coding
pythondebuggingdebugging-toolmcpmcp-servergit clone https://github.com/Ilikepizza2/QA-MCP - mcp-openmsx 🏠 (⭐ 36, 🍴 2) - A Model Context Protocol (MCP) server for automating openMSX emulator instances. This server provides comprehensive tools for MSX software development, testing, and automation through standardized MCP protocols.
texmcpservertestinggit clone https://github.com/nataliapc/mcp-openmsx - mcp-servers-schemas 🏠 (⭐ 14, 🍴 1) - This document provides a list of different MCP servers. For each server, we provide a schema definition that includes the latest basic information and tool definitions.
mcp-schemamcp-server-storemcp-serversmcp-servers-directorymcp-servers-schemasgit clone https://github.com/oslook/mcp-servers-schemas - ex-mcp-test 🏠 (⭐ 9, 🍴 2) - Test implementation of mcp server in Elixir
elixirmcpservergit clone https://github.com/y86/ex-mcp-test - echo-mcp-server-for-testing 🐍 🏠 (⭐ 2, 🍴 2) - A simple echo MCP (Model Context Protocol) Server for testing MCP Clients.
pythonmcpmcp-servertestingserverpip install git+https://github.com/piebro/echo-mcp-server-for-testing - mcp-client-for-testing 🐍 🏠 (⭐ 2) - A simple MCP (Model Context Protocol) client for testing MCP Server
pythonmcpmcp-clienttestingserverpip install git+https://github.com/piebro/mcp-client-for-testing - gh-mcp-tests 🏠 (⭐ 1, 🐛 3) - Testing sub-issue creation with the gh mcp server
mcpservertestinggit clone https://github.com/martinnormark/gh-mcp-tests - civicnet-mcp-tools 🏠 (⭐ 1) - CivicNet MCP Tools are a modular set of administrative and developer utilities that make it easy for any community, organization, or contributor to manage, audit, test, and extend their local MCP (Model Context Protocol) server and node.
mcpservernodegit clone https://github.com/Publik-Works/civicnet-mcp-tools - claude-mcp-test 🏠 - Test repository created via claude-desktop with github MCP server
mcpservergit clone https://github.com/devacse/claude-mcp-test - github-mcp-test 🏠 - Test repository for GitHub MCP server functionality
mcpservergit clone https://github.com/ariofarmani/github-mcp-test - mcp_repo_170d1d13 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo_170d1d13 - mcp_repo_4a01eabf 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo_4a01eabf - mcp_repo_9610b307 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo_9610b307 - mcp_repo_9ebf5242 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo_9ebf5242 - mcp_repo_a2700009 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo_a2700009 - mcp_repo_c11db53a 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo_c11db53a - mcp_repo-386eee04 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo-386eee04 - mcp_repo9756c6c7-ee07-4f3a-ada4-f6e2705daa02 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repo9756c6c7-ee07-4f3a-ada4-f6e2705daa02 - mcp_repob7b7df37-94c2-48e4-8721-6cc695c23d4c 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repob7b7df37-94c2-48e4-8721-6cc695c23d4c - mcp_repod27deec8-0d1e-446e-b4d2-f2860d808f71 🏠 - This is a test repository created by test script of MCP Server for GitHub
mcpservergit clone https://github.com/sanskarmk/mcp_repod27deec8-0d1e-446e-b4d2-f2860d808f71 - MCP_test 🏠 - Testing the functionalities of the MCP server of Github with Claude. Everything shown in here (besides this description) is made via natural text in Claude desktop!
mcpservertestinggit clone https://github.com/KleinJonasUVT/MCP_test - MCP_test 🏠 - Test repository for MCP server
cssmcpservergit clone https://github.com/jerry3315765/MCP_test - MCP-Repo 🏠 - Repository for testing MCP GitHub server capabilities
mcpservertestinggit clone https://github.com/JYf12/MCP-Repo - mcp-sample 🏠 - Test repository created using Claude Desktop and MCP server integration
mcpservergit clone https://github.com/pxdsgnco/mcp-sample - mcp-server-test 🏠 - MCP服务器测试仓库
mcpgit clone https://github.com/qikexin/mcp-server-test - mcp-server-test 🏠 - A test repository for MCP server-related experiments and demonstrations.
mcpservergit clone https://github.com/ashvinto/mcp-server-test - mcp-server-test 🏠 - MCP Server Test Repository
mcpservergit clone https://github.com/sor999/mcp-server-test - mcp-server-weather-test 🏠 - mcp-server-weather-test
mcpservergit clone https://github.com/tamujin/mcp-server-weather-test - mcp-test 🏠 - GitHub MCP Server implementation and testing repository
mcpservertestinggit clone https://github.com/tomo-cps/mcp-test - mcp-test-repo 🏠 - Ett testrepository skapat via GitHub MCP-server
mcpservergit clone https://github.com/klarkenolofsson/mcp-test-repo - mcp-test-repo 🏠 - Test repository for GitHub MCP server validation
mcpservergit clone https://github.com/hamnhugs/mcp-test-repo - MCP-TEST-REPO 🏠 - A test repository created using the GitHub MCP server
mcpservergit clone https://github.com/oghenetejiriorukpegmail/MCP-TEST-REPO - mcp-test-repo-1 🏠 - Test repository for MCP GitLab server validation
mcpservergit clone https://github.com/OneofGods/mcp-test-repo-1 - mcp-testing 🏠 - Repository for testing MCP Server tools and functionality
mcpservertestinggit clone https://github.com/AstroMined/mcp-testing - MCPTest 🏠 - This repository complements or interacts with the github-mcp-server project.
mcpservergit clone https://github.com/almas7202/MCPTest - PentestAgentMCP 🏠 - Repository for creating an automatic pentesting agent using MCP servers.
mcpservertestinggit clone https://github.com/ibrahimsaleem/PentestAgentMCP - test_MCPServer 🏠 - Test MCP server that can do several things
mcpservergit clone https://github.com/Cavumnigrum/test_MCPServer - test-mcp 🏠 - Test mcp server
mcpservergit clone https://github.com/christinemasters/test-mcp - test-mcp-repo 🏠 - A test repository created using the GitHub MCP server
mcpservergit clone https://github.com/Prof-pengyin/test-mcp-repo - test-mcp-server 🏠 - Test repository for MCP server functionality
mcpservergit clone https://github.com/ganesh-mindbridges/test-mcp-server - Welcome-MCP-Server-Testing 🏠 - A test repository for MCP server functionality
mcpservergit clone https://github.com/Munirg2003/Welcome-MCP-Server-Testing
📚 Documentation
- mcp-svelte-docs 📘 🏠 (⭐ 109, 🍴 8, 🐛 3) - 🔍 MCP server that lets you search and access Svelte documentation with built-in caching
typescriptdeveloper-toolsdocumentationlibsqlllmnpm install spences10/mcp-svelte-docs - Mcp-Research 📘 🏠 (⭐ 5, 🍴 1) - I scraped a lot of information on MCP (Model Context Protocol) servers . with Integration to Cursor AI and Claude Desktop . That way you can add this folder to your preferred IDE so that it will have contextual indexing information available to grasp how to create MCP servers correctly .
mcpserverdocumentationtypescriptaigit clone https://github.com/spuerFan/mcp-research - mcp-npm_docs-server 📘 🏠 (⭐ 3) - An MCP server that provides a tool to fetch metadata and documentation (including README content) for NPM packages, using a local cache to improve performance.
typescriptclaudedocsmodelcontextprotocolmpcnpm install bsmi021/mcp-npm_docs-server - aoe4-mcp 🏠 - mcp server for aoe4 documentation
mcpserverdocumentationgit clone https://github.com/Bit0r/aoe4-mcp - git-mcp-server-troubleshooting 🐚 🏠 - Troubleshooting documentation for Git MCP Server with specific focus on registry and connection issues
shellmcpserverdocumentationgit clone https://github.com/OneofGods/git-mcp-server-troubleshooting - mcp-server 🏠 - Repository for MCP (Multi-Cloud Platform) Server configuration and documentation
mcpserverdocumentationgit clone https://github.com/ABHISHEK-KUMAR-14022001/mcp-server - Mcpthings 🏠 - Repository for MCP (Master Control Program) server implementation and documentation
mcpserverdocumentationgit clone https://github.com/ayush-3006/Mcpthings
🔧 Utilities
- Awesome-MCP-ZH 🏠 (⭐ 4.2k, 🍴 241, 🐛 3) - MCP 资源精选, MCP指南,Claude MCP,MCP Servers, MCP Clients
claudeclaude-mcpdeepseekdeepseek-mcpmcpgit clone https://github.com/yzfly/Awesome-MCP-ZH - awesome-web3-mcp-servers 🏠 (⭐ 568, 🍴 71, 🐛 1) - DeMCP is the first Decentralized MCP network, offering SSE proxies for MCP services and mainstream LLMs, tackling trust and security with TEE and blockchain.
mcpaillmrustgit clone https://github.com/demcp/awesome-web3-mcp-servers - mcp-server-elasticsearch 🦀 🏠 (⭐ 450, 🍴 94, 🐛 23) - Rust-based
rustelasticsearchmcpmcp-servervector-databasecargo install --git https://github.com/elastic/mcp-server-elasticsearch - mcp-sequentialthinking-tools 📘 🏠 (⭐ 367, 🍴 59, 🐛 3) - 🧠 An adaptation of the MCP Sequential Thinking Server to guide tool usage. This server provides recommendations for which MCP tools would be most effective at each stage.
typescriptmcpmodel-context-protocolmodelcontextprotocoltoolnpm install spences10/mcp-sequentialthinking-tools - tfmcp 🦀 🏠 (⭐ 340, 🍴 22, 🐛 4) - 🌍 Terraform Model Context Protocol (MCP) Tool - An experimental CLI tool that enables AI assistants to manage and operate Terraform environments. Supports reading Terraform configurations, analyzing plans, applying configurations, and managing state with Claude Desktop integration. ⚡️
rustmcpmcp-serverterraformaicargo install --git https://github.com/nwiizo/tfmcp - apollo-mcp-server 🦀 🏠 (⭐ 188, 🍴 38, 🐛 20) - Apollo MCP Server (Rust-based)
rustmcpservercargo install --git https://github.com/apollographql/apollo-mcp-server - mcp-guardian 🦀 🏠 (⭐ 169, 🍴 10, 🐛 11) - Manage / Proxy / Secure your MCP Servers
rustagentic-aiclaude-desktopllm-toolsmcpcargo install --git https://github.com/eqtylab/mcp-guardian - mcp-access-point 🦀 🏠 (⭐ 120, 🍴 21, 🐛 3) - Turn a web server into an MCP server in one click without making any code changes.
rustgatewaymcpmcp-serversproxycargo install --git https://github.com/sxhxliang/mcp-access-point - rust-mcp-sdk 🦀 🏠 (⭐ 91, 🍴 12, 🐛 3) - A high-performance, asynchronous toolkit for building MCP servers and clients in Rust.
rustcrates-iomcp-clientmcp-servermcp-toolscargo install --git https://github.com/rust-mcp-stack/rust-mcp-sdk - mcp-rs-template 🦀 🏠 (⭐ 80, 🍴 9) - Model Context Protocol (MCP) CLI server template for Rust
rustjson-rpcmcpservercargo install --git https://github.com/linux-china/mcp-rs-template - rust-mcp-filesystem 🦀 🏠 (⭐ 68, 🍴 8, 🐛 3) - Blazing-fast, asynchronous MCP server for seamless filesystem operations.
rustfilesystemmcp-serverrust-mcprust-mcp-stackcargo install --git https://github.com/rust-mcp-stack/rust-mcp-filesystem - rust-mcp-schema 🦀 🏠 (⭐ 67, 🍴 5, 🐛 2) - A type-safe implementation of the official Model Context Protocol (MCP) schema in Rust.
rustcrates-iomcp-clientmcp-hostmcp-servercargo install --git https://github.com/rust-mcp-stack/rust-mcp-schema - cratedocs-mcp 🦀 🏠 (⭐ 51, 🍴 16, 🐛 9) - An MCP server for rust crate docs
rustmcpservercargo install --git https://github.com/d6e/cratedocs-mcp - mcp-discovery 🦀 🏠 (⭐ 47, 🍴 6) - A command-line tool written in Rust for discovering and documenting MCP Server capabilities.
rustclimcpmcp-clientmcp-servercargo install --git https://github.com/rust-mcp-stack/mcp-discovery - mcp-sqlite 📜 🏠 (⭐ 47, 🍴 5) - 🐇 Model Context Protocol (MCP) server that provides comprehensive SQLite database interaction capabilities
rustmcpsqlitejavascriptaitoolingcargo install --git https://github.com/fishcode2025/mcp-sqlite - assistant-mcp 🦀 🏠 (⭐ 37, 🍴 6, 🐛 1) - Pinecone Assistant MCP server
rustmcpserverhttpgitcargo install --git https://github.com/pinecone-io/assistant-mcp - iceberg-mcp 🦀 🏠 (⭐ 30, 🍴 2) - MCP server for Apache Iceberg
rustcatalogglueiceberglakehousecargo install --git https://github.com/morristai/iceberg-mcp - solana-mcp-server 🦀 🏠 (⭐ 22, 🍴 9, 🐛 3) - solana mcp sever to enable solana rpc methods
rustmcpmcp-servermcp-serverssolanacargo install --git https://github.com/aldrin-labs/solana-mcp-server - mcp-sharepoint 🐍 🏠 (⭐ 20, 🍴 6, 🐛 1) - Python-based
httpaimlgitgithubpip install git+https://github.com/Sofias-ai/mcp-sharepoint - mcp-js 🦀 🏠 (⭐ 18, 🍴 5) - A Rust-based Model Context Protocol (MCP) server that exposes a V8 JavaScript runtime as a tool for AI agents like Claude and Cursor. Supports persistent heap snapshots via S3 or local filesystem, and is ready for integration with modern AI development environments.
rustmcpserverailocalcargo install --git https://github.com/r33drichards/mcp-js - rbdc-mcp 🦀 🏠 (⭐ 18, 🍴 4) - rbdc-mcp-server (Rust-based)
rustmcpservercargo install --git https://github.com/rbatis/rbdc-mcp - mcp-server-brave-search 🦀 🏠 (⭐ 17, 🍴 4, 🐛 1) - MCP Server for Brave Search
rustmcpservercargo install --git https://github.com/zed-extensions/mcp-server-brave-search - mcp-server-runner 🦀 🏠 (⭐ 17, 🍴 7) - A WebSocket server implementation for running Model Context Protocol (MCP) servers. This application enables MCP servers to be accessed via WebSocket connections, facilitating integration with web applications and other network-enabled clients.
rustmcpserverwebwebsocketcargo install --git https://github.com/yonaka15/mcp-server-runner - tsrs-mcp-server 🦀 🏠 (⭐ 15, 🍴 3) - tushare rust mcp server
rustmcp-serverpoemtusharetushare-procargo install --git https://github.com/hanxuanliang/tsrs-mcp-server - zed-mcp-server-figma 🦀 🏠 (⭐ 12, 🍴 1) - A Framelink Figma MCP server extension for Zed
rustfigmamcp-serverzedmcpcargo install --git https://github.com/LoamStudios/zed-mcp-server-figma - mcp-server-thehive 🦀 🏠 (⭐ 11, 🍴 3, 🐛 1) - MCP Server for TheHive
rustmcpserverhttpaicargo install --git https://github.com/gbrigandi/mcp-server-thehive - zed-exa-mcp-extension 🦀 🏠 (⭐ 11, 🍴 2, 🐛 1) - Zed extension for Exa's MCP server
rustmcpservercargo install --git https://github.com/exa-labs/zed-exa-mcp-extension - smart-memory-mcp-v2 🦀 🏠 (⭐ 9, 🐛 3) - Smart Memory MCP v2 - Model Context Protocol implementation with memory management capabilities
rustmcpcargo install --git https://github.com/shipdocs/smart-memory-mcp-v2 - mcp-server-cortex 🦀 🏠 (⭐ 8, 🍴 3, 🐛 1) - MCP Server for Cortex
rustmcpserverhttpaicargo install --git https://github.com/gbrigandi/mcp-server-cortex - mcp-google-sheets 📘 🏠 (⭐ 7) - TypeScript-based
httpmlgitgithubtypescriptnpm install Demontie/mcp-google-sheets - rig-mcp-server 🦀 🏠 (⭐ 7, 🍴 2, 🐛 1) - Rig MCP Server Example (April 7, 2025)
rustmcp-serverrigmcpservercargo install --git https://github.com/RGGH/rig-mcp-server - mcp-git-tools 🦀 🏠 (⭐ 6, 🍴 2) - Git tool integration library for the Model Context Protocol (MCP).
rustgitmcpmcp-servercargo install --git https://github.com/lileeei/mcp-git-tools - porkbun-mcp-server 📘 🏠 📇 (⭐ 6, 🍴 2, 🐛 2) - MCP server implementation for managing domains, DNS, and SSL via the Porkbun API.
apihttpaigitgithubnpm install miraclebakelaser/porkbun-mcp-server - mcpc 🦀 🏠 (⭐ 6, 🍴 1) - Mcp server scaffolding tool
rustmcpservercargo install --git https://github.com/vlyl/mcpc - weatherxm-pro-mcp 📜 🏠 📇 (⭐ 6, 🍴 3, 🐛 2) - This MCP server exposes the WeatherXM PRO APIs as MCP tools, allowing clients to access weather station data, observations, and forecasts through the MCP protocol.
apihttpgitgithubjavascriptnpm install WeatherXM/weatherxm-pro-mcp - mcp-server-splunk 🐹 🏠 (⭐ 5, 🍴 2, 🐛 1) - MCP server for Splunk
httpmlgitgithubgogo install jkosik/mcp-server-splunk@latest - Netmind-Parse-PDF-MCP 🐍 🏠 (⭐ 5) - A Model Context Protocol (MCP) server that parses PDF files into structured formats.
filehttpjsongitgithubpip install git+https://github.com/protagolabs/Netmind-Parse-PDF-MCP - mcp-rust-sdk 🦀 🏠 (⭐ 5) - unofficial SDK for MCP servers in Rust
rustmcpservercargo install --git https://github.com/mediar-ai/mcp-rust-sdk - fdic-bank-find-mcp-server 🦀 🏠 📇 (⭐ 4, 🍴 2, 🐛 1) - MCP Server to wrap the FDIC Bank Find API
rustmcpserverapihttpcargo install --git https://github.com/clafollett/fdic-bank-find-mcp-server - mcp-discovery-action 🏠 (⭐ 4) - GitHub Action for the mcp-discovery CLI
cligithub-actionmcpmcp-clientmcp-servergit clone https://github.com/rust-mcp-stack/mcp-discovery-action - mcp-server-axiom 🦀 🏠 (⭐ 4, 🍴 3, 🐛 1) - An MCP server for Axiom
rustmcpservercargo install --git https://github.com/zed-extensions/mcp-server-axiom - n8n-mcp-server-rust 🦀 🏠 (⭐ 4, 🍴 4, 🐛 1) - An MCP server that can use n8n.
rustmcpservercargo install --git https://github.com/joshua-mo-143/n8n-mcp-server-rust - unity_code_mcp 🦀 🏠 (⭐ 4, 🍴 1, 🐛 1) - Unity Code MCP is a MCP server that enables AI agents to work on Unity project autonomously, by providing tools to compile code and run tests in Unity Editor.
rustmcpserveraicargo install --git https://github.com/hackerzhuli/unity_code_mcp - terminal-mcp 🦀 🏠 (⭐ 4, 🐛 1) - native mcp server for unix pty control
rustmcpmcp-clientservercargo install --git https://github.com/ianks/terminal-mcp - CristianCiubancan/sequentialthinking 📜 🏠 (⭐ 3) - Facilitates dynamic problem-solving through structured, step-by-step thinking processes.
httpgitgithub - eagle-mcp-server 🐍 🏠 (⭐ 3, 🍴 1, 🐛 5) - A Model Context Protocol (MCP) server for Eagle. Manages local media files (e.g., images, mp3, mp4)
httpmlgitgithubpythonpip install git+https://github.com/tuki0918/eagle-mcp-server - mcp-prompts-rs 🦀 🏠 (⭐ 3, 🍴 2) - Rust-based server for managing AI prompts using the Model Context Protocol (MCP)
rustmcpserveraicargo install --git https://github.com/sparesparrow/mcp-prompts-rs - tinderbox-mcp 🏠 (⭐ 3, 🍴 2) - An MCP server for interacting with the knowledge management tool Tinderbox.
applescriptmcpservergit clone https://github.com/phkus/tinderbox-mcp - zed-mcp-server-buildkite 🦀 🏠 (⭐ 3, 🍴 2, 🐛 2) - Buildkite Integration for Zed - Access your Buildkite CI/CD pipelines and builds directly from your editor
rustcargo install --git https://github.com/mcncl/zed-mcp-server-buildkite - larkrs-mcp-server 🦀 🏠 (⭐ 3, 🍴 1) - lark rust mcp server
rustmcpservercargo install --git https://github.com/hanxuanliang/larkrs-mcp-server - mcp-get-installed-apps 📘 🏠 (⭐ 3, 🍴 2) - A Model Context Protocol (MCP) server that provides information about installed applications on your computer, support MacOS and Windows.
httpaigitgithubtypescriptnpm install Xutaotaotao/mcp-get-installed-apps - mcp-server-hello 🦀 🏠 (⭐ 3, 🍴 1) - A hello-world server for the Model Context Protocol
rustservercargo install --git https://github.com/TeamDman/mcp-server-hello - applemusic-mcp-server 🦀 🏠 📇 (⭐ 2, 🐛 5) - An MCP server for interacting with the Apple Music API.
rustmcpserverapicargo install --git https://github.com/akr4/applemusic-mcp-server - mcpbridge 🦀 🏠 (⭐ 2, 🍴 1) - Server side of Firefox Claude MCP extension
rustmcpservercargo install --git https://github.com/k3d3/mcpbridge - pref-editor-mcp-server 📘 🏠 (⭐ 2, 🍴 3) - Preference Editor MCP server
httpgitgithubtypescriptagentic-ainpm install charlesmuchene/pref-editor-mcp-server - pihole-mcp-server 🐍 🏠 (⭐ 2, 🍴 3, 🐛 1) - A Model Context Protocol (MCP) server for Pi-hole
httpaigitgithubmetricspip install git+https://github.com/sbarbett/pihole-mcp-server - prisma-mcp-zed 🦀 🏠 (⭐ 2, 🐛 1) - Zed extension for Prisma MCP server
rustmcpservercargo install --git https://github.com/aqrln/prisma-mcp-zed - switch-bot-mcp-server 🐹 🏠 (⭐ 2, 🍴 1) - SwitchBot MCP Server
httpgitgithubgogolanggo install yasu89/switch-bot-mcp-server@latest - docs-rs-mcp-server 🏠 (⭐ 2) - MCP Server Implementation for Rust documentation from Docs.rs
htmlmcpserverrustdocumentationgit clone https://github.com/liamwh/docs-rs-mcp-server - lifx-api-mcp-server 📜 🏠 📇 (⭐ 2) - 🤖💡 MCP Server for LIFX API
apihttpllmgitgithubnpm install furey/lifx-api-mcp-server - mcpm 📘 🏠 (⭐ 2, 🍴 1) - Model Context Protocol MCP manager
httpjsongitgithubtypescriptnpm install jsnanigans/mcpm - zed-resend-mcp-server 🦀 🏠 (⭐ 2, 🍴 1) - A Zed extension for the Resend MCP.
rustmcpcargo install --git https://github.com/danilo-leal/zed-resend-mcp-server - pr_creator_mcp 📘 🏠 (⭐ 2, 🍴 1) - TypeScript-based
httpgitgithubtypescriptnpm install urijan44/pr_creator_mcp - cosmwasm-mcp-template 🦀 🏠 (⭐ 1) - MCP server template for CosmWasm smart contract projects
rustmcpservercargo install --git https://github.com/archway-network/cosmwasm-mcp-template - patch-file-mcp 🐍 🏠 (⭐ 1) - An MCP Server to patch existing files using block format
filehttpaigitgithubpip install git+https://github.com/PyneSys/patch-file-mcp - simple-mcp-fileserver 📜 🏠 (⭐ 1) - A minimal MCP (Model Context Protocol) server for file system operations. Supports reading, writing, and listing files via JSON-RPC 2.0, designed for integration with AI agents such as Windsurf, Claude, or Codeium for autonomous coding and code repair.
filelocalhttpjsonainpm install aezizhu/simple-mcp-fileserver - date-mcp 📘 🏠 (⭐ 1) - TypeScript-based
httpgitgithubtypescriptnpm install Nozomuts/date-mcp - elhadjaoui/prreviewer 🐍 🏠 (⭐ 1) - An MCP server that integrates with Claude Desktop to analyze GitHub Pull Requests and automatically saves reviews to Google Drive.
httpgitgithub - gamecode-mcp2 🦀 🏠 (⭐ 1, 🐛 7) - mcp in rust both client and server
rustmcpservercargo install --git https://github.com/navicore/gamecode-mcp2 - mcpm 🐍 🏠 (⭐ 1) - Python-based
filehttpgitgithubpythonpip install git+https://github.com/dotku/mcpm - solvitor-mcp 🦀 🏠 (⭐ 1, 🍴 2, 🐛 1) - Rust-based
rustanchorreverse-engineeringrust-langsolanacargo install --git https://github.com/Adeptus-Innovatio/solvitor-mcp - n8n-mcp-tool 📜 🏠 (⭐ 1) - MCP tool for managing n8n workflows in Docker containers - A comprehensive guide and toolset for automating n8n workflow management
httpdockeraigitgithubnpm install Kr8thor/n8n-mcp-tool - anet-mcp-server 🦀 🏠 (⭐ 1) - 🚀 A high-performance Rust server for Model Control Protocol (MCP) with JSON-RPC 2.0, NATS messaging, async support, and pluggable AI tools.
rustmcpserveraijsoncargo install --git https://github.com/marekkucak/anet-mcp-server - mcp 🦀 🏠 (⭐ 1) - The mcp service collection, including aliyun cli and aliyun log, mysql, redis, and the se service of the common tool collection
rustmcpmcp-servermcp-serversmcp-toolscargo install --git https://github.com/LikeRainDay/mcp - rust-mcp-server 🦀 🏠 (⭐ 1) - Model Context Protocol server for Rust development tools (clippy, rustfmt, cargo check, cargo test)
rustservergocargo install --git https://github.com/lh/rust-mcp-server - visa-mcp 🏠 (⭐ 1)
httpmlgitgithubhtmlgit clone https://github.com/Hizuki1030/visa-mcp - zed-mcp-server-miaoduo 🦀 🏠 (⭐ 1, 🍴 1) - miaoduo mcp server extension for zed editor
rustmcpservercargo install --git https://github.com/benmooo/zed-mcp-server-miaoduo - zed-slack-mcp 🦀 🏠 (⭐ 1, 🍴 1, 🐛 1) - Zed extension for Slack's MCP server.
rustmcpzedservercargo install --git https://github.com/semioz/zed-slack-mcp - poly-mcp-client 🐍 🏠 (⭐ 1) - An simple MCP client adapting tool definitions for Anthropic, OpenAI, and Gemini.
httpaiopenaianthropicgitpip install git+https://github.com/yo-ban/poly-mcp-client - design-system-mcp-sandbox 📘 🏠 (⭐ 1) - TypeScript-based
httpaigitgithubtypescriptnpm install ssaitho/design-system-mcp-sandbox - mcp-excel-controller-pro 📜 🏠 (⭐ 1) - mcp-excel-controller-pro
filehttpgitgithubjavascriptnpm install Jerry-is-coder/mcp-excel-controller-pro - mcp-excel-server 📜 🏠 (⭐ 1) - mcp excel server (Node.js-based)
filehttpgitgithubjavascriptnpm install qianO33/mcp-excel-server - MCP-Notion 🦀 🏠 📇 (⭐ 1) - This project implements a MCP (Model Context Protocol) server that allows language models such as Claude to interact directly with Notion. It serves as a standardized interface between LLMs and the Notion API, eliminating the need for intermediate layers such as Supabase.
rustmcpserverapillmcargo install --git https://github.com/GsusFC/MCP-Notion - review-toolkit-mcp 📜 🏠 (⭐ 1, 🍴 1) - Node.js-based
filehttpaigitgithubnpm install ZebraRoy/review-toolkit-mcp - Server-Inspection-MCP 🐹 🏠 (⭐ 1) - 服务器巡检 MCP (Go-based)
httpgitgithubgomcpgo install b3nguang/Server-Inspection-MCP@latest - write_emoji_mcp 📜 🏠 (⭐ 1) - 欢迎来到 md-emoji-mcp,一个超便捷的 CLI 小工具,让你的 Markdown 技术文章瞬间萌化~ !
httpgitgithubjavascriptclinpm install ndlxp2008/write_emoji_mcp - aldrin-labs_solana-mcp-server 🦀 🏠 (⭐ 1, 🍴 1) - Mirror of https://github.com/aldrin-labs/solana-mcp-server
rustmcpserverhttpcargo install --git https://github.com/MCP-Mirror/aldrin-labs_solana-mcp-server - AgentForgeMCP 🏠 - A template MCP server to easily deploy tools, resources, and prompts for agents. From the AgentForge team
mcpservergit clone https://github.com/DataBassGit/AgentForgeMCP - mcp-blueprint 🦀 🏠 - Convert any remote MCP Server into a Tangle Blueprint in seconds
rustmcpservercargo install --git https://github.com/tangle-network/mcp-blueprint - rmcp-mailer 🦀 🏠 - An example rust-based MCP server for sending emails.
rustmcpserveraicargo install --git https://github.com/AlvinHon/rmcp-mailer - mcp-license-check 📜 🏠 - Node.js-based
httpgitgithubjavascriptnpm install tvriesde/mcp-license-check - agents-mcp-clients 🐍 🏠 - A working example of your own agents from the scratch and using it with the mcp servers from scratch
filehttpgitgithubpythonpip install git+https://github.com/dynstat/agents-mcp-clients - alvinveroy/aider-mcp-client 🏠 - A Python tool that integrates MCP with Aider to fetch library documentation and enhance AI-assisted coding workflows.
httpaigitgithub - ambur-mcp 🦀 🏠 - MCP server in Rust, for wrapping Ambur query and execute entry point messages to be broadcast by a signer
rustmcpservercargo install --git https://github.com/phi-labs-ltd/ambur-mcp - deno-kv-mcp 📘 🏠 - An MCP Server for chatting with Deno KV instances
httpmlgitgithubtypescriptnpm install joshuayoes/deno-kv-mcp - ej-mcp-server-gdrive 📜 🏠 - Node.js-based
filehttpgitgithubjavascriptnpm install ejoyee/ej-mcp-server-gdrive - gibwork-mcp 📘 🏠 - A Mcp server to create and fetch tasks from gibwork platfom
httpgitgithubtypescriptmcpnpm install shivaji43/gibwork-mcp - http-request-mcp 📜 🏠 - Node.js-based
webhttpmlgitgithubnpm install vitolrosario/http-request-mcp - hyper-mcp-release-monitor-id-tool 🦀 🏠 - Rust-based
rustcargo install --git https://github.com/ntheanh201/hyper-mcp-release-monitor-id-tool - mc-mcp 🦀 🏠 - Rust-based
rustcargo install --git https://github.com/metacontract/mc-mcp - mcp_ai_local_memory 📜 🏠 - A file management server using Model Context Protocol for AI local memory storage
filelocalhttpaigitnpm install mhappy78/mcp_ai_local_memory - mcp-datetime 🦀 🏠 - Simple Rust MCP server to provide the current date and time to LLMs.
rustmcpserverllmcargo install --git https://github.com/GeorgeHahn/mcp-datetime - mcp-server-rs-exploration 🦀 🏠 - Learning MCP in Rust
rustmcpmcp-servercargo install --git https://github.com/navahas/mcp-server-rs-exploration - mcp-demo 🐍 🏠 - Python-based
filehttpllmgitgithubpip install git+https://github.com/LittleFatz/mcp-demo - mcp-echo-server 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install devjiel/mcp-echo-server - mcp-server 🦀 🏠 - Playing with Model Context Protocol server(s)
rustservercargo install --git https://github.com/d747d/mcp-server - mcp-server-bridge 🏠 - A MCP Manager tool for managing all MCP servers and exporting your own combinations.
mcpservergit clone https://github.com/xuzhongpeng/mcp-server-bridge - mcp-server-flatfile 📘 🏠 📇 - TypeScript-based
apifilehttpmlgitnpm install FlatFilers/mcp-server-flatfile - mcp-server-implement 🐍 🏠 - Python-based
webfilehttpaigitpip install git+https://github.com/iamkaia/mcp-server-implement - mcp-server-learn 📘 🏠 📇 - An MCP server to get Weather details
apihttpgitgithubtypescriptnpm install adarshem/mcp-server-learn - mcp-server-port-cleaner 📜 🏠 - Use this MCP Server when you encounter 'EADDRINUSE' (Address already in use).
httpgitgithubjavascriptmcpnpm install BrightLin/mcp-server-port-cleaner - mcp-server-svgl 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install sam-trost/mcp-server-svgl - gitlab-mcp-server-tools 🐚 🏠 - Configuration, adapters, and troubleshooting tools for GitLab MCP server implementation
shellmcpservergit clone https://github.com/OneofGods/gitlab-mcp-server-tools - Masa1984a/jrhokkaidotraininfo 🏠 - Provides real-time train operation information for JR Hokkaido, including delays and cancellations, across various regions.
httpaigitgithub - mcp-sever-google-sheets 🐍 🏠 - Python-based
httpmlgitgithubpythonpip install git+https://github.com/Aryan1718/mcp-sever-google-sheets - my-mcp-lab 🐍 🏠 - Python-based
httpmlgitgithubpythonpip install git+https://github.com/helebest/my-mcp-lab - poemcp 🦀 🏠 - Rust MCP Server
rustipaddressmcpmcp-serverpoemcargo install --git https://github.com/RGGH/poemcp - mcp-setup 🐚 🏠 - Model Context Protocol (MCP) setup with custom prompts and tools
shellmcpgit clone https://github.com/deffgod/mcp-setup - nguyendinhsinh361/supergateway-sinhnd 🏠 ☁️ - Supergateway facilitates running MCP stdio-based servers over SSE or WebSockets, enabling seamless remote access and integration with web-based clients.
webremotewebsockethttpml - OpenSourceGuru776/consist 🏠 - Markdownify transforms diverse file types and web content into Markdown format, enhancing readability and shareability.
webfilehttpgitgithub - paperscraper-MCP-Server 🏠 - A MCP Server for paperscraper:Tools to scrape publication metadata from pubmed, arxiv, medrxiv, biorxiv and chemrxiv.
mcpservergit clone https://github.com/JackKuo666/paperscraper-MCP-Server - repo-created-using-mcp-server 🏠 - Repository created using GitHub MCP tools
mcpgit clone https://github.com/jayant-vashisth/repo-created-using-mcp-server - RIMS-MCP 🐍 🏠 - RIMSの情報を取得するMCPサーバ (Python-based)
httpgitgithubpythonmcppip install git+https://github.com/rims-dev/RIMS-MCP - roo-code-custom-mode-editor-mcp-server 📜 🏠 - An MCP server that knows how to edit the Roo Code custom modes file
filehttpgitgithubjavascriptnpm install raymondlowe/roo-code-custom-mode-editor-mcp-server - rust-mcp-example 🦀 🏠 - Basic MCP server example using rmcp crate (requires rustup nightly)
rustmcpservercargo install --git https://github.com/drewstaylor/rust-mcp-example - skeet-build/skeet-local 📘 🏠 - Facilitates seamless integration and configuration of Skeet MCP tools for database and search operations.
databaselocalhttpmlgit - truto-mcp-stdio 🐹 🏠 - A CLI program that acts as a Stdio proxy for HTTP Streamable MCP servers. It reads newline-delimited JSON-RPC messages from stdin, forwards them to a specified MCP server endpoint via POST requests, and writes the responses to stdout.
httpjsongitgithubgogo install trutohq/truto-mcp-stdio@latest - simple-mcp 🦀 🏠 - A Simple MCP Server for personal experimentation
rustmcpservercargo install --git https://github.com/cirego/simple-mcp - slavahatnuke/octolis-tech-support 🏠 - Facilitates technical support operations through MCP server configurations.
httpgitgithub - whois-mcp ☕ 🏠 - MCP Server for whois lookups
httpgitgithubjavaclaudegit clone https://github.com/ASJordi/whois-mcp - sqlite-anet-mcp 🦀 🏠 - SQLite-Anet-MCP Server A blazing-fast, Rust-powered SQLite server for AI agents—speak JSON-RPC, store insights, and manage your database like a pro.
rustmcpserverdatabaseaicargo install --git https://github.com/marekkucak/sqlite-anet-mcp - TeamDman_mcp-server-hello 🦀 🏠 - Mirror of https://github.com/TeamDman/mcp-server-hello
rustmcpserverhttpcargo install --git https://github.com/MCP-Mirror/TeamDman_mcp-server-hello - Twinic-server 🏠 - configure mcp servers directly from prompt
httpgitgithubmcpservergit clone https://github.com/twinic/Twinic-server - va99/napier 🏠 📇 - Napier facilitates the installation of MCP servers through prompt-based commands, streamlining the setup process for npm and PyPi hosted servers.
apihttpmlgitgithub - veithly/ipfs-uploader 🏠 - A TypeScript-based MCP server for uploading images to IPFS, featuring a simple notes system with text note creation and summarization tools.
httpgitgithub - version_checker_mcp 📘 🏠 - TypeScript-based
httpaigitgithubtypescriptnpm install ai-wes/version_checker_mcp - yonaka15_mcp-server-runner 🦀 🏠 - Mirror of https://github.com/yonaka15/mcp-server-runner
rustmcpserverhttpcargo install --git https://github.com/MCP-Mirror/yonaka15_mcp-server-runner - zed-brave-search-context-server 🦀 🏠 - Adds the Brave Search MCP server to Zed's assistant panel.
rustmcpservercargo install --git https://github.com/reecelikesramen/zed-brave-search-context-server - mcp_rs_test 🦀 🏠 - MCP server implementation in Rust
rustmodel-context-protocolmcpservercargo install --git https://github.com/andrewsah/mcp_rs_test
📦 Other
- github-mcp-server 🐹 🏠 📇 (⭐ 22.3k, 🍴 2.5k, 🐛 253) - GitHub's official MCP Server
apihttpgitgithubgogo install github/github-mcp-server@latest - Figma-Context-MCP 📘 🏠 (⭐ 10.5k, 🍴 842, 🐛 40) - MCP server to provide Figma layout information to AI coding agents like Cursor
httpgitgithubtypescriptainpm install GLips/Figma-Context-MCP - awesome-mcp-clients 🏠 (⭐ 5.6k, 🍴 420, 🐛 43) - A collection of MCP clients.
clientsmcpgit clone https://github.com/punkpeye/awesome-mcp-clients - mcp-server-cloudflare 📘 🏠 (⭐ 2.9k, 🍴 251, 🐛 28) - TypeScript-based
httpgitgithubtypescriptnpm install cloudflare/mcp-server-cloudflare - mcp-server-chart 📘 🏠 (⭐ 2.7k, 🍴 247, 🐛 19) - 🤖 A visualization mcp contains 25+ visual charts using @antvis. Using for chart generation and data analysis.
httpgitgithubtypescriptantvnpm install antvis/mcp-server-chart - mcp-obsidian 🐍 🏠 📇 (⭐ 1.9k, 🍴 239, 🐛 52) - MCP server that interacts with Obsidian via the Obsidian rest API community plugin
filehttpgitgithubpythonpip install git+https://github.com/MarkusPfundstein/mcp-obsidian - mcp-obsidian 📜 🏠 (⭐ 1.1k, 🍴 77, 🐛 16) - A connector for Claude Desktop to read and search an Obsidian vault.
httpgitgithubjavascriptainpm install calclavia/mcp-obsidian - ElevenLabs 🐍 🏠 (⭐ 966, 🍴 148) - The official ElevenLabs MCP server
httpgitgithub - mcp-unity 🔷 🏠 (⭐ 948, 🍴 118, 🐛 3) - Model Context Protocol (MCP) plugin to connect with Unity Editor — designed for OpenAI, Gemini, Claude, Deepseek and Grok interoperability
httpgitgithubc#aigit clone https://github.com/CoderGamester/mcp-unity - awesome-mcp-list 🏠 (⭐ 826, 🍴 68, 🐛 13) - A concise list for mcp servers
mcpservergit clone https://github.com/MobinX/awesome-mcp-list - mcp-notion-server 📘 🏠 📇 (⭐ 817, 🍴 140, 🐛 14) - TypeScript-based
apihttpgitgithubtypescriptnpm install suekou/mcp-notion-server - iMCP 🦉 🏠 (⭐ 802, 🍴 31, 🐛 16) - A macOS app that provides an MCP server to your Messages, Contacts, Reminders and more
swiftmacosmcpserverhttpgit clone https://github.com/loopwork-ai/iMCP - mcp-marketplace 🏠 (⭐ 711, 🍴 58, 🐛 412) - This is the official repository for submitting MCP servers to be included in Cline's MCP Marketplace. If you’ve built an MCP server and want it to be discoverable and easily installable by millions of developers using Cline, submit your server here.
mcpservergit clone https://github.com/cline/mcp-marketplace - server 🐘 🏠 (⭐ 627, 🍴 43, 🐛 10) - Core PHP implementation for the Model Context Protocol (MCP) server
httpaimlgitgithubgit clone https://github.com/php-mcp/server - qgis_mcp 🐍 🏠 (⭐ 624, 🍴 84, 🐛 4) - Model Context Protocol (MCP) that allows LLMs to use QGIS Desktop
httpaigitgithubpythonpip install git+https://github.com/jjsantos01/qgis_mcp - 12306-mcp 📜 🏠 📇 (⭐ 544, 🍴 94, 🐛 3) - This is a 12306 ticket search server based on the Model Context Protocol (MCP).
apihttpgitgithubjavascriptnpm install Joooook/12306-mcp - mcp 🐍 🏠 (⭐ 527, 🍴 49, 🐛 32) - A MCP server for using Semgrep to scan code for security vulnerabilities.
httpgitgithubpythonmcppip install git+https://github.com/semgrep/mcp - mcp-get 📘 🏠 (⭐ 477, 🍴 99, 🐛 12) - TypeScript-based
httpgitgithubtypescriptnpm install michaellatman/mcp-get - spotify-mcp 🐍 🏠 (⭐ 471, 🍴 88, 🐛 16) - MCP to connect your LLM with Spotify.
httpgitgithubpythonmcppip install git+https://github.com/varunneal/spotify-mcp - mcp-server-weread 📜 🏠 (⭐ 455, 🍴 49, 🐛 10) - 微信读书MCP (Node.js-based)
httpmlgitgithubjavascriptnpm install freestylefly/mcp-server-weread - mcp-youtube 📜 🏠 (⭐ 437, 🍴 50, 🐛 10) - A Model-Context Protocol Server for YouTube
httpaigitgithubjavascriptnpm install anaisbetts/mcp-youtube - octocode-mcp 📘 🏠 (⭐ 424, 🍴 29, 🐛 2) - Code search analysys MCP
httpaigitgithubtypescriptnpm install bgauryy/octocode-mcp - laravel 🐘 🏠 (⭐ 391, 🍴 21, 🐛 8) - An SDK building Laravel MCP servers
httpmlgitgithubphpgit clone https://github.com/php-mcp/laravel - Unity-MCP 🔷 🏠 (⭐ 390, 🍴 40, 🐛 8) - MCP Server + Plugin for Unity Editor and Unity game. The Plugin allows to connect to MCP clients like Claude Desktop or others.
httpgitgithubc#aigit clone https://github.com/IvanMurzak/Unity-MCP - mcp-k8s-go 🐹 🏠 (⭐ 343, 🍴 47, 🐛 9) - MCP server connecting to Kubernetes
httpkubernetesgitgithubgogo install strowk/mcp-k8s-go@latest - mcp-server-youtube-transcript 📜 🏠 (⭐ 308, 🍴 52, 🐛 9) - This is an MCP server that allows you to directly download transcripts of YouTube videos.
httpgitgithubjavascriptmcpnpm install kimtaeyoon83/mcp-server-youtube-transcript - todoist-mcp-server 📜 🏠 (⭐ 307, 🍴 64, 🐛 15) - MCP server for Todoist integration enabling natural language task management with Claude
httpgitgithubjavascriptmcpnpm install abhiz123/todoist-mcp-server - biomcp 🐍 🏠 (⭐ 281, 🍴 41, 🐛 2) - BioMCP: Biomedical Model Context Protocol
databasehttpllmgitgithubpip install git+https://github.com/genomoncology/biomcp - edgeone-pages-mcp 📘 🏠 (⭐ 277, 🍴 32, 🐛 8) - An MCP service designed for deploying HTML content to EdgeOne Pages and obtaining an accessible public URL.
httpaimlgitgithubnpm install TencentEdgeOne/edgeone-pages-mcp - mcp-server-airbnb 📜 🏠 📇 (⭐ 272, 🍴 72, 🐛 5) - Node.js-based
apihttpaigitgithubnpm install openbnb-org/mcp-server-airbnb - mcp-server 🎯 🏠 (⭐ 265, 🍴 35, 🐛 15) - MCP Server for Burp (Kotlin-based)
kotlinextensionmcpserverhttpgit clone https://github.com/portswigger/mcp-server - win-cli-mcp-server 📜 🏠 (⭐ 246, 🍴 42, 🐛 7) - Model Context Protocol server for secure command-line interactions on Windows systems
httpgitgithubjavascriptclaudenpm install SimonB97/win-cli-mcp-server - ms-365-mcp-server 📘 🏠 📇 (⭐ 243, 🍴 77, 🐛 6) - A Model Context Protocol (MCP) server for interacting with Microsoft 365 and Office services through the Graph API
apifilehttpaigitnpm install softeria/ms-365-mcp-server - mcp-server-apple-shortcuts 📜 🏠 (⭐ 239, 🍴 25, 🐛 4) - Node.js-based
httpgitgithubjavascriptnpm install recursechat/mcp-server-apple-shortcuts - mettamatt/code-reasoning 📘 🏠 (⭐ 238, 🍴 21, 🐛 11) - Enhances Claude's problem-solving capabilities by breaking down complex programming tasks into manageable steps using structured, sequential thinking.
httpgitgithub - notion_mcp 🐍 🏠 📇 (⭐ 200, 🍴 52, 🐛 6) - A simple MCP integration that allows Claude to read and manage a personal Notion todo list
apihttpgitgithubpythonpip install git+https://github.com/danhilse/notion_mcp - Remote-MCP 📘 🏠 ☁️ (⭐ 198, 🍴 28, 🐛 9) - A type-safe solution to remote MCP communication, enabling effortless integration for centralized management of Model Context.
remotehttpmlgitgithubnpm install RemoteMCP/Remote-MCP - MetasploitMCP 🐍 🏠 (⭐ 181, 🍴 45, 🐛 1) - MCP Server for Metasploit
httpaigitgithubpythonpip install git+https://github.com/GH05TCREW/MetasploitMCP - BifrostMCP 📘 🏠 (⭐ 174, 🍴 32, 🐛 6) - VSCode Extension with an MCP server that exposes semantic tools like Find Usages and Rename to LLMs
httpgitgithubtypescriptclinenpm install biegehydra/BifrostMCP - CAD-MCP 🐍 🏠 (⭐ 168, 🍴 27) - CAD MCP Server (Python-based)
httpmlgitgithubpythonpip install git+https://github.com/daobataotie/CAD-MCP - mcp-mermaid 📘 🏠 (⭐ 166, 🍴 17, 🐛 1) - ❤️ Generate mermaid diagram and chart with AI MCP dynamically.
httpaigitgithubtypescriptnpm install hustcc/mcp-mermaid - opik-mcp 📘 🏠 (⭐ 165, 🍴 22, 🐛 3) - Model Context Protocol (MCP) implementation for Opik enabling seamless IDE integration and unified access to prompts, projects, traces, and metrics.
httpmlllmgitgithubnpm install comet-ml/opik-mcp - MCP-Kali-Server 🐍 🏠 📇 (⭐ 157, 🍴 28, 🐛 4) - MCP configuration to connect AI agent to a Linux machine.
apihttpaigitgithubpip install git+https://github.com/Wh0am123/MCP-Kali-Server - seo-mcp 🐍 🏠 (⭐ 154, 🍴 16, 🐛 3) - A free SEO tool MCP (Model Control Protocol) service based on Ahrefs data. Includes features such as backlinks, keyword ideas, and more.
httpgitgithubpythonmcppip install git+https://github.com/cnych/seo-mcp - BloodHound-MCP 🐍 🏠 (⭐ 153, 🍴 14) - Python-based
httpllmgitgithubpythonpip install git+https://github.com/stevenyu113228/BloodHound-MCP - facebook-ads-mcp-server 🐍 🏠 (⭐ 132, 🍴 30) - Python-based
httpaigitgithubpythonpip install git+https://github.com/gomarble-ai/facebook-ads-mcp-server - make-mcp-server 📘 🏠 (⭐ 131, 🍴 32, 🐛 5) - Make MCP Server (TypeScript-based)
httpaigitgithubtypescriptnpm install integromat/make-mcp-server - postman-mcp-server 📘 🏠 📇 (⭐ 129, 🍴 26, 🐛 7) - An MCP server that provides access to Postman.
apihttpgitgithubtypescriptnpm install delano/postman-mcp-server - Gitingest-MCP 🐍 🏠 (⭐ 117, 🍴 23, 🐛 3) - mcp server for gitingest
httpgitgithubpythonclaude-desktoppip install git+https://github.com/puravparab/Gitingest-MCP - mcp-servers-nix 🏠 (⭐ 117, 🍴 11, 🐛 5) - A Nix-based configuration framework for Model Control Protocol (MCP) servers with ready-to-use packages.
nixmcpservergit clone https://github.com/natsukium/mcp-servers-nix - awesome-crypto-mcp-servers 🏠 (⭐ 108, 🍴 10, 🐛 4) - A collection of crypto MCP servers.
mcpserverhttpgitgithubgit clone https://github.com/badkk/awesome-crypto-mcp-servers - jupyter-notebook-mcp 🏠 (⭐ 105, 🍴 21, 🐛 2) - A Model Context Protocol (MCP) for Jupyter Notebook
jupyter notebookmcphttpaigitgit clone https://github.com/jjsantos01/jupyter-notebook-mcp - MCppServer 🏠 (⭐ 102, 🍴 4, 🐛 1) - Fast and super efficient Minecraft Server written in C++
c++servergit clone https://github.com/Noeli14/MCppServer - dart-mcp 🐍 🏠 📇 (⭐ 101, 🍴 20, 🐛 3) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/2geonhyup/dart-mcp - esp-mcp 🐍 🏠 (⭐ 101, 🍴 10, 🐛 32) - Centralize ESP32 related commands and simplify getting started with seamless, LLM-driven interaction and help.
httpgitgithubpythonesp-idfpip install git+https://github.com/horw/esp-mcp - mcp-server-macos-use 🦉 🏠 📇 (⭐ 101, 🍴 13, 🐛 2) - AI agent that controls computer with OS-level tools, MCP compatible, works with any model
apihttpaigitgithubgit clone https://github.com/mediar-ai/mcp-server-macos-use - backlog-mcp-server 📘 🏠 (⭐ 99, 🍴 25, 🐛 2) - TypeScript-based
httpgitgithubtypescriptnpm install nulab/backlog-mcp-server - memory-mcp-server 🦉 🏠 (⭐ 96, 🍴 9) - A Model Context Protocol server that provides knowledge graph management capabilities.
swiftservergit clone https://github.com/okooo5km/memory-mcp-server - tiktok-mcp 📜 🏠 (⭐ 94, 🍴 16, 🐛 1) - Model Context Protocol (MCP) with TikTok integration
httpaigitgithubjavascriptnpm install Seym0n/tiktok-mcp - ebook-mcp 🐍 🏠 (⭐ 92, 🍴 15, 🐛 3) - A MCP server that supports mainstream eBook formats including EPUB, PDF and more. Simplify your eBook user experience with LLM.
localhttpaillmgitpip install git+https://github.com/onebirdrocks/ebook-mcp - node-code-sandbox-mcp 📘 🏠 (⭐ 92, 🍴 19, 🐛 12) - A Node.js–based Model Context Protocol server that spins up disposable Docker containers to execute arbitrary JavaScript.
httpdockeraigitgithubnpm install alfonsograziano/node-code-sandbox-mcp - flux-ui-mcp 📜 🏠 (⭐ 91, 🍴 15, 🐛 1) - Node.js-based
httpaigitgithubjavascriptnpm install iannuttall/flux-ui-mcp - MasterMCP 🐍 🏠 (⭐ 87, 🍴 7, 🐛 2) - A demonstration toolkit revealing potential security vulnerabilities in MCP (Model Context Protocol) frameworks through data poisoning, JSON injection, function overriding, and cross-MCP call attacks, exposing AI security issues while providing defense recommendations. For educational and research purposes only.
httpaigitgithubpythonpip install git+https://github.com/slowmist/MasterMCP - mcp-vegalite-server 🐍 🏠 (⭐ 86, 🍴 24, 🐛 3) - Python-based
httpgitgithubpythonpip install git+https://github.com/isaacwasserman/mcp-vegalite-server - SwiftMCP 🦉 🏠 (⭐ 85, 🍴 5, 🐛 1) - Model Context Protocol Server for Swift
swiftservergit clone https://github.com/Cocoanetics/SwiftMCP - molecule-mcp 🐍 🏠 (⭐ 80, 🍴 12, 🐛 4) - A model-context-protocol server for molecules.
httpaigitgithubpythonpip install git+https://github.com/ChatMol/molecule-mcp - elektron-mcp 🐍 🏠 (⭐ 79, 🍴 4, 🐛 3) - MCP sever for controlling Elektron devices using LLMs
httpllmgitgithubpythonpip install git+https://github.com/zerubeus/elektron-mcp - isaac-sim-mcp 🐍 🏠 (⭐ 79, 🍴 19, 🐛 4) - Isaac Simulation MCP Extension and Server
httpgitgithubpythonmcppip install git+https://github.com/omni-mcp/isaac-sim-mcp - radare2-mcp 🏠 (⭐ 78, 🍴 15, 🐛 3) - MCP stdio server for radare2
cmcpservergit clone https://github.com/dnakov/radare2-mcp - ssh-mcp 📜 🏠 ☁️ (⭐ 78, 🍴 10) - MCP server exposing SSH control for Linux servers via Model Context Protocol.
remotehttpgitgithubjavascriptnpm install tufantunc/ssh-mcp - mcp 📘 🏠 📇 (⭐ 77, 🍴 16, 🐛 2) - 🤖 Taskade MCP · Official MCP server and OpenAPI to MCP codegen. Build AI agent tools from any OpenAPI API and connect to Claude, Cursor, and more.
apihttpgitgithubainpm install taskade/mcp - codemirror-mcp 📘 🏠 (⭐ 76, 🍴 3) - CodeMirror extension to hook up a Model Context Provider (MCP)
httpaigitgithubtypescriptnpm install marimo-team/codemirror-mcp - sandbox-mcp 🐹 🏠 (⭐ 76, 🍴 12, 🐛 7) - A Model Context Protocol (MCP) server that enables LLMs to run ANY code safely in isolated Docker containers.
httpdockeraillmgitgo install pottekkat/sandbox-mcp@latest - jadx-mcp-plugin ☕ 🏠 📇 (⭐ 75, 🍴 9, 🐛 1) - Java-based
apihttpgitgithubjavagit clone https://github.com/mobilehackinglab/jadx-mcp-plugin - aws-security-mcp 🐍 🏠 (⭐ 74, 🍴 15, 🐛 1) - A Model Context Protocol server that connects AI assistants like Claude to AWS security services, allowing them to autonomously query, inspect, and analyze AWS infrastructure for security issues and misconfigurations.
httpawsaigitgithubpip install git+https://github.com/groovyBugify/aws-security-mcp - auth0-mcp-server 📘 🏠 (⭐ 73, 🍴 20, 🐛 10) - TypeScript-based
authhttpaillmgitnpm install auth0/auth0-mcp-server - alibaba-cloud-ops-mcp-server 🐍 🏠 📇 (⭐ 72, 🍴 19, 🐛 6) - AlibabaCloud CloudOps MCP Server
httpgitgithubpythonalibabacloudpip install git+https://github.com/aliyun/alibaba-cloud-ops-mcp-server - pocketbase-mcp 📜 🏠 📇 (⭐ 72, 🍴 20, 🐛 4) - MCP server for building PocketBase apps really quickly - Need a front end quick consider FastPocket
apidatabasehttpgitgithubnpm install mrwyndham/pocketbase-mcp - lara-mcp 📘 🏠 📇 (⭐ 69, 🍴 11, 🐛 1) - TypeScript-based
apihttpgitgithubtypescriptnpm install translated/lara-mcp - mcp-memory-bank 🐍 🏠 (⭐ 69, 🍴 12) - MCP server that helps build Memory Bank - structured documentation system for context preservation
httpaigitgithubpythonpip install git+https://github.com/ipospelov/mcp-memory-bank - mcp-server 🐍 🏠 📇 (⭐ 68, 🍴 18, 🐛 3) - Model Context Protocol (MCP) Server for the Keboola Platform
httpgitgithubanalyticspythonpip install git+https://github.com/keboola/keboola-mcp-server - office-editor-mcp 🐍 🏠 (⭐ 66, 🍴 12, 🐛 6) - 基于MCP(Model Context Protocol)的Office文档处理助手,支持在MCP Client中创建和编辑Word、Excel、Powerpoint文档。
httpmlgitgithubpythonpip install git+https://github.com/theWDY/office-editor-mcp - kdqed/zaturn 🐍 🏠 (⭐ 65, 🍴 7) - Zaturn is an AI-powered data analytics and business intelligence tool that connects to various data sources, executes SQL queries, and provides insightful visualizations, all integrated as an MCP server.
httpaigitgithubanalytics - amap-mcp-server 🐍 🏠 📇 (⭐ 65, 🍴 11, 🐛 6) - 高德地图MCP Server,支持stdio, sse和streamable-http
apihttpgitgithubpythonpip install git+https://github.com/sugarforever/amap-mcp-server - mcp_sse 🏠 📇 (⭐ 64, 🍴 17, 🐛 2) - An elixir Model Context Protocal (MCP) server library which uses the Server-Sent Events (SSE) transport type
elixirmcpserverapihttpgit clone https://github.com/kEND/mcp_sse - MCPhoenix 🏠 (⭐ 64, 🍴 5) - A simplified implementation of the Model Context Protocol (MCP) server using Elixir's Phoenix Framework.
elixirmcpservergit clone https://github.com/jmanhype/MCPheonix - health-record-mcp 📘 🏠 (⭐ 62, 🍴 21, 🐛 1) - Connect to an EHR and make clinical data available via MCP
httpaigitgithubtypescriptnpm install jmandel/health-record-mcp - octagon-mcp-server 📜 🏠 (⭐ 61, 🍴 11, 🐛 4) - A free MCP server to analyze and extract insights from public filings, earnings transcripts, financial metrics, stock market data, private market transactions, and deep web-based research within Claude Desktop and other popular MCP clients.
httpaigitgithubjavascriptnpm install OctagonAI/octagon-mcp-server - devto-mcp 🐍 🏠 (⭐ 60, 🍴 10, 🐛 2) - MCP Server of DevTo (Python-based)
httpaigitgithubpythonpip install git+https://github.com/Arindam200/devto-mcp - railway-mcp 📘 🏠 (⭐ 60, 🍴 28, 🐛 5) - An unofficial and community-built MCP server for integrating with https://railway.app
httpaimlgitgithubnpm install jason-tan-swe/railway-mcp - searchAPI-mcp 🐍 🏠 📇 (⭐ 58, 🍴 4, 🐛 4) - SearchAPI MCP for Google searches
apihttpaigitgithubpip install git+https://github.com/RmMargt/searchAPI-mcp - QuickMCP 🔷 🏠 📇 (⭐ 57, 🍴 4, 🐛 1) - Effortlessly Build Model Context Protocol Servers with OpenAPI or Swagger or Google Discovery Specifications
apihttpgitgithubc#git clone https://github.com/gunpal5/QuickMCP - ExternalAttacker-MCP 🐍 🏠 (⭐ 56, 🍴 15) - A modular external attack surface mapping tool integrating tools for automated reconnaissance and bug bounty workflows.
httpaigitgithubpythonpip install git+https://github.com/MorDavid/ExternalAttacker-MCP - mcp 📘 🏠 📇 (⭐ 56, 🍴 11, 🐛 2) - can your ai run anything? yes it can
httpaigitgithubtypescriptnpm install pkgxdev/mcp - arxiv-latex-mcp 🐍 🏠 (⭐ 55, 🍴 5, 🐛 3) - MCP server that uses arxiv-to-prompt to fetch and process arXiv LaTeX sources for precise interpretation of mathematical expressions in scientific papers.
httpgitgithubpythonarxivpip install git+https://github.com/takashiishida/arxiv-latex-mcp - mcp-clojure-sdk 🏠 (⭐ 54, 🍴 7) - A Clojure SDK to create MCP servers (and eventually clients)
clojuremcpservergit clone https://github.com/unravel-team/mcp-clojure-sdk - MCP-PIF 🏠 (⭐ 54, 🍴 14, 🐛 3) - A MCP implementation of the personal intelligence framework (PIF) in ClojureScript. Work in progress.
clojuremcpfilehttpaigit clone https://github.com/hungryrobot1/MCP-PIF - ssh-mcp-server 📘 🏠 ☁️ (⭐ 52, 🍴 13, 🐛 3) - 基于 SSH 的 MCP 服务器 (TypeScript-based)
remotehttpaigitgithubnpm install classfang/ssh-mcp-server - Mureka-mcp 🐍 🏠 (⭐ 51, 🍴 8, 🐛 1) - generate lyrics, song and background music(instrumental). Model Context Protocol (MCP) server.
httpaimlopenaigitpip install git+https://github.com/SkyworkAI/Mureka-mcp - astro-mcp 🏠 (⭐ 50, 🐛 3) - MCP server to support Astro project development
astromcpmodelcontextprotocolservergit clone https://github.com/morinokami/astro-mcp - mcps 🐍 🏠 (⭐ 50, 🍴 19, 🐛 1) - Python-based
databasehttpaigitgithubpip install git+https://github.com/gosset-ai/mcps - tabby-mcp-server 📘 🏠 (⭐ 47, 🍴 3, 🐛 1) - MCP server for control Tabby terminal
httpaigitgithubtypescriptnpm install thuanpham582002/tabby-mcp-server - hloiseaufcms/mcp-gopls 🐹 🏠 (⭐ 45, 🍴 5, 🐛 1) - Facilitates AI assistants' interaction with Go's Language Server Protocol for enhanced code analysis and navigation.
httpaigitgithub - mcp-openapi-schema-explorer 📘 🏠 ☁️ 📇 (⭐ 45, 🍴 8, 🐛 2) - MCP server providing token-efficient access to OpenAPI/Swagger specs via MCP Resources for client-side exploration.
apihttpaigitgithubnpm install kadykov/mcp-openapi-schema-explorer - houdini-mcp 🏠 (⭐ 45, 🍴 3, 🐛 3) - Houdini integration through the Model Context Protocol
git clone https://github.com/capoom/houdini-mcp - Nocodb-MCP-Server 📜 🏠 (⭐ 44, 🍴 15) - nocodb mcp server (Node.js-based)
databasehttpmlgitgithubpip install git+https://github.com/granthooks/Nocodb-MCP-Server - tripadvisor-mcp 🐍 🏠 📇 (⭐ 44, 🍴 10, 🐛 3) - A Model Context Protocol (MCP) server for Tripadvisor Content API. This provides access to Tripadvisor location data, reviews, and photos through standardized MCP interfaces, allowing AI assistants to search for travel destinations and experiences.
httpaigitgithubpythonpip install git+https://github.com/pab1it0/tripadvisor-mcp - awesome-medical-mcp-servers 🏠 (⭐ 42, 🍴 3, 🐛 1) - A collection of Medical MCP servers.
mcpservergit clone https://github.com/sunanhe/awesome-medical-mcp-servers - finData-mcp-server 🐍 🏠 (⭐ 42, 🍴 9, 🐛 2) - FinData enables your AI agents retrieve financial data from different providers like Tushare, Wind, and DataYes.
httpaigitgithubpythonpip install git+https://github.com/zlinzzzz/finData-mcp-server - imagen3-mcp 🦀 🏠 📇 (⭐ 42, 🍴 7, 🐛 5) - Rust-based
apihttpgitgithubrustcargo install --git https://github.com/hamflx/imagen3-mcp - coinmarket-mcp-server 🐍 🏠 📇 (⭐ 40, 🍴 14, 🐛 2) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/anjor/coinmarket-mcp-server - jimeng-mcp 📘 🏠 (⭐ 39, 🍴 12, 🐛 6) - TypeScript-based
httpaigitgithubtypescriptnpm install c-rick/jimeng-mcp - naver-search-mcp 📘 🏠 📇 (⭐ 39, 🍴 14) - MCP server for Naver Search API integration. Provides comprehensive search capabilities across Naver services (web, news, blog, shopping, etc) and data trend analysis tools via DataLab API.
apihttpgitgithubtypescriptnpm install isnow890/naver-search-mcp - keep-mcp 🐍 🏠 (⭐ 38, 🍴 16, 🐛 3) - MCP server for Google Keep
httpgitgithubpythonmcppip install git+https://github.com/feuerdev/keep-mcp - mcp-clj 🏠 (⭐ 38, 🍴 6, 🐛 2) - A MCP server written in clojure
clojuremcpservergit clone https://github.com/hugoduncan/mcp-clj - mcp-nomad 🐹 🏠 (⭐ 37, 🍴 7, 🐛 1) - A nomad MCP Server (modelcontextprotocol)
httpmlgitgithubmonitoringgo install kocierik/mcp-nomad@latest - openrpc-mpc-server 📜 🏠 📇 (⭐ 37, 🍴 12, 🐛 4) - A Model Context Protocol (MCP) server that provides JSON-RPC functionality through OpenRPC.
httpjsongitgithubjavascriptnpm install shanejonas/openrpc-mpc-server - mcp-open-library 📘 🏠 📇 (⭐ 35, 🍴 10) - A Model Context Protocol (MCP) server for the Internet Archive's Open Library API that enables AI assistants to search for book and author information.
apiauthhttpaigitnpm install 8enSmith/mcp-open-library - UNS-MCP 🏠 (⭐ 35, 🍴 18, 🐛 1)
jupyter notebookhttpgitgithubgit clone https://github.com/Unstructured-IO/UNS-MCP - hex-mcp 🏠 (⭐ 35, 🍴 1, 🐛 1) - MCP Server for Hex Package Versions
elixirmcpserverpythongit clone https://github.com/9elements/hex-mcp - buildkite-mcp-server 🐹 🏠 (⭐ 34, 🍴 15, 🐛 9) - Official MCP Server for Buildkite.
httpgitgithubgobuildkitego install buildkite/buildkite-mcp-server@latest - mcp-amadeus 🐍 🏠 📇 (⭐ 34, 🍴 11) - Amadeus MCP(Model Context Protocol) Server
apihttpgitgithubpythonpip install git+https://github.com/donghyun-chae/mcp-amadeus - mcp-twitter 🐍 🏠 📇 (⭐ 34, 🍴 8, 🐛 1) - Manage your twitter account using mcp
httpgitgithubpythonmcppip install git+https://github.com/LuniaKunal/mcp-twitter - computer-control-mcp 🐍 🏠 📇 (⭐ 33, 🍴 4) - MCP server that provides computer control capabilities, like mouse, keyboard, OCR, etc. using PyAutoGUI, RapidOCR, ONNXRuntime. Similar to 'computer-use' by Anthropic. With Zero External Dependencies.
apihttpgitgithubpythonpip install git+https://github.com/AB498/computer-control-mcp - keycloak-model-context-protocol 📘 🏠 (⭐ 31, 🍴 9, 🐛 3) - MCP server implementation for Keycloak user management. Enables AI-powered administration of Keycloak users and realms through the Model Context Protocol (MCP). Seamlessly integrates with Claude Desktop and other MCP clients for automated user operations.
httpgitgithubtypescriptai-toolsgit clone https://github.com/ChristophEnglisch/keycloak-model-context-protocol - producthunt-mcp-server 🐍 🏠 📇 (⭐ 31, 🍴 8, 🐛 4) - Python-based
apihttpaimlllmpip install git+https://github.com/jaipandya/producthunt-mcp-server - jlcpcb-parts-mcp 🐍 🏠 (⭐ 31, 🍴 4, 🐛 2) - JLCPCB PCBA向けの、部品探しを補助するためのMCPサーバー
httpgitgithubpythonjlcpcbpip install git+https://github.com/nvsofts/jlcpcb-parts-mcp - spring-rest-to-mcp ☕ 🏠 📇 (⭐ 31, 🍴 8, 🐛 1) - Convert Spring REST API to MCP Server with OpenRewrite
apiwebresthttpaigit clone https://github.com/addozhang/spring-rest-to-mcp - GitHubMCP ☕ 🏠 (⭐ 29, 🍴 4) - Java-based
httpllmgitgithubjavagit clone https://github.com/stephanj/GitHubMCP - codelogic-mcp-server 🐍 🏠 (⭐ 28, 🍴 11, 🐛 6) - An MCP Server to utilize Codelogic's rich software dependency data in your AI programming assistant.
httpaigitgithubpythonpip install git+https://github.com/CodeLogicIncEngineering/codelogic-mcp-server - kanban-mcp 📘 🏠 📇 (⭐ 28, 🍴 9, 🐛 3) - MCP server providing kanban-based task management memory for complex multi-session workflows with AI agents
httpaigitgithubtypescriptnpm install eyalzh/kanban-mcp - mcp-obsidian 📘 🏠 📇 (⭐ 28, 🍴 22, 🐛 3) - MCP server for Obsidian (TypeScript + Bun)
apilocalresthttpainpm install fazer-ai/mcp-obsidian - Outlook_Calendar_MCP 🏠 (⭐ 28, 🍴 8, 🐛 9) - A Model Context Protocol (MCP) server that allows Claude to access and manage your local Microsfot Outlook calendar (Windows only).
vbscriptmcpservergit clone https://github.com/merajmehrabi/Outlook_Calendar_MCP - directus-mcp-server 📘 🏠 📇 (⭐ 28, 🍴 4, 🐛 1) - Model Context Protocol server for Directus
apihttpaimlgitnpm install rijkvanzanten/directus-mcp-server - apple-books-mcp 🐍 🏠 (⭐ 27, 🍴 4, 🐛 1) - Apple Books MCP Server
httpgitgithubpythonaipip install git+https://github.com/vgnshiyer/apple-books-mcp - bluesky-context-server 📘 🏠 📇 (⭐ 27, 🍴 7, 🐛 1) - Bluesky MCP server (TypeScript-based)
apihttpgitgithubtypescriptnpm install keturiosakys/bluesky-context-server - qiniu-mcp-joe 🐍 🏠 (⭐ 27, 🍴 2) - AI写的七牛上传MCP,以后各种音频图片上传都可以传上去引用,方便很多。
filehttpmlgitgithubpip install git+https://github.com/joeseesun/qiniu-mcp-joe - iotdb-mcp-server 🐍 🏠 (⭐ 27, 🍴 13, 🐛 3) - Apache IoTDB MCP Server
databasehttpgitgithubpythonpip install git+https://github.com/apache/iotdb-mcp-server - trade-agent-mcp 🏠 (⭐ 27, 🍴 2) - Guide to connect to Trade Agent's MCP server and trade stocks and crypto
mcpservergit clone https://github.com/PortFray/trade-agent-mcp - wealthy-mcp 🐹 🏠 (⭐ 27, 🍴 8) - Wealthy-MCP (Go-based)
httpmlgitgithubgogo install wealthy/wealthy-mcp@latest - archy-mcp 📘 🏠 (⭐ 26, 🍴 6, 🐛 2) - TypeScript-based
httpaigitgithubtypescriptnpm install phxdev1/archy-mcp - mcp-badges 🏠 (⭐ 26, 🍴 2) - Get your projects MCP (Model Context Protocol) badges
mcphttpgitgithubgit clone https://github.com/mcpx-dev/mcp-badges - ancestry-mcp 🐍 🏠 📇 (⭐ 25, 🍴 5) - Ancestry MCP server made with Python that allows interactability with .ged (GEDCOM) files
apifilehttpgitgithubpip install git+https://github.com/reeeeemo/ancestry-mcp - apollo-io-mcp-server 📘 🏠 📇 (⭐ 25, 🍴 10, 🐛 4) - MCP server that exposes the Apollo.io API functionalities as tools
apihttpgitgithubpythonpip install git+https://github.com/edwardchoh/apollo-io-mcp-server - PixVerse-MCP 🐍 🏠 📇 (⭐ 25, 🍴 6, 🐛 1) - Official PixVerse Model Context Protocol (MCP) server that enables interaction with powerful AI video generation APIs.
httpaimlgitgithubpip install git+https://github.com/PixVerseAI/PixVerse-MCP - bonk-mcp 🐍 🏠 (⭐ 24, 🍴 7, 🐛 1) - Python-based
httpaigitgithubpythonpip install git+https://github.com/letsbonk-ai/bonk-mcp - MCPDocSearch 🐍 🏠 (⭐ 24, 🍴 12, 🐛 3) - This project provides a toolset to crawl websites wikis, tool/library documentions and generate Markdown documentation, and make that documentation searchable via a Model Context Protocol (MCP) server, designed for integration with tools like Cursor.
webhttpgitgithubpythonpip install git+https://github.com/alizdavoodi/MCPDocSearch - task-manager-mcp 🐍 🏠 (⭐ 24, 🍴 4, 🐛 1) - A task management MCP server that provides comprehensive project and task tracking capabilities
httpaigitgithubpythonpip install git+https://github.com/tradesdontlie/task-manager-mcp - a11y-mcp 📜 🏠 (⭐ 23, 🍴 6, 🐛 1) - An MCP (Model Context Protocol) server for performing accessibility audits on webpages using axe-core. Use the results in an agentic loop with your favorite AI assistants (Amp/Cline/Cursor/GH Copilot) and let them fix a11y issues for you!
webhttpaimlgitnpm install priyankark/a11y-mcp - globalping-mcp-server 📘 🏠 (⭐ 23, 🍴 2, 🐛 2) - Remote MCP server that gives LLMs access to run network commands
httpgitgithubtypescriptmcpnpm install jsdelivr/globalping-mcp-server - mcp-servers-registry 🏠 (⭐ 23, 🍴 10) - Repository holding sources for all mcp-servers managed by Acuvity
open policy agentmcpservergit clone https://github.com/acuvity/mcp-servers-registry - textin-mcp 📜 🏠 📇 (⭐ 23, 🍴 4, 🐛 2) - Node.js-based
httpgitgithubjavascriptapinpm install intsig-textin/textin-mcp - UnrealMCPBridge 🐍 🏠 📇 (⭐ 23, 🍴 5, 🐛 2) - An Unreal Engine plugin that implements an MCP server allowing MCP clients to access the UE Editor Python API.
apihttpgitgithubpythonpip install git+https://github.com/appleweed/UnrealMCPBridge - altium-mcp 🏠 📇 (⭐ 22, 🍴 6, 🐛 1) - Altium Model Context Protocol server and Altium API script
httpgitgithubpascalservergit clone https://github.com/coffeenmusic/altium-mcp - bocha-search-mcp 🐍 🏠 (⭐ 22, 🍴 6, 🐛 1) - Bocha Search MCP Server.
webhttpaigitgithubpip install git+https://github.com/BochaAI/bocha-search-mcp - code-merge-mcp 📜 🏠 (⭐ 22, 🍴 6) - Node.js-based
filehttpgitgithubjavascriptnpm install yy1588133/code-merge-mcp - json2video-mcp-server 📜 🏠 📇 (⭐ 22, 🍴 1) - Message Communication Protocol server for json2video API integration
apihttpjsonmlllmnpm install omergocmen/json2video-mcp-server - indian-railway-mcp 📘 🏠 (⭐ 21, 🍴 2, 🐛 3) - MCP server for Indian Railway data. Search trains, check seat availability, get live statuses, delay info, station/train codes, and more — all via a simple Claude Desktop integration.
httpaimlgitgithubnpm install amith-vp/indian-railway-mcp - kaggle-mcp 🐍 🏠 📇 (⭐ 21, 🍴 5, 🐛 1) - MCP server for Kaggle
httpgitgithubpythonkagglepip install git+https://github.com/arrismo/kaggle-mcp - mcp-server-bash 🐚 🏠 (⭐ 21, 🍴 2) - minimalistic MCP server written in bash script
shellmcpservergit clone https://github.com/antonum/mcp-server-bash - mitre-attack-mcp 🐍 🏠 (⭐ 21, 🍴 6) - Python-based
httpgitgithubpythonpip install git+https://github.com/stoyky/mitre-attack-mcp - ast-mcp-server 🐍 🏠 (⭐ 20, 🍴 4) - AST/ASG Code Analysis MCP Server
httpgitgithubpythonasgpip install git+https://github.com/angrysky56/ast-mcp-server - CMD-MCP-Server 📜 🏠 (⭐ 20, 🍴 8, 🐛 2) - MCP server for executing CMD commands. Can be hooked to claude for additional agentics.
httpgitgithubjavascriptmcpnpm install phialsbasement/cmd-mcp-server - directus-mcp 📘 🏠 📇 (⭐ 20, 🍴 7, 🐛 5) - MCP server for Directus API integration
apihttpaimlgitnpm install pixelsock/directus-mcp - mcp-cli 🐍 🏠 📇 (⭐ 20, 🍴 2, 🐛 1) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/Deniscartin/mcp-cli - mcp-proxy 🦀 🏠 (⭐ 20, 🍴 8, 🐛 1) - Fast rust MCP proxy between stdio and SSE
httpgitgithubrustagentscargo install --git https://github.com/stephenlacy/mcp-proxy - pocketbase-mcp 📘 🏠 (⭐ 20, 🍴 5, 🐛 2) - This is an MCP server that interacts with a PocketBase instance. It allows you to fetch, list, create, update, and manage records and files in your PocketBase collections.
filehttpgitgithubtypescriptnpm install mabeldata/pocketbase-mcp - mcp-kql-server 🐍 🏠 (⭐ 19, 🍴 4) - Kusto and Log Analytics MCP server help you execute a KQL (Kusto Query Language) query within an AI prompt, analyze, and visualize the data.
authhttpazureaigitpip install git+https://github.com/4R9UN/mcp-kql-server - mcp-soccer-data 🐍 🏠 📇 (⭐ 19, 🍴 6) - An MCP server that provides real-time football data based on the SoccerDataAPI.
apihttpgitgithubpythonpip install git+https://github.com/yeonupark/mcp-soccer-data - OSV-MCP 🐹 🏠 (⭐ 19, 🍴 4, 🐛 1) - OSV MCP server implementation
databasehttpaigitgithubpip install git+https://github.com/EdenYavin/OSV-MCP - heybeauty-mcp 📜 🏠 📇 (⭐ 19, 🍴 5, 🐛 3) - HeyBeauty MCP Server for Virtual TryOn
apihttpgitgithubjavascriptnpm install chatmcp/heybeauty-mcp - entraid-mcp-server 🐍 🏠 📇 (⭐ 18, 🍴 6, 🐛 2) - MCP server for interacting with EntraID through Microsoft Graph API.
apihttpaigitgithubpip install git+https://github.com/hieuttmmo/entraid-mcp-server - mcp-writer-substack 🐍 🏠 (⭐ 18, 🍴 2, 🐛 1) - Model Context Protocol to bridge in Substack writings to Claude.
httpgitgithubpythonpip install git+https://github.com/jean-technologies/mcp-writer-substack - openmcp-tutorial 🏠 (⭐ 18, 🍴 4) - tutorial for mcp server development
cssmcpservergit clone https://github.com/LSTM-Kirigaya/openmcp-tutorial - mcp_godot_rag 🐍 🏠 (⭐ 18, 🍴 3, 🐛 1) - This MCP server is used to provide Godot documentation to the Godot RAG model.
httpgitgithubpythonmcppip install git+https://github.com/weekitmo/mcp_godot_rag - arm64-mcpelauncher-server 🏠 (⭐ 17, 🍴 3) - Minecraft Bedrock Edition BDS-like server for aarch64 devices like raspi
c++servergit clone https://github.com/LNSSPsd/arm64-mcpelauncher-server - cos-mcp 📘 🏠 (⭐ 17, 🍴 7) - 基于 MCP 协议的腾讯云 COS MCP Server,无需编码即可让大模型快速接入腾讯云存储 (COS) 和数据万象 (CI) 能力。
httpmlgitgithubtypescriptnpm install Tencent/cos-mcp - MalwareBazaar_MCP 🐍 🏠 (⭐ 17, 🍴 7) - An AI-driven MCP server that autonomously interfaces with Malware Bazaar, delivering real-time threat intel and sample metadata for authorized cybersecurity research workflows.
httpaigitgithubpythonpip install git+https://github.com/mytechnotalent/MalwareBazaar_MCP - mcp_nuclei_server 🐍 🏠 (⭐ 17, 🍴 2, 🐛 2) - A Nuclei security scanning server based on MCP (Model Control Protocol), providing convenient vulnerability scanning services.一个基于 MCP (Model Control Protocol) 的 Nuclei 安全扫描服务器,提供便捷的漏洞扫描服务。
httpjsongitgithubpythonpip install git+https://github.com/crazyMarky/mcp_nuclei_server - mcp-terminal 🐍 🏠 (⭐ 17, 🍴 10, 🐛 1) - run and use mcp servers in your terminal
httpgitgithubtypescriptmcpnpm install GeLi2001/mcp-terminal - modbus-mcp 🐍 🏠 (⭐ 17, 🍴 6) - An MCP server that standardizes and contextualizes industrial Modbus data.
httpaimlgitgithubpip install git+https://github.com/kukapay/modbus-mcp - ecovacs-mcp 🐍 🏠 (⭐ 16, 🍴 3, 🐛 4) - Ecovacs MCP Server (Python-based)
httpaimlgitgithubpip install git+https://github.com/ecovacs-ai/ecovacs-mcp - github-repo-mcp 📜 🏠 (⭐ 16, 🍴 6, 🐛 1) - Model Context Protocol server for Github Repo // Reading Github Repo
httpaigitgithubjavascriptnpm install Ryan0204/github-repo-mcp - mcp-cerebra-legal-server 📘 🏠 (⭐ 16, 🍴 7, 🐛 1) - TypeScript-based
httpaigitgithubtypescriptnpm install yoda-digital/mcp-cerebra-legal-server - mcp-metricool 🐍 🏠 📇 (⭐ 16, 🍴 8, 🐛 1) - This is a Multi-Agent Collaboration Protocol (MCP) server for interacting with the Metricool API. It allows AI agents to access and analyze social media metrics and campaign data from your Metricool account.
apihttpaigitgithubpip install git+https://github.com/metricool/mcp-metricool - smartlead-mcp-server 📘 🏠 (⭐ 16, 🍴 5, 🐛 2) - Local version of Smartlead MCP for quick download and deployment to MCP compatible clients or n8n.
localhttpaimlgitnpm install jean-technologies/smartlead-mcp-server-local - awesome-mcp 📘 🏠 (⭐ 15, 🍴 4, 🐛 1) - A collection about MCP
mcpservertypescriptaiawesomegit clone https://github.com/iAmCorey/Awesome-MCP - hh-mcp-comfyui 🐍 🏠 📇 (⭐ 15, 🍴 2) - 基于Model Context Protocol (MCP)的ComfyUI图像生成服务,通过API调用本地ComfyUI实例生成图片,实现自然语言生图自由
localhttpgitgithubpythonpip install git+https://github.com/zjf2671/hh-mcp-comfyui - metabase-mcp 🐍 🏠 📇 (⭐ 15, 🍴 12, 🐛 2) - Metabase MCP server provides integration with the Metabase API, enabling LLM with MCP capabilites to directly interact with your analytics data, this server acts as a bridge between your analytics platform and conversational AI.
httpaimlgitgithubpip install git+https://github.com/cheukyin175/metabase-mcp - Offensive-MCP-AI 🐍 🏠 (⭐ 15, 🍴 6) - Python-based
httpaigitgithubpythonpip install git+https://github.com/CyberSecurityUP/Offensive-MCP-AI - opcua-mcp 🐍 🏠 (⭐ 15, 🍴 6, 🐛 3) - An MCP server that connects to OPC UA-enabled industrial systems.
httpaigitgithubmonitoringpip install git+https://github.com/kukapay/opcua-mcp - openehr-mcp-server 🐍 🏠 📇 (⭐ 15, 🍴 5, 🐛 2) - Python-based
apiresthttpaimlpip install git+https://github.com/deak-ai/openehr-mcp-server - strava-mcp-server 🐍 🏠 📇 (⭐ 15, 🍴 9, 🐛 4) - MCP server for Strava API integration
httpaigitgithubpythonpip install git+https://github.com/tomekkorbak/strava-mcp-server - code-context-provider-mcp 📜 🏠 (⭐ 14, 🍴 2) - MCP server that provides code context and analysis for AI assistants. Extracts directory structure and code symbols using WebAssembly Tree-sitter parsers with Zero Native Dependencies.
webhttpaigitgithubnpm install AB498/code-context-provider-mcp - mcp-server-template 📘 🏠 (⭐ 14, 🍴 9, 🐛 1) - A template for making an MCP server with TypeScript
httpaigitgithubjavascriptnpm install larryhudson/mcp-server-template - ClinicalTrials-MCP-Server 🐍 🏠 (⭐ 13, 🍴 6, 🐛 4) - 🔍 Enable AI assistants to search and access ClinicalTrials.gov data through a simple MCP interface.
httpaimlgitgithubpip install git+https://github.com/JackKuo666/ClinicalTrials-MCP-Server - Elementor-MCP 📜 🏠 (⭐ 13, 🍴 9, 🐛 1) - A simple MCP server for Wordpress Elementor
httpaigitgithubjavascriptnpm install aguaitech/Elementor-MCP - flights-mcp-server 🐍 🏠 (⭐ 13, 🍴 4, 🐛 2) - MCP Server for Google Flights !!
httpaigitgithubpythonpip install git+https://github.com/smamidipaka6/flights-mcp-server - Google-Flights-MCP-Server 🐍 🏠 (⭐ 13, 🍴 4, 🐛 1) - This MCP server provides tools to interact with Google Flights data using the bundled fast_flights library.
httpgitgithubpythonmcppip install git+https://github.com/opspawn/Google-Flights-MCP-Server - mcp-external-recon-server 🐍 🏠 (⭐ 13, 🍴 2) - An external reconnaissnce MCP server for offensive security engagements
httpaigitgithubpythonpip install git+https://github.com/naebo/mcp-external-recon-server - mcp-gameboy 📘 🏠 (⭐ 13, 🍴 6, 🐛 2) - A gameboy emulator for LLM's
webhttpllmgitgithubnpm install mario-andreschak/mcp-gameboy - mcp-ilert 🏠 (⭐ 13) - MCP server for ilert
mcpserverhttpgitgithubgit clone https://github.com/iLert/mcp-ilert - mcp-zap-server ☕ 🏠 📇 (⭐ 13, 🍴 1, 🐛 1) - A Spring Boot application exposing OWASP ZAP as an MCP (Model Context Protocol) server. It lets any MCP‑compatible AI agent (e.g., Claude Desktop, Cursor) orchestrate ZAP actions—spider, active scan, import OpenAPI specs, and generate reports.
httpaigitgithubjavagit clone https://github.com/dtkmn/mcp-zap-server - qasphere-mcp 📜 🏠 (⭐ 13, 🍴 5, 🐛 4) - MCP Server for QA Sphere TMS
httpaillmgitgithubnpm install Hypersequent/qasphere-mcp - variflight-mcp 🏠 (⭐ 13, 🍴 5, 🐛 1) - A Model Context Protocol (MCP) server implementation for Variflight services.
httpgitgithubmetricsmcpgit clone https://github.com/variflight/variflight-mcp - x-twitter-mcp-server 🐍 🏠 (⭐ 13, 🍴 7) - X/Twitter MCP server
httpaigitgithubpythonpip install git+https://github.com/rafaljanicki/x-twitter-mcp-server - consul-mcp-server 📘 🏠 (⭐ 12, 🍴 4, 🐛 1) - Consul MCP Server for Discovery and Mesh
httpaigitgithubtypescriptnpm install 3loka/consul-mcp-server - gis-dataconversion-mcp 📜 🏠 (⭐ 12, 🍴 3) - An MCP server for converting GIS filetypes (1000+ Downloads)
httpmlllmgitgithubnpm install ronantakizawa/gis-dataconvertersion-mcp - mcp-android-adb-server 🐹 🏠 (⭐ 12, 🍴 1, 🐛 1) - 通过AI大模型操作安卓设备 (Go-based)
httpgitgithubgoaigo install github-hewei/mcp-android-adb-server@latest - mcp-template 🦉 🏠 (⭐ 12, 🍴 3) - Barebones starting point for a new MCP server, following https://youtu.be/m46tZX6vceI?t=123
mcpserverhttpswiftclaudegit clone https://github.com/josmithiii/mcp-template - vibe-mcp 📘 🏠 (⭐ 12, 🍴 5) - Vibe MCp generates and plays music based on the code you're working with
httpmlgitgithubtypescriptnpm install trevhud/vibe-mcp - volatility3-mcp 🏠 (⭐ 12, 🍴 1, 🐛 1) - Volatility3 MCP Server for automating Memory Forensics
yaramcpservergit clone https://github.com/Kirandawadi/volatility3-mcp - hugeicons/mcp-server 📘 🏠 (⭐ 11, 🐛 1) - Facilitates seamless integration of Hugeicons across various platforms by providing tools, resources, and platform-specific guides for AI assistants.
httpaimlgitgithub - amap-weather-mcp-server 🐍 🏠 📇 (⭐ 11, 🍴 5) - 基于高德地图 API 的中国城市天气查询 MCP Server
apihttpaigitgithubpip install git+https://github.com/ACAne0320/amap-weather-mcp-server - currents-mcp 📘 🏠 (⭐ 11, 🍴 6, 🐛 2) - Currents MCP Server (TypeScript-based)
httpaigitgithubtypescriptnpm install currents-dev/currents-mcp - d2-mcp 🐹 🏠 (⭐ 11, 🍴 1) - Go-based
httpgitgithubgogo install h0rv/d2-mcp@latest - DoorDash-MCP-Server 📘 🏠 (⭐ 11, 🍴 3, 🐛 2) - TypeScript-based
httpgitgithubtypescriptnpm install JordanDalton/DoorDash-MCP-Server - formula1-mcp 📘 🏠 (⭐ 11, 🍴 1, 🐛 1) - TypeScript-based
httpgitgithubtypescriptai-agentsnpm install Panth1823/formula1-mcp - lancedb-mcp-server 🐍 🏠 (⭐ 11, 🍴 3, 🐛 2) - Python-based
httpgitgithubpythonpip install git+https://github.com/lancedb/lancedb-mcp-server - mcp_video_recognition 📘 🏠 (⭐ 11, 🍴 8, 🐛 3) - TypeScript-based
httpaigitgithubtypescriptnpm install mario-andreschak/mcp_video_recognition - paprika-3-mcp 🐹 🏠 (⭐ 11, 🍴 4, 🐛 1) - MCP Server for creating/editing recipes in Paprika 3 with natural language
httpllmgitgithubgogo install soggycactus/paprika-3-mcp@latest - simctl-mcp 📘 🏠 (⭐ 11, 🍴 4) - TypeScript-based
httpgitgithubtypescriptnpm install ambar/simctl-mcp - Azure/blue-bridge 🏠 (⭐ 10, 🍴 6, 🐛 1) - Facilitates querying and managing Azure resources using MCP server with zero-secret authentication, supporting Azure Managed Grafana, Azure Data Explorer, and more.
authhttpazuregitgithub - CutterMCP 🐍 🏠 (⭐ 10, 🍴 1) - MCP Server for Cutter
httpllmgitgithubpythonpip install git+https://github.com/ap425q/CutterMCP - forgejo-mcp 🐹 🏠 📇 (⭐ 10, 🍴 3, 🐛 2) - MIRROR ONLY!! This Model Context Protocol (MCP) server provides tools and resources for interacting with the Forgejo (specifically Codeberg.org) REST API.
apiresthttpgitgithubgo install goern/forgejo-mcp@latest - google-photos-mcp 📘 🏠 📇 (⭐ 10, 🍴 2, 🐛 2) - A Model Context Protocol repository for Google Photos API
httpaigitgithubtypescriptnpm install savethepolarbears/google-photos-mcp - m2m-mcp-server-ssh-server 🐍 🏠 ☁️ (⭐ 10, 🍴 2) - Python-based
remotehttpgitgithubpythonpip install git+https://github.com/Machine-To-Machine/m2m-mcp-server-ssh-server - mcp-osv 🐹 🏠 (⭐ 10) - A MCP (Model Context Protocol) server to allow code security reviews using https://osv.dev (Open Source Vulnerabilities Database)
httpaigitgithubgogo install gleicon/mcp-osv@latest - misp-mcp 🐍 🏠 (⭐ 10, 🍴 1) - A Model Context Protocol server allows to interact with MISP
httpaimlgitgithubpip install git+https://github.com/Eacus/misp-mcp - modelica_simulation_mcp_server 🏠 (⭐ 10, 🍴 2) - Public MCP server to run modelica simulation
httpllmgitgithubmcpgit clone https://github.com/Orthogonalpub/modelica_simulation_mcp_server - windows-rs-mcp 🐍 🏠 📇 (⭐ 10) - MCP server that allows searching the Rust windows crate API documentation
apiwebhttpmlgitpip install git+https://github.com/preludeorg/windows-rs-mcp - mcp_3d_relief 🐍 🏠 (⭐ 10) - image to 3d relief STL models
httpaigitgithubpythonpip install git+https://github.com/Bigchx/mcp_3d_relief - databricks-genie-mcp 🐍 🏠 📇 (⭐ 9, 🍴 2, 🐛 1) - This project implements a Model Context Protocol (MCP) server that exposes Databricks Genie API capabilities as tools
httpaigitgithubpythonpip install git+https://github.com/alexxx-db/databricks-genie-mcp - gitlab-mcp-server 🐍 🏠 (⭐ 9) - Improved implementation of Anthropic's modelcontextprotocol/servers Gitlab MCP server
httpmlgitgithubgitlabpip install git+https://github.com/radostkali/gitlab-mcp-server - mcp-ip2location-io 🐍 🏠 📇 (⭐ 9, 🍴 8, 🐛 1) - IP Geolocation MCP server using IP2Location.io API
apihttpgitgithubpythonpip install git+https://github.com/ip2location/mcp-ip2location-io - mcp-osrs 📜 🏠 📇 (⭐ 9, 🍴 8, 🐛 2) - mcp server for AI to understand osrs
apifilehttpgitgithubnpm install JayArrowz/mcp-osrs - mcp-server-midi 🐍 🏠 (⭐ 9, 🍴 1) - A MCP Server for sending MIDI sequences to any program that supports MIDI input
httpmlllmgitgithubpip install git+https://github.com/sandst1/mcp-server-midi - mcp-server-tester 📘 🏠 (⭐ 9, 🍴 2) - Automated testing tool for Model Context Protocol (MCP) servers - WORK IN PROGRESS
httpaigitgithubtypescriptnpm install r-huijts/mcp-server-tester - mcp-strava 🎯 🏠 📇 (⭐ 9, 🍴 1) - The MCP Strava Server facilitates seamless integration between Strava APIs and Claude for Desktop.
apihttpmlgitgithubgit clone https://github.com/MariyaFilippova/mcp-strava - searxng-mcp-server 🐍 🏠 (⭐ 9, 🍴 3, 🐛 2) - An MCP sse implementation of the Model Context Protocol (MCP) server integrated with SearXNG for providing AI agents with powerful, privacy-respecting search capabilities.
httpaigitgithubpythonpip install git+https://github.com/The-AI-Workshops/searxng-mcp-server - storyblok-mcp 📘 🏠 (⭐ 9, 🍴 1) - A Model Context Protocol (MCP) implementation for Storyblok that allows you to manage components through natural language descriptions.
httpgitgithubtypescriptmcpnpm install harlley/storyblok-mcp - mcp-dndzgz 📜 🏠 (⭐ 9, 🍴 3, 🐛 2) - A MCP Server to know about Zaragoza bus, tram and bizi services in realtime
httpgitgithubjavascriptmcpnpm install danilat/mcp-dndzgz - SuricataMCP 🐍 🏠 (⭐ 9, 🍴 4, 🐛 2) - Python-based
httpaimlgitgithubpip install git+https://github.com/Medinios/SuricataMCP - tailscale-mcp-server 🐹 🏠 (⭐ 9) - MCP server for safe read-only operations on the Tailscale CLI
httpaigitgithubgogo install paulsmith/tailscale-mcp-server@latest - wordpress-mcp 📘 🏠 📇 (⭐ 9) - A Model Context Protocol server for WordPress
apiresthttpgitgithubnpm install jpollock/wordpress-mcp - exia-mcp 📘 🏠 (⭐ 9, 🍴 2, 🐛 2) - 解説シナリオを自動生成するMCPサーバ (TypeScript-based)
filehttpgitgithubtypescriptnpm install kokushin/exia-mcp - Hubspot-MCP 📜 🏠 (⭐ 9, 🍴 1, 🐛 3) - Streamlining the process of Integrating existing MCP server into a Hubspot Database
databasehttpmlgitgithubgit clone https://github.com/deezsecc/Hubspot-MCP - adb_mcp_server 🐍 🏠 ☁️ (⭐ 8, 🍴 3, 🐛 2) - Android ADB MCP 服务器 - 通过Claude或其他MCP客户端远程控制Android设备
remotehttpgitgithubpythonpip install git+https://github.com/wolfcoming/adb_mcp_server - bicscan-mcp 🐍 🏠 📇 (⭐ 8, 🍴 14, 🐛 3) - BICScan MCP Server (Python-based)
apihttpaigitgithubpip install git+https://github.com/ahnlabio/bicscan-mcp - duckdb-mcp-server 🐍 🏠 (⭐ 8, 🍴 2) - A MCP server for DuckDB with auth and friendly sql support out of the box.
httpaimlgitgithubpip install git+https://github.com/mustafahasankhan/duckdb-mcp-server - ebitengine-mcp 🐹 🏠 (⭐ 8) - Ebitengine MCP server for Cursor
httpgitgithubgomcpgo install sedyh/ebitengine-mcp@latest - esp-rainmaker-mcp 🐍 🏠 (⭐ 8, 🍴 5, 🐛 1) - ESP RainMaker MCP server
httpaigitgithubpythonpip install git+https://github.com/dhavalgujar/esp-rainmaker-mcp - mcp-dataverse 🐍 🏠 (⭐ 8, 🍴 3, 🐛 3) - Python-based
httpmlgitgithubpythonpip install git+https://github.com/gdcc/mcp-dataverse - mcp-shopify 📘 🏠 📇 (⭐ 8, 🍴 3, 🐛 2) - TypeScript-based
apigraphqlhttpmlgitnpm install sarayd/mcp-shopify - scanpy-mcp 🐍 🏠 (⭐ 8, 🍴 2) - MCP server for Scanpy
httpaimlgitgithubpip install git+https://github.com/huang-sh/scanpy-mcp - m2m-mcp-server-ssh-client 🐍 🏠 ☁️ (⭐ 8, 🍴 1) - Python-based
remotehttpgitgithubpythonpip install git+https://github.com/Machine-To-Machine/m2m-mcp-server-ssh-client - ptcg-mcp 📘 🏠 (⭐ 8, 🍴 3, 🐛 3) - MCP server for Pokemon cards
httpaigitgithubtypescriptnpm install jlgrimes/ptcg-mcp - trilogy-group/oneroster-ts 📘 🏠 📇 (⭐ 8, 🍴 2, 🐛 1) - A TypeScript SDK offering a type-safe interface for interacting with the 1EdTech OneRoster API, also deployable as an MCP server for AI applications.
apihttpaigitgithub - containerinc-mcp 📘 🏠 (⭐ 8, 🍴 2, 🐛 2) - MCP Server for automated deployments onto Container Inc.
httpaigitgithubtypescriptnpm install f-inc/containerinc-mcp - monad-mcp-server 📘 🏠 (⭐ 8, 🍴 2) - Monad MCP Server (TypeScript-based)
httpgitgithubtypescriptmcpnpm install lispking/monad-mcp-server - estat-mcp-server 🐍 🏠 📇 (⭐ 7, 🍴 1) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/cygkichi/estat-mcp-server - FinQ4Cn-mcp-server 🏠 (⭐ 7, 🍴 7) - 适合国内使用的量化金融mcp server
jupyter notebookmcpservergit clone https://github.com/jinhongzou/FinQ4Cn-mcp-server - FastlyMCP 📜 🏠 📇 (⭐ 7, 🍴 2, 🐛 1) - Fastly MCP brings the power of Fastly's API directly to your AI assistants through the Model Context Protocol (MCP).
apihttpaimlgitnpm install Arodoid/FastlyMCP - gitlab-mcp 🐍 🏠 📇 (⭐ 7, 🍴 3) - A MCP (Model Context Protocol) server for interacting with GitLab API.
httpaigitgithubgitlabpip install git+https://github.com/Adit-999/gitlab-mcp - jobspy-mcp-server 📜 🏠 (⭐ 7, 🍴 6) - MCP server to search for jobs across multiple job listing platforms
httpaigitgithubjavascriptnpm install borgius/jobspy-mcp-server - mcp_vms 🐍 🏠 (⭐ 7, 🍴 3, 🐛 1) - MCP server for controlling and accessing a video surveillance system
httpgitgithubpythonmcppip install git+https://github.com/jyjune/mcp_vms - moodle-mcp 🐍 🏠 (⭐ 7, 🍴 2) - A Model Context Protocol (MCP) server implementation that provides capabilities to interact with Moodle LMS
httpgitgithubpythonmcppip install git+https://github.com/loyaniu/moodle-mcp - newsnow-mcp-server 📜 🏠 (⭐ 7, 🍴 3) - Official MCP Server for newnow, 40+ sources available.
httpgitgithubjavascriptmcpnpm install ourongxing/newsnow-mcp-server - PubTator-MCP-Server 🐍 🏠 (⭐ 7, 🐛 2) - 🔍 A biomedical literature annotation and relationship mining server based on PubTator3, providing convenient access through the MCP interface.
httpaigitgithubpythonpip install git+https://github.com/BioMCP-Hub/PubTator-MCP-Server - sakura-mcp 🏠 (⭐ 7, 🍴 1)
scalagit clone https://github.com/mullerhai/sakura-mcp - adb-mcp 📜 🏠 (⭐ 7, 🍴 2, 🐛 1) - An MCP (Model Context Protocol) server for interacting with Android devices through ADB in TypeScript.
httpaigitgithubjavascriptnpm install srmorete/adb-mcp - airflow-mcp 🐍 🏠 (⭐ 7, 🍴 2) - Python-based
httpaigitgithubpythonpip install git+https://github.com/hipposys-ltd/airflow-mcp - wayland-mcp 🐍 🏠 (⭐ 7, 🍴 3, 🐛 1) - MCP Server for Wayland
httpaigitgithubpythonpip install git+https://github.com/someaka/wayland-mcp - weather-mcp 🐍 🏠 📇 (⭐ 7, 🍴 1) - An MCP-compatible service that provides real-time weather and location data via the OpenWeather API. Built for easy integration with Claude Desktop and Ollama (Qwen 2.5).
apihttpaimlgitnpm install aldotestino/weather-mcp - BangumiMCP 🐍 🏠 📇 (⭐ 7, 🍴 3) - bgm.tv MCP Server (Python-based)
apihttpgitgithubpythonpip install git+https://github.com/Ukenn2112/BangumiMCP - base-builder-mcp 📘 🏠 (⭐ 7, 🍴 11, 🐛 1) - TypeScript-based
httpmlgitgithubtypescriptnpm install base/base-builder-mcp - clockify-mcp-server 📘 🏠 (⭐ 7, 🍴 4) - A MCP Server to manage your time entries in Clockify
httpaillmgitgithubnpm install https-eduardo/clockify-mcp-server - defold-mcp 📜 🏠 (⭐ 7, 🐛 2) - My attempt to create a MCP server that can be used with cursor to work on a defold project
httpaigitgithubjavascriptnpm install ChadAragorn/defold-mcp - hugo-mcp 🐍 🏠 (⭐ 7, 🍴 1, 🐛 1) - A powerful MCP (Model Control Protocol) server for managing Hugo static site generator.
httpgitgithubpythonhugopip install git+https://github.com/SunnyCloudYang/hugo-mcp - MCP-CyberAgent 🐍 🏠 (⭐ 7) - MCP-CyberAgent is an MCP-compliant AI security assistant that connects Claude Desktop (or any MCP client) with real-world cybersecurity tools like VirusTotal, Nmap, Shodan, and PowerShell.
httpaigitgithubpythonpip install git+https://github.com/JithukrishnanV/MCP-CyberAgent - nativeMCP 🏠 (⭐ 7, 🐛 1) - 这是一个由C++编写的MCP系统,包括MCP核心架构的host、client和server
c++mcpservergit clone https://github.com/SihaoH/nativeMCP - nature-remo-mcp-server 📘 🏠 📇 (⭐ 7, 🍴 3, 🐛 2) - MCP Server for the Nature Remo API.
httpgitgithubtypescriptmcpnpm install noboru-i/nature-remo-mcp-server - yandex-maps-mcp 📜 🏠 📇 (⭐ 7, 🍴 1, 🐛 2) - MCP server for Yandex Maps map rendering and geocoding APIs
apihttpgitgithubjavascriptnpm install peschinskiy/yandex-maps-mcp - mcp-git-commit-aider 📜 🏠 (⭐ 7, 🍴 2, 🐛 2) - A simple MCP server that makes git commits on behave of AI, so that you can track AI contribution in your codebase
httpaigitgithubjavascriptnpm install MrOrz/mcp-git-commit-aider - tailor-mcp 📜 🏠 (⭐ 7) - The tailorctl command-line utility, with a focus on MCP (Model Context Protocol) server functionality.
graphqlhttpaimlllmnpm install tailor-platform/tailor-mcp - tfnsw-realtime-alerts-mcp-server 📜 🏠 📇 (⭐ 7, 🍴 3, 🐛 2) - A Model Context Protocol (MCP) server for TfNSW's realtime alerts API
httpaillmgitgithubnpm install piddlingtuna/tfnsw-realtime-alerts-mcp-server - AstroMCP 📘 🏠 (⭐ 6) - An MCP server for querying astrological data.
httpaimlgitgithubnpm install simpolism/AstroMCP - climatiq-mcp-server 🐍 🏠 📇 (⭐ 6, 🍴 7, 🐛 4) - A Model Context Protocol (MCP) server for accessing the Climatiq API to calculate carbon emissions. This allows AI assistants to perform real-time carbon calculations and provide climate impact insights.
apihttpaigitgithubpip install git+https://github.com/jagan-shanmugam/climatiq-mcp-server - eclass-mcp-server 🐍 🏠 (⭐ 6, 🍴 3, 🐛 1) - A Model Context Protocol (MCP) server for the Open eClass platform.
authhttpaigitgithubpip install git+https://github.com/sdi2200262/eclass-mcp-server - ghidra-mcp-zig 🏠 (⭐ 6) - A Ghidra plugin that provides a bridge between Ghidra and a Zig-based MCP server for enhanced program analysis capabilities.
zigmcpservergit clone https://github.com/streamerd/ghidra-mcp-zig - haiguitangmcp 🐍 🏠 (⭐ 6, 🍴 4, 🐛 2) - 海龟汤mcp服务,使你独自一人也可以享受海龟汤游戏的乐趣
httpaigitgithubpythonpip install git+https://github.com/wangyafu/haiguitangmcp - himalayas-mcp 🏠 ☁️ (⭐ 6, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server that provides access to remote job listings and company information from Himalayas.app.
mcpserverdatabaseremotehttpgit clone https://github.com/Himalayas-App/himalayas-mcp - flightradar-mcp-server 📜 🏠 📇 (⭐ 6, 🍴 1, 🐛 1) - Node.js-based
apihttpaigitgithubnpm install Cyreslab-AI/flightradar-mcp-server - fuel-mcp-server 📘 🏠 (⭐ 6, 🍴 2, 🐛 5) - A Fuel MCP server which provides support for Fuel docs and various coding IDEs such as Cursor.
httpmlgitgithubtypescriptnpm install FuelLabs/fuel-mcp-server - i18n-mcp-server 📘 🏠 (⭐ 6, 🍴 3) - MCP server for handling i18n JSON files
filehttpjsonmlgitnpm install reinier-millo/i18n-mcp-server - mcp-jacoco-reporter 🐍 🏠 (⭐ 6, 🍴 4, 🐛 1) - read jacoco reporter and response a friendly structure for llm
httpaigitgithubpythonpip install git+https://github.com/crisschan/mcp-jacoco-reporter - mcp-korea-tourism-api 🐍 🏠 📇 (⭐ 6, 🍴 1) - Model Context Protocol (MCP) server that provides tools for accessing the Korea Tourism API
apihttpaigitgithubpip install git+https://github.com/harimkang/mcp-korea-tourism-api - mcp-teradata 🐍 🏠 (⭐ 6, 🍴 1) - MCP Server for Teradata database
databasehttpgitgithubpythonpip install git+https://github.com/arturborycki/mcp-teradata - mcp-video-extraction 🐍 🏠 (⭐ 6, 🍴 2) - Python-based
filehttpaiopenaigitpip install git+https://github.com/SealinGp/mcp-video-extraction - mcpservers 🔷 🏠 (⭐ 6, 🍴 1) - A collection of MCP (Model Context Protocol) servers as dotnet tools. And some projects to easily build Stdio or SSE MCP Servers.
mcpserverc#git clone https://github.com/mcpserversvip/mcpservers - metamask-mcp 📘 🏠 (⭐ 6, 🍴 2) - TypeScript-based
httpaillmgitgithubnpm install Xiawpohr/metamask-mcp - oura-mcp 📘 🏠 (⭐ 6, 🍴 7, 🐛 1) - An MCP server for ouraring.com
httpgitgithubmetricstypescriptnpm install johnie/oura-mcp - qgis_mcp_modify1 🐍 🏠 (⭐ 6, 🍴 1, 🐛 1) - An update version of qgis_mcp from jjsantos01/qgis_mcp repository
httpaimlgitgithubpip install git+https://github.com/syauqi-uqi/qgis_mcp_modify1 - reclaim-mcp-server 📘 🏠 📇 (⭐ 6, 🍴 1, 🐛 1) - A Model Context Protocol (MCP) server implementation using TypeScript
apihttpaimlgitnpm install jj3ny/reclaim-mcp-server - risken-mcp-server 🐹 🏠 📇 (⭐ 6) - RISKEN's official MCP Server
apihttpmlgitgithubgo install ca-risken/risken-mcp-server@latest - Lemonade-Stand-MCP-Server 📜 🏠 (⭐ 6, 🍴 3, 🐛 3) - A simple, working example of a Model Context Protocol (MCP) server that lets you play the classic Lemonade Stand game through Claude Desktop.
httpgitgithubjavascriptmcpnpm install jimmcq/Lemonade-Stand-MCP-Server - TAMA-MCP 🐍 🏠 (⭐ 6, 🐛 3) - AI-Powered Task Manager CLI with MCP Server
httpaigitgithubpythonpip install git+https://github.com/Gitreceiver/TAMA-MCP - youtube-mcp 🐍 🏠 (⭐ 6, 🍴 1, 🐛 1) - YouTube MCP Server is an AI-powered solution designed to revolutionize your YouTube experience. It empowers users to search for YouTube videos, retrieve detailed transcripts, and perform semantic searches over video content—all without relying on the official API. By integrating with a vector database, this server streamlines content discovery.
httpllmgitgithubpythonpip install git+https://github.com/RohitMidha23/youtube-mcp - elixir_mcp_server 🏠 (⭐ 6, 🍴 2) - An example of how to implement an MCP server using Elixir and SSE transport
elixirmcpservergit clone https://github.com/epinault/elixir_mcp_server - mcp-bazel 🐹 🏠 (⭐ 6, 🍴 1, 🐛 2) - An MCP server providing common Bazel actions like build, test, and dependency analysis.
httpgitgithubgobazelgo install aaomidi/mcp-bazel@latest - playwright-sse-mcp-server 🐚 🏠 (⭐ 6) - playwright/mcpをsseで外部から触るためのやつ
shellmcpgit clone https://github.com/torohash/playwright-sse-mcp-server - sentry-issues-mcp 📜 🏠 (⭐ 6, 🍴 2, 🐛 2) - Node.js-based
httpllmgitgithubjavascriptnpm install Leee62/sentry-issues-mcp - Brave-Gemini-Research-MCP-Server 📘 🏠 📇 (⭐ 5, 🍴 3, 🐛 2) - TypeScript-based
apiwebhttpaigitnpm install falahgs/Brave-Gemini-Research-MCP-Server - claude-mcp-marketing 🐚 🏠 (⭐ 5, 🍴 3) - One-click installer for Claude MCP servers focused on marketing professionals
shellmcpservergit clone https://github.com/redmorestudio/claude-mcp-marketing - cs2-rcon-mcp 🐍 🏠 ☁️ (⭐ 5, 🍴 1, 🐛 1) - CS2 RCON MCP - Server management tool for Counter-Strike 2
remotehttpgitgithubmonitoringpip install git+https://github.com/v9rt3x/cs2-rcon-mcp - etf-flow-mcp 🐍 🏠 (⭐ 5, 🍴 4) - An MCP server that delivers crypto ETF flow data to power AI agents' decision-making.
httpaigitgithubpythonpip install git+https://github.com/kukapay/etf-flow-mcp - ios-forensics-mcp 🐍 🏠 (⭐ 5) - iOS Forensics MCP Server for analyzing iPhone/iPad file systems
filehttpaigitgithubpip install git+https://github.com/RLabs-Inc/ios-forensics-mcp - mcp-adonet-server 🔷 🏠 (⭐ 5, 🍴 3) - C# based Model Context Procotol (MCP) Server for ADO.NET ODBC provider
databasehttpgitgithubc#git clone https://github.com/OpenLinkSoftware/mcp-adonet-server - mcp-duckduckgo 🐍 🏠 📇 (⭐ 5, 🍴 3, 🐛 1) - A DuckDuckGo search plugin for Model Context Protocol (MCP), compatible with Claude Code. Provides web search functionality with advanced navigation and content exploration features.
apiwebhttpllmgitpip install git+https://github.com/Glitchfix/mcp-duckduckgo - MCP-FileMaker 📘 🏠 (⭐ 5, 🍴 2, 🐛 2) - TypeScript-based
databasefileauthhttpgitnpm install calafate40/MCP-FileMaker - mcp-server 🏠 (⭐ 5, 🍴 1) - 该MCP服务提供旷湖企业大数据服务,是一个全面的信息查询和分析平台,涵盖企业工商信息、风险分析、知识产权、地理分布、经营洞察等多个维度的专业数据服务。
mcpgit clone https://github.com/handaas/mcp-server - mcp-server-mathematica 📜 🏠 (⭐ 5, 🍴 1) - Node.js-based
httpaigitgithubjavascriptnpm install texra-ai/mcp-server-mathematica - mcp-server-runescape 📜 🏠 (⭐ 5, 🍴 2, 🐛 2) - Node.js-based
httpgitgithubjavascriptnpm install stefan-xyz/mcp-server-runescape - mcp-vulnerability-scanner 📘 🏠 📇 (⭐ 5, 🍴 1, 🐛 1) - A Model Context Protocol (MCP) server for scanning IP addresses for vulnerabilities. This server provides tools to perform security scanning on individual IPs or multiple IPs at once.
apihttpaigitgithubnpm install RobertoDure/mcp-vulnerability-scanner - MISP-MCP-SERVER 🐍 🏠 (⭐ 5, 🍴 3) - A Model Context Protocol (MCP) server that integrates with the MISP (Malware Information Sharing Platform) to provide threat intelligence capabilities to Large Language Models.
httpgitgithubpythonmcppip install git+https://github.com/bornpresident/MISP-MCP-SERVER - searxng-mcp-bridge 📜 🏠 (⭐ 5, 🍴 1, 🐛 2) - Model-Context Protocol server that acts as a bridge to a SearxNG instance
httpgitgithubjavascriptservernpm install nitish-raj/searxng-mcp-bridge - medadapt-content-server 🐍 🏠 (⭐ 5, 🍴 1, 🐛 1) - A specialized MCP server for Claude Desktop that enhances AI-assisted medical learning
httpaigitgithubpythonpip install git+https://github.com/ryoureddy/medadapt-content-server - tandoor-mcp-server 📜 🏠 (⭐ 5, 🍴 2) - A Model Context Protocol (MCP) server for interacting with Tandoor Recipe Manager.
httpmlgitgithubjavascriptnpm install starbuck93/tandoor-mcp-server - mcp-hosting 🏠 (⭐ 5, 🍴 4, 🐛 1) - MCP servers hosting in Phala Cloud
mcpservergit clone https://github.com/Phala-Network/mcp-hosting - weibo-mcp-server 🐍 🏠 (⭐ 5) - This is a Weibo hot search data acquisition server based on the Model Context Protocol (MCP) framework, providing functions to fetch Weibo hot search list, hot search details, and comments.
httpaigitgithubpythonpip install git+https://github.com/Yooki-K/weibo-mcp-server - code-reviewer-mcp 📜 🏠 (⭐ 5) - A code reviewer MCP powered by AI.
httpaigitgithubjavascriptnpm install joaomj/code-reviewer-mcp - mcp-naver-map 🐍 🏠 📇 (⭐ 5, 🍴 1) - Naver Map MCP Server
apihttpgitgithubpythonpip install git+https://github.com/yeonupark/mcp-naver-map - ae-mcp 🐹 🏠 (⭐ 4) - Go-based
httpaigitgithubgogo install sunqirui1987/ae-mcp@latest - arxiv-search-mcp 📘 🏠 (⭐ 4, 🍴 2, 🐛 1) - An MCP server that provides tools to search and fetch papers from arXiv.org.
httpgitgithubtypescriptdenonpm install danimal141/arxiv-search-mcp - GDB-MCP 🐍 🏠 (⭐ 4, 🍴 1) - An MCP server written in MCP python SDK that enables LLMs to interact with GDB for binary debugging and analysis.
httpllmgitgithubpythonpip install git+https://github.com/smadi0x86/GDB-MCP - google-flights-mcp 🐍 🏠 📇 (⭐ 4, 🍴 2, 🐛 3) - Python-based
apihttpmlgitgithubpip install git+https://github.com/salamentic/google-flights-mcp - imgmcp 🏠 (⭐ 4, 🍴 1) - Connecting Models to Your Creativity.
git clone https://github.com/imgmcp/imgmcp - buildkite-mcp 📜 🏠 (⭐ 4, 🍴 1, 🐛 2) - A Model Context Protocol (MCP) server for Buildkite integration
httpmlgitgithubjavascriptnpm install Drew-Goddyn/buildkite-mcp - mcp_youtube_dlp 🐍 🏠 (⭐ 4) - A Model Context Protocol (MCP) server that provides tools for downloading YouTube videos and audio using yt-dlp.
httpaigitgithubpythonpip install git+https://github.com/yorickchan/mcp_youtube_dlp - mcp-game-helper 📘 🏠 (⭐ 4) - Custom Model Context Protocol (MCP) Server that provides AI-powered tools to assist game developers in tasks related to combat balancing, skill analysis, level pacing, and simulation.
httpaigitgithubtypescriptnpm install xhulz/mcp-game-helper - mcp-playbook 📘 🏠 📇 (⭐ 4, 🍴 4, 🐛 1) - A Model Context Protocol (MCP) server for managing project documentation and saving conversation logs within a user-specified target project directory.
apihttpgitgithubtypescriptnpm install dwarvesf/mcp-playbook - newsbang-mcp 🏠 (⭐ 4) - See the trends. Seek the opportunity.
git clone https://github.com/NewsBang/newsbang-mcp - podcast-xyzrank-mcp 📘 🏠 (⭐ 4, 🍴 1) - 通过 MCP 问今天听什么播客 (TypeScript-based)
httpgitgithubtypescriptmcpnpm install Otto-J/podcast-xyzrank-mcp - Subnet-Calculator-MCP-Server 🐍 🏠 (⭐ 4) - Python-based
httpgitgithubpythonpip install git+https://github.com/melihteke/Subnet-Calculator-MCP-Server - swift-tarot-mcp 🦉 🏠 (⭐ 4, 🍴 1) - A Swift-based MCP (Model Context Protocol) server for tarot card readings
swiftmcpservergit clone https://github.com/junebash/swift-tarot-mcp - todo-mcp-server 🐍 🏠 (⭐ 4, 🍴 1) - The repository todo-mcp-server is a minimal Todo application implemented as an MCP (Model Context Protocol) server. It provides basic functionalities such as listing, viewing, adding, removing, and clearing todo items.
httpgitgithubpythonmcppip install git+https://github.com/idsulik/todo-mcp-server - vault-mcp 📘 🏠 (⭐ 4, 🍴 1, 🐛 1) - Model Context Protocol (MCP) Server for HashiCorp Vault secret management
httpgitgithubtypescriptmcpnpm install ashgw/vault-mcp - ghidra_mcp 🐍 🏠 (⭐ 4, 🍴 2, 🐛 1) - Ghidra MCP server that extracts decompiled binary context and exposes it to LLMs via Model Context Protocol.
httpllmgitgithubpythonpip install git+https://github.com/Bamimore-Tomi/ghidra_mcp - mcp-minimax-music-server 📘 🏠 📇 (⭐ 4, 🍴 2, 🐛 1) - TypeScript-based
apihttpaimlgitnpm install falahgs/mcp-minimax-music-server - Translationx-mcp-server 🐍 🏠 (⭐ 4) - MCP Server for Translationx
httpgitgithubpythonmcppip install git+https://github.com/Deep-Intelligent-Pharma/Translationx-mcp-server - zipic-mcp-server 🦉 🏠 (⭐ 4, 🍴 3) - A Model Context Protocol server that provides image compression and optimization capabilities through Zipic app.
swiftservergit clone https://github.com/okooo5km/zipic-mcp-server - 4oimage-mcp 📜 🏠 📇 (⭐ 4, 🍴 2, 🐛 1) - An MCP server implementation that integrates with 4o-image API, enabling LLMs and other AI systems to generate and edit images through a standardized protocol. Create high-quality art, 3D characters, and custom images using simple text prompts.
apihttpaigitgithubnpm install Antipas/4oimage-mcp - fastapi-mcp-workshop 🐍 🏠 📇 (⭐ 4) - FastAPI でMCP (Python-based)
apihttpgitgithubpythonpip install git+https://github.com/Miura55/fastapi-mcp-workshop - mcp-gdrive-server 📜 🏠 (⭐ 4) - Google Drive MCP server for integrating with Google Drive to allow listing, reading, and searching over files.
filehttpgitgithubjavascriptnpm install tonioshikanlu/mcp-gdrive-server - mcp-image-processor 📘 🏠 (⭐ 4) - mcp server for image professing
httpgitgithubtypescriptmcpnpm install HYPERVAPOR/mcp-image-processor - mcp-nftgo-api 📘 🏠 📇 (⭐ 4, 🍴 2, 🐛 1) - TypeScript-based
apihttpmlgitgithubnpm install NFTGo/mcp-nftgo-api - mcp-yahoo-finance 🐍 🏠 (⭐ 4, 🍴 2, 🐛 2) - MCP server for Yahoo Finance
httpgitgithubanalyticspythonpip install git+https://github.com/leoncuhk/mcp-yahoo-finance - tumf/fastmcp-gsuite 🐍 🏠 (⭐ 4, 🍴 1, 🐛 2) - Facilitates seamless interaction with Gmail and Google Calendar through a fastmcp-based server, supporting multiple accounts and advanced email and calendar management.
httpaimlgitgithub - coresignal-mcp 🏠 (⭐ 3, 🍴 1, 🐛 2)
git clone https://github.com/Coresignal-com/coresignal-mcp - DocNR/repo-explorer 📘 🏠 (⭐ 3, 🐛 1) - Efficiently explore and analyze Git repositories with advanced caching and cross-repository code pattern search, integrating seamlessly with Claude AI.
httpaimlgitgithub - mcp_hkbus 🐍 🏠 (⭐ 3, 🍴 3) - A MCP server which can query bus info, routes, eta, etc.
httpgitgithubpythonmcppip install git+https://github.com/kennyckk/mcp_hkbus - mcp-docker-code-interpreter 🐍 🏠 (⭐ 3) - Python-based
httpdockeraigitgithubpip install git+https://github.com/svngoku/mcp-docker-code-interpreter - mcp-news 🐍 🏠 (⭐ 3, 🍴 1, 🐛 1) - Python-based
databasehttpgitgithubpythonpip install git+https://github.com/eluc1a/mcp-news - mcp-server-gitlab 📘 🏠 📇 (⭐ 3) - TypeScript-based
apiresthttpmlgitnpm install ZephyrDeng/mcp-server-gitlab - mcp-server-updater 🏠 (⭐ 3) - Automatically analyze and update Model Context Protocol (MCP) servers for Claude Desktop
powershellmcpservergit clone https://github.com/JayceeB1/mcp-server-updater - mcp-sg-lta 📜 🏠 📇 (⭐ 3, 🍴 4, 🐛 2) - MCP server for Singapore's Land Transport Authority (LTA) DataMall API
apihttpaigitgithubnpm install arjunkmrm/mcp-sg-lta - mcp-tabnews 📘 🏠 (⭐ 3, 🍴 2, 🐛 1) - A Model Context Protocol (MCP) server that provides tools for Tabnews
httpmlgitgithubanalyticsnpm install renant/mcp-tabnews - prometheus-mcp-server 🐹 🏠 (⭐ 3, 🍴 1) - 一个简化版的Prometheus MCP服务器,用于收集和暴露MCP服务器的指标
httpgitgithubgoaigo install shaxiaozz/prometheus-mcp-server@latest - py-ue5-mcp-server 🐍 🏠 (⭐ 3, 🍴 3, 🐛 1) - an ue5 mcp server that allows the user to access functions in blueprint actors
httpgitgithubpythonmcppip install git+https://github.com/edi3on/py-ue5-mcp-server - python_sandbox_mcp_server 🐍 🏠 (⭐ 3, 🍴 1) - A MCP server that enables LLMs to run python code safely in isolated Docker containers.
httpdockeraillmgitpip install git+https://github.com/cloudywu0410/python_sandbox_mcp_server - Aurora-4X-MCP 📘 🏠 (⭐ 3) - TypeScript-based
httpgitgithubtypescriptnpm install thirionlogan/Aurora-4X-MCP - code-scanner-server 📜 🏠 (⭐ 3, 🍴 3, 🐛 1) - CLI & MCP server for scanning code definitions (.gitignore aware, LLM output)
filehttpllmgitgithubnpm install Ixe1/code-scanner-server - DuckDB-RAG-MCP-Sample 🐍 🏠 (⭐ 3) - Python-based
httpgitgithubpythonpip install git+https://github.com/nananaman/DuckDB-RAG-MCP-Sample - simple_dart_mcp_server 🎯 🏠 (⭐ 3, 🍴 1) - A very simple Model Context Protocol server implementation in Dart
dartservergit clone https://github.com/nmfisher/simple_dart_mcp_server - SmartCustomerSupportMCP 🐍 🏠 (⭐ 3) - 这是一个基于MCP框架的智能客服系统示例项目,用于演示如何构建和部署智能客服应用
httpgitgithubpythonmcppip install git+https://github.com/precariat365/SmartCustomerSupportMCP - spm-mcp 🦉 🏠 (⭐ 3) - Swift Package Manager MCP Server written in Swift
swiftmcpserverhttpgitgit clone https://github.com/simpleswift/spm-mcp - vcenter-mcp-server 🐍 🏠 (⭐ 3) - Python-based
httpmlgitgithubpythonpip install git+https://github.com/lijian-ui/vcenter-mcp-server - mcp-sequentialthinking-qa 📘 🏠 (⭐ 3, 🍴 1, 🐛 1) - TypeScript-based
httpgitgithubtypescriptnpm install spences10/mcp-sequentialthinking-qa - mcp-wikijs 📘 🏠 (⭐ 3) - TypeScript-based
httpaigitgithubtypescriptnpm install Im-neko/mcp-wikijs - offorte-mcp-server 📘 🏠 📇 (⭐ 3, 🍴 2) - MCP server for the Offorte API - Create & send proposals using AI
httpgitgithubtypescriptmcpnpm install offorte/offorte-mcp-server - taskNote-bridge-mcp 🦉 🏠 (⭐ 3) - TaskNote Bridge - MCP Server for Things 3 and Apple Notes integration
swiftmcpservergit clone https://github.com/ragdollKB/taskNote-bridge-mcp - todoist-mcp 📘 🏠 (⭐ 3, 🍴 2) - mcp server for todoist
httpgitgithubjavascriptmcpnpm install stevengonsalvez/todoist-mcp - youtubeinsights-mcp-server 🐍 🏠 (⭐ 3, 🍴 4, 🐛 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/dabidstudio/youtubeinsights-mcp-server - mcp-close-server 📜 🏠 📇 (⭐ 3) - Close.com MCP Server
apihttpaigitgithubnpm install ShiftEngineering/mcp-close-server - concrete-properties-mcp 🐍 🏠 📇 (⭐ 3, 🍴 3) - Concrete Section Properties AI MCP Server
apihttpaigitgithubpip install git+https://github.com/GreatApo/concrete-properties-mcp - future3OOO/Deep-Fusion-Research- 🏠 📇 (⭐ 3) - A comprehensive workflow that integrates outputs from Gemini and OpenAI with Manus's live web/API sweep for enhanced research synthesis.
apiwebhttpaiopenai - SuperColliderMCP 🐍 🏠 (⭐ 3, 🍴 1) - A Model Context Protocol (MCP) server for SuperCollider using Open Sound Control (OSC).
httpaigitgithubpythonpip install git+https://github.com/Tok/SuperColliderMCP - gopalcnepal/mcp-wordpress 🐍 🏠 📇 (⭐ 3, 🍴 1) - Facilitates interaction with WordPress sites by fetching posts, pages, and categories using the REST API.
apiresthttpgitgithub - indian-railways-mcp 📘 🏠 (⭐ 3, 🍴 1) - The Indian Railways MCP Server provides live station status and train information using the Model Context Protocol (MCP). This server is designed to handle requests for live data from Indian Railways.
httpaigitgithubtypescriptnpm install rajprem4214/indian-railways-mcp - mcp-partner-hub 🐚 🏠 (⭐ 3, 🐛 1) - A centralized repository for discovering and comparing Model Context Protocol (MCP) servers from ISV partners.
shellmcpservergit clone https://github.com/zytbeyond/mcp-partner-hub - agentipy-mcp 🐚 🏠 (⭐ 3, 🍴 6)
shellgit clone https://github.com/niceberginc/agentipy-mcp - ares-devops-mcp 📘 🏠 (⭐ 3, 🍴 1, 🐛 1) - TypeScript-based
httpazuremlgitgithubnpm install Cognitive-Stack/ares-devops-mcp - deep-search-mcp 📜 🏠 📇 (⭐ 3, 🍴 1) - A deep web search MCP using LinkUp API.
apiwebhttpgitgithubnpm install joaomj/deep-search-mcp - mcp_adobe_premiere 📘 🏠 (⭐ 3) - TypeScript-based
httpllmgitgithubtypescriptnpm install morim3/mcp_adobe_premiere - mcp-bedrock-agent 🐍 🏠 (⭐ 3) - It is a bedrock agent using MCP.
httpaimlgitgithubpip install git+https://github.com/kyopark2014/mcp-bedrock-agent - mcp-pr-pilot 🐍 🏠 (⭐ 3) - Python-based
httpllmgitgithubpythonpip install git+https://github.com/0010aor/mcp-pr-pilot - MCPHackathon 🏠 (⭐ 3) - GitHub repository for Unstructured MCP Hackathon.
jupyter notebookmcpmcp-serverunstructuredgit clone https://github.com/HeetVekariya/MCPHackathon - Quathor/CMD-Executor 🐍 🏠 ☁️ (⭐ 2) - Facilitates remote execution of Windows CMD commands via the MCP protocol, ensuring secure and configurable command execution.
remotehttpgitgithub - airtop-mcp 📘 🏠 (⭐ 2, 🍴 1) - An MCP server to talk to Airtop (https://www.airtop.ai/)
httpaigitgithubtypescriptnpm install alecf/airtop-mcp - chunker-mcp 🐍 🏠 (⭐ 2, 🍴 1) - This cli tool/Model Context Protocol (MCP) server chunks source code files using LangChain's RecursiveCharacterTextSplitter and stores the resulting chunks in a ChromaDB vector database, including line range metadata for each chunk.
httpaigitgithubpythonpip install git+https://github.com/tarjeir/chunker-mcp - dart_mcp 🎯 🏠 (⭐ 2, 🍴 2, 🐛 1) - A Dart implementation of the Model Context Protocol (MCP)
dartmcpgit clone https://github.com/cristhro/dart_mcp - domain-check-mcp 📜 🏠 (⭐ 2) - A Model Context Protocol (MCP) server for checking domain availability using IONOS endpoints
httpaigitgithubjavascriptnpm install SebastianBoehler/domain-check-mcp - enrichment-mcp 🐍 🏠 (⭐ 2, 🍴 3, 🐛 2) - A Model Context Protocol server for enriching data from multiple security products
httpgitgithubpythonenrichmentpip install git+https://github.com/MSAdministrator/enrichment-mcp - excel-to-json-mcp 🏠 (⭐ 2) - MCP Server converting Excel and CSV data into JSON
exceljsonmcpwtsolutionsservergit clone https://github.com/he-yang/excel-to-json-mcp - freshrss-mcp-server 📜 🏠 📇 (⭐ 2, 🍴 1) - Node.js-based
apihttpaigitgithubnpm install rakeshgangwar/freshrss-server - Gemini-Email-Subject-Generator-MCP 📘 🏠 (⭐ 2, 🍴 3, 🐛 2) - TypeScript-based
httpaimlgitgithubnpm install falahgs/Gemini-Email-Subject-Generator-MCP - HackerMCP 🐍 🏠 (⭐ 2) - Python-based
httpaimlgitgithubpip install git+https://github.com/R3verseIN/HackerMCP - limesurvey-mcp 🐍 🏠 (⭐ 2, 🍴 2) - A MCP (Model Context Protocol) server for interacting with LimeSurvey.
httpmlgitgithubpythonpip install git+https://github.com/edgarrmondragon/limesurvey-mcp - liorfranko/home-assistant-mcp 📘 🏠 (⭐ 2) - Integrate Anthropic's Claude with Home Assistant for seamless natural language control and monitoring of home automation systems.
httpmlanthropicgitgithub - mcp_tianditu 🐍 🏠 📇 (⭐ 2, 🍴 1) - 天地图MCP服务 (Python-based)
apihttpaigitgithubpip install git+https://github.com/bailaohe/mcp_tianditu - mcp-mtg-assistant 🐍 🏠 📇 (⭐ 2) - Python-based
apihttpaigitgithubpip install git+https://github.com/0010aor/mcp-mtg-assistant - minecraft-mcp-server-pixel 📜 🏠 📇 (⭐ 2) - Node.js-based
apihttpaigitgithubnpm install Jeremy-Min-Yang/minecraft-mcp-server-pixel - nostr-code-snippet-mcp 📘 🏠 (⭐ 2) - 🤖 code snippet mcp server
httpgitgithubtypescriptmcpnpm install nodetec/nostr-code-snippet-mcp - pega-dx-mcp 🏠 (⭐ 2) - Pega DX MCP Server - Enabling conversational interaction with Pega Infinity™ applications. This MCP Server transforms Pega Infinity™ interactions into intuitive, conversational experiences through the Model Context Protocol.
mcpservergit clone https://github.com/MarcoLooy/pega-dx-mcp - PentestMCP 🐍 🏠 (⭐ 2) - MCP for interacting with Kali Linux using LLMs like Claude
httpllmgitgithubpythonpip install git+https://github.com/dev-lu/PentestMCP - MCP-Server-Cybersecurity-News 🐍 🏠 (⭐ 2) - Implementazione di un server MCP integrabile con Claude Desktop che consente di accedere alle ultime notizie sulla cybersecurity da vari siti web.
webhttpmlgitgithubpip install git+https://github.com/enggpt-it/MCP-Server-Cybersecurity-News - mj-mcp 🐍 🏠 (⭐ 2) - Midjourney mcp server
httpgitgithubpythonmcppip install git+https://github.com/Lala-0x3f/mj-mcp - restate-mcp-server 📘 🏠 (⭐ 2, 🐛 1) - Restate Admin MCP server
resthttpgitgithubtypescriptnpm install pcholakov/restate-mcp-server - RRR-MCP 🐍 🏠 📇 (⭐ 2) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/rapidriskradar/RRR-MCP - verodat-mcp-server 📘 🏠 (⭐ 2, 🍴 8, 🐛 2) - Verodat MCP Server Implementation
mcpservertypescriptgit clone https://github.com/smithery-ai/verodat-mcp-server - mcp-3d-style-cartoon-gen-server 📜 🏠 (⭐ 2, 🍴 1, 🐛 1) - Node.js-based
filehttpaigitgithubnpm install falahgs/mcp-3d-style-cartoon-gen-server - mcp-clean-code 📜 🏠 (⭐ 2) - Node.js-based
httpaigitgithubjavascriptnpm install aidalinfo/mcp-clean-code - mcp-sqlite-client 🐍 🏠 📇 (⭐ 2) - A simple command line mcp client interacting with sqlite database
apidatabasehttpsqlitellmpip install git+https://github.com/calvinw/mcp-sqlite-client - mcp-teamtailor 📘 🏠 📇 (⭐ 2, 🍴 2) - The MCP Teamtailor is a Model Context Protocol (MCP) server that provides a simple integration with the teamtailor api.
apihttpaimlgitnpm install crunchloop/mcp-teamtailor - mcpserver 🐍 🏠 ☁️ 📇 (⭐ 2, 🐛 1) - Python-based
apiremotehttpdockermlpip install git+https://github.com/AdLibML/mcpserver - molecule_mcp 🏠 (⭐ 2) - MCP server for visualizing molecules in Claude Desktop :)
httpllmgitgithubjupyter notebookgit clone https://github.com/leelasd/molecule_mcp - nba-stats-predictor-mcp 🐍 🏠 (⭐ 2, 🍴 1) - MCP server of NBA stats predictor app that generates player performance forecasts using real-time data analysis and advanced statistical modeling
httpgitgithubpythonmcppip install git+https://github.com/dhrbtjr0331/nba-stats-predictor-mcp - nuvama-mcp 🐍 🏠 📇 (⭐ 2) - MCP server to connect to nuvama-trade apis
httpaigitgithubpythonpip install git+https://github.com/alokamgnaneswarasai/nuvama-mcp - RobotFrameworkLibrary-to-MCP 🏠 (⭐ 2) - How to turn any robot framework library to a mcp server
mcpservergit clone https://github.com/noubar/RobotFrameworkLibrary-to-MCP - wordpress-automation-mcp 🐍 🏠 (⭐ 2) - A quick mcp for Wordpress post automation
httpaigitgithubpythonpip install git+https://github.com/tsainte/wordpress-automation-mcp - agoda-review-mcp ☕ 🏠 (⭐ 2) - MCP server for find agoda hotel reviews
httpllmgitgithubjavagit clone https://github.com/birariro/agoda-review-mcp - dida-mcp-server 📘 🏠 📇 (⭐ 2, 🐛 1) - A Model Context Protocol (MCP) server for interacting with TickTick/Dida365 task management service. This server provides tools to manage tasks, projects, and tags through the TickTick API.
httpaigitgithubtypescriptnpm install zhongwencool/dida-mcp-server - enkryptai-mcp-server 🐍 🏠 (⭐ 2, 🍴 2, 🐛 3) - Python-based
httpaigitgithubpythonpip install git+https://github.com/enkryptai/enkryptai-mcp-server - harness-mcp 🐹 🏠 (⭐ 2, 🍴 1) - Harness MCP server (Go-based)
httpgitgithubgomcpgo install vistaarjuneja/harness-mcp@latest - isolator-mcp 🐹 🏠 (⭐ 2, 🍴 1) - MCP server providing secure code execution (Python, Go, JS) via containers.
httpdockeraigitgithubgo install Ompragash/isolator-mcp@latest - MCP_thingiverse 🏠 (⭐ 2) - MCP for letting Claude search Thingiverse
mcpgit clone https://github.com/gpaul-mcp/MCP_thingiverse - mcp-fathom-analytics 📘 🏠 (⭐ 2, 🍴 4) - MCP server for Fathom Analytics
httpgitgithubanalyticstypescriptnpm install mackenly/mcp-fathom-analytics - mcp-draw 📜 🏠 (⭐ 2) - Fun MCP server that draws / generates images and saves the output locally
httpaigitgithubjavascriptnpm install kdr/mcp-draw - mcp-salesforce-code-search 📘 🏠 (⭐ 2) - TypeScript-based
filehttpgitgithubtypescriptnpm install atskimura/mcp-salesforce-code-search - google-map-mcp 📜 🏠 📇 (⭐ 2) - Node.js-based
apihttpgitgithubjavascriptnpm install RikGmee/google-map-mcp - asdf-mcp-plugin 🐚 🏠 (⭐ 2, 🍴 1, 🐛 10) - ASDF plugin for managing MCP (Model Context Protocol) servers
shellmcpservergit clone https://github.com/hongsw/asdf-mcp-plugin - lq0910/vuesage 📜 🏠 (⭐ 2, 🍴 1) - VueSage enhances Vue component quality through intelligent analysis and optimization, leveraging MCP for seamless integration with editors.
httpmlgitgithub - mcp-investec-sapb-simple 🐍 🏠 📇 (⭐ 2) - Python-based
apihttpmlgitgithubpip install git+https://github.com/acambitsis/mcp-investec-sapb-simple - ngspice-mcp 🏠 (⭐ 2) - An MCP server for interfacing with the ngspice circuit simulator
dmcpservergit clone https://github.com/gtnoble/ngspice-mcp - secure-mcp-server-platform 🏠 (⭐ 2, 🍴 1) - For Dynamous members to learn MCP client/server implementation
mcpservergit clone https://github.com/Ryan-Spooner/secure-mcp-server-platform - twitter-username-changes-mcp 🐍 🏠 (⭐ 2, 🍴 7, 🐛 3) - An MCP server that tracks the historical changes of Twitter usernames.
httpgitgithubpythonmcppip install git+https://github.com/kukapay/twitter-username-changes-mcp - typescript-analyzer-mcp 📘 🏠 (⭐ 2, 🍴 1) - Analyze and fix any types in TypeScript with an intelligent MCP server – fast, extensible, and React-aware.
httpgitgithubtypescriptmcpnpm install davidleathers113/typescript-analyzer-mcp - mcp-server-trueRAG 🏠 (⭐ 2, 🍴 2, 🐛 2) - Model Context Protocol (MCP) server to access an instance of TrueRAG
jupyter notebookmcpservergit clone https://github.com/Ad-Veritas/mcp-server-trueRAG - vscode-mcp-server 🏠 (⭐ 2, 🍴 2) - VSCode MCP Server for managing VSCode settings, extensions, snippets, and more
mcpservergit clone https://github.com/markjspivey-xwisee/vscode-mcp-server - mcproxy 🏠 (⭐ 2, 🍴 1) - A proxy between MCP Clients and MCP Servers
mcpservergit clone https://github.com/LaurentAjdnik/mcproxy - galatanovidiu/wp-wordpress-remote-proxy 📘 🏠 📦 ☁️ (⭐ 1) - Facilitates seamless communication between local and remote WordPress MCP servers through a bidirectional proxy.
remotelocalhttpmlgit - aws-weekly-news-mcp 🐍 🏠 (⭐ 1) - Python-based
httpawsgitgithubpythonpip install git+https://github.com/Kota8102/aws-weekly-news-mcp - backlog-manager-mcp 🐍 🏠 (⭐ 1) - Play project for MCP Server Learning
httpaimlanthropicgitpip install git+https://github.com/danielscholl/backlog-manager-mcp - biblegateway-votd-mcp 🐍 🏠 📇 (⭐ 1) - This is a MCP server for the BibleGateway Verse of the Day (Web Service Only)
apihttpgitgithubpythonpip install git+https://github.com/cmathgit/biblegateway-votd-mcp - ipfind-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 5, 🐛 4) - IP Find MCP Server (Node.js-based)
apihttpaigitgithubnpm install ipfind/ipfind-mcp-server - lta-mcp 📜 🏠 (⭐ 1, 🍴 1, 🐛 10) - MCP server to access Singapore's LTA data
authhttpgitgithubjavascriptnpm install arjunkmrm/sg-lta-mcp - mcp-sentry-custom 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - mcp-sentry-custom (Python-based)
httpaigitgithubpythonpip install git+https://github.com/javaDer/mcp-sentry-custom - mcp-swift-example-server 🦉 🏠 (⭐ 1, 🐛 1) - Example MCP(Model Context Protocol) Server Impl
swiftmcpservergit clone https://github.com/devyhan/mcp-swift-example-server - msbuild-mcp-server 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - A lightweight MCP (Model Context Protocol) server for building MSBuild projects. Supports dynamic MSBuild discovery using vswhere and provides flexible build configuration options.
httpmlgitgithubpythonpip install git+https://github.com/zenoengine/msbuild-mcp-server - notion_fastmcp 🐍 🏠 (⭐ 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/brian3814/notion_fastmcp - openMM-Doc-MCP 🐍 🏠 (⭐ 1) - Python-based
httpaillmgitgithubpip install git+https://github.com/ytworks/openMM-Doc-MCP - postgresql-mcp-server 📘 🏠 (⭐ 1, 🍴 1) - Mcp server for postgres
databasehttppostgresgitgithubnpm install 1Levick3/postgresql-mcp-server - ProxmoxMCP-advance 🐍 🏠 (⭐ 1) - ProxmoxMCP (advance): MCP for Proxmox integration in Claude, Goose, Cline, any client.
httpgitgithubmonitoringpythonpip install git+https://github.com/Markermav/ProxmoxMCP-advance - elevenlabs-mcp 🐍 🏠 📇 (⭐ 1) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/nguyendinhsinh361/elevenlabs-mcp - glue-mcp 🦀 🏠 (⭐ 1) - A model context protocol (MCP) server to AWS Glue Data Catalog
httpawsgitgithubrustcargo install --git https://github.com/atcol/glue-mcp - mattfoster/kcve 🐹 🏠 (⭐ 1) - Facilitates querying Linux Kernel CVEs by integrating a basic MCP server with an SQLite database.
databasehttpsqlitegitgithub - python-interpreter-mcp 🐍 🏠 (⭐ 1) - A Model Context Server providing simple features to automate python script execution via LLMs.
httpllmgitgithubpythonpip install git+https://github.com/bimalpaudels/python-interpreter-mcp - taiwan-cwa-mcp-server 📘 🏠 📇 (⭐ 1) - Taiwan Central Weather Administration (CWA) API MCP Server
apihttpaimlgitnpm install stephen9412/taiwan-cwa-mcp-server - mcp-c 🏠 (⭐ 1) - mcp server frarmwork written in c, developing efficiently and effortlessly
c++mcpmcp-serverservergit clone https://github.com/ZenWayne/mcp-c - 8sleep-mcp 📘 🏠 (⭐ 1, 🍴 1) - MCP server for 8sleep
httpgitgithubtypescriptmcpnpm install elizabethtrykin/8sleep-mcp - claude-code-mcp-docker 🐚 🏠 (⭐ 1)
authhttpdockeraigitgit clone https://github.com/akr4/claude-code-mcp-docker - ddnet-mcpserver 🐍 🏠 (⭐ 1) - 一个可以操作本地ddnet配置文件的mcpserver
filehttpgitgithubpythonpip install git+https://github.com/SilverHi/ddnet-mcpserver - mcp-server-article ☕ 🏠 (⭐ 1) - MCP自动发文服务 (Java-based)
httpaigitgithubjavagit clone https://github.com/gulihua10010/mcp-server-article - ping-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - This mcp server allows Claude to perform network connectivity tests and ping operations.
httpgitgithubpythonmcppip install git+https://github.com/sadeghtkd/ping-mcp-server - prompt-character-mcp-server 🐍 🏠 (⭐ 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/molmolkky/prompt-character-mcp-server - sheet-music-mcp 🏠 (⭐ 1) - A MCP Server for sheet music render
mcpservergit clone https://github.com/imiskolee/sheet-music-mcp - underdoc-tutorial-expense-analytics-mcp-sqlite 🏠 (⭐ 1) - UnderDoc Tutorial - Expense Analytics with MCP Server for SQLite
httpsqliteaigitgithubgit clone https://github.com/under-doc/underdoc-tutorial-expense-analytics-mcp-sqlite - vlang-mcp-server 🏠 (⭐ 1, 🐛 1) - Just for learning
vgit clone https://github.com/lacolaco/vlang-mcp-server - advanced-backlog-mcp-server 📘 🏠 (⭐ 1) - TypeScript-based
httpgitgithubtypescriptnpm install digitalcube/advanced-backlog-mcp-server - Awesome-Official-MCP-Servers 🏠 (⭐ 1) - MCP 精选,MCP Servers,官方MCP
mcpservergit clone https://github.com/MCPStar/Awesome-Official-MCP-Servers - claude-google-images-mcp 📜 🏠 (⭐ 1) - A Mod Content Pack for Claude Desktop that helps retrieve images from Google Images
httpgitgithubjavascriptgonpm install Arnoutopya/claude-google-images-mcp - adrianmonad/MonDeployer 📜 🏠 (⭐ 1) - Facilitates the deployment of Solidity contracts to the Monad testnet using AI and MCP integration.
httpaigitgithub - AWS-cost-explorer-with-MCP-server 🐍 🏠 (⭐ 1) - Python-based
httpawsanthropicgitgithubpip install git+https://github.com/sanxxit/AWS-cost-explorer-with-MCP-server - bizflycloud-mcp-server 🐹 🏠 (⭐ 1) - A Model Context Protocol (MCP) server implementation that connects to Bizfly Cloud to manage cloud resources
httpgitgithubgomcpgo install bizflycloud/bizflycloud-mcp-server@latest - bootiful-wordpress-mcp-server ☕ 🏠 (⭐ 1) - 🍃 WordPress MCP Server written with Java & Spring Boot
httpgitgithubjavamcpgit clone https://github.com/PragmaTech-GmbH/bootiful-wordpress-mcp-server - CelestialMCP 📘 🏠 (⭐ 1, 🍴 3, 🐛 2) - TypeScript-based
httpaimlgitgithubnpm install Rkm1999/CelestialMCP - cf-example-remote-mcp-server 📘 🏠 ☁️ (⭐ 1) - TypeScript-based
remoteauthoauthhttpmlnpm install noahseger/cf-example-remote-mcp-server - claude-mcp-manager 🐚 🏠 (⭐ 1) - Script to easily switch between Claude MCP server configurations on macOS.
shellmcpservergit clone https://github.com/BLTGV/claude-mcp-config-switcher - claude-openweather-mcp 🐍 🏠 📇 (⭐ 1) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/ChandekarDhruvin/claude-openweather-mcp - climate-triage-mcp 📘 🏠 📇 (⭐ 1, 🍴 4, 🐛 2) - TypeScript-based
apihttpaigitgithubnpm install Codeshark-NET/climate-triage-mcp - custom-mcp-servers 🏠 (⭐ 1) - Learn the ins and outs of Model Context Protocol, MCP servers, and custom implementations
mcpservergit clone https://github.com/Dyno-Community-Code-Space/custom-mcp-servers - dad-mcp 📘 🏠 ☁️ (⭐ 1) - Remote MCP server for providing better education at home
remotehttpaigitgithubnpm install andyrewlee/dad-mcp - die-mcp 🏠 (⭐ 1) - Detect-It-Easy MCP Server
mcpservergit clone https://github.com/MCPPhalanx/die-mcp - fess-mcp-server 🐍 🏠 (⭐ 1) - MCP server for interfacing with Fess search engine.
httpgitgithubpythonmcppip install git+https://github.com/g-fukurowl/fess-mcp-server - Garak-MCP 🐍 🏠 (⭐ 1, 🍴 3) - MCP Server for using Garak LLM vulnerability scanner
httpllmgitgithubpythonpip install git+https://github.com/EdenYavin/Garak-MCP - github-releases-mcp 📜 🏠 (⭐ 1) - A powerful Model Context Protocol (MCP) toolkit for GitHub releases management. This server provides comprehensive tools for accessing, comparing, and analyzing GitHub repository releases with rich formatting and detailed information.
httpaigitgithubjavascriptnpm install SLineroDev/github-releases-mcp - handsome-server-python 🐍 🏠 (⭐ 1) - 一个基于 MCP (Model Context Protocol) 的简单服务器,提供了一个
who_is_handsome工具函数。httpgitgithubpythonmcppip install git+https://github.com/Yantha6/handsome-server-python - horologic-mcp 📘 🏠 (⭐ 1) - TypeScript-based
httpmlgitgithubtypescriptnpm install yoda-digital/horologic-mcp - hotpepper-gourmet-mcp-server 🐹 🏠 📇 (⭐ 1, 🐛 10) - ホットペッパーグルメ MCP Server
apihttpgitgithubgogo install miyamo2/hotpepper-gourmet-mcp-server@latest - hubspot-mcp-server 📘 🏠 📇 (⭐ 1) - TypeScript-based
apihttpaimlgitnpm install NaorAIdeas/hubspot-mcp-server - imagemagic-mcp 🐍 🏠 (⭐ 1) - Python-based
httpaigitgithubpythonpip install git+https://github.com/aimino/imagemagic-mcp - cwa-mcp-server 🐚 🏠 📇 (⭐ 1, 🍴 1, 🐛 1) - 利用台灣中央氣象局的 API 建立 MCP-server
apihttpaigitgithubgit clone https://github.com/lincw/cwa-mcp-server - dank-mcp 🐹 🏠 (⭐ 1) - Model Context Procotol (MCP) server with tools for Cannabis Datasets.
httpllmgitgithubgogo install AgentDank/dank-mcp@latest - db2-mcp 🐍 🏠 (⭐ 1) - a MCP Server for DB2 for LUW
databasehttpgitgithubpythonpip install git+https://github.com/longxiangzhu/db2-mcp - illustrator-mcp 🐍 🏠 (⭐ 1) - MCP that connects illustrator to claude desktop
httpgitgithubpythonmcppip install git+https://github.com/AnshulDalua/illustrator-mcp - jdelon02/chat-orchestrate 🐍 🏠 (⭐ 1) - A versatile MCP server built with mcp-framework, enabling the creation and integration of custom tools for enhanced functionality.
httpgitgithub - linear-mcp-server-again 📜 🏠 (⭐ 1) - Node.js-based
httpaigitgithubjavascriptnpm install larryhudson/linear-mcp-server-again - liuchongchong1995/nodejs 📜 🏠 (⭐ 1) - Facilitates runtime debugging of Node.js applications using Cursor or Claude Code.
httpgitgithub - Make_MCP 🐍 🏠 (⭐ 1, 🍴 1) - An MCP server for making MCP servers
httpgitgithubpythonmcppip install git+https://github.com/RoryMB/Make_MCP - MardiantoS/alpaca-mcp-server 🐍 🏠 📇 (⭐ 1, 🍴 1) - Facilitates interaction between Large Language Models and Alpaca's trading API for automated trading operations.
apihttpgitgithub - MCP_ravelry 🏠 (⭐ 1, 🍴 1, 🐛 2) - MCP for letting Claude search Ravelry
mcpgit clone https://github.com/gpaul-mcp/MCP_ravelry - mcp-chess-poc 📜 🏠 (⭐ 1) - Play chess in a GUI against an LLM using MCP
httpaillmgitgithubnpm install matthijn/mcp-chess-poc - mcp-clickup 🏠 (⭐ 1, 🍴 1) - ClickUp MCP Server
mcpservergit clone https://github.com/johaneriksson-io/mcp-clickup - mcp-datapi 🐍 🏠 📇 (⭐ 1) - An MCP server for working with ECWMF data catalogues
apihttpgitgithubpythonpip install git+https://github.com/albertdow/mcp-datapi - mcp-helm-chart 🏠 (⭐ 1, 🍴 2) - Helm Chart for MCP Server
smartymcpservergit clone https://github.com/chatmcp/mcp-helm-chart - mcp-server-igcl-poc 🏠 (⭐ 1) - A PoC of MCP Server for IGCL
c++mcpservergit clone https://github.com/paulchi-intel/mcp-server-igcl-poc - Spring-Boot-Sample-MCP-Server ☕ 🏠 (⭐ 1, 🍴 1) - Java-based
httpaimlgitgithubgit clone https://github.com/tobiassteidle/Spring-Boot-Sample-MCP-Server - uupt-mcp-server 🐍 🏠 (⭐ 1, 🍴 1) - 通过MCP协议在uupt.com开放平台创建订单
httpgitgithubpythonmcppip install git+https://github.com/uupt-mcp/uupt-mcp-server - youtube_shorts_with_mcp_server 🏠 (⭐ 1) - Открытый инструмент для автоматизированного создания коротких видеороликов с поддержкой MCP и переводом README на русский язык.
mcpgit clone https://github.com/finesoft2009/youtube_shorts_with_mcp_server - mcp-server-altibase 🐍 🏠 (⭐ 1) - Python-based
databasehttpgitgithubpythonpip install git+https://github.com/hesslee/mcp-server-altibase - mcp-server-proj 🐍 🏠 (⭐ 1) - MCP Server PROJ (cartographic projections and coordinate transformations )
httpgitgithubpythonmcppip install git+https://github.com/radial-hks/mcp-server-proj - mcp-servers-collection 🐚 🏠 (⭐ 1) - A collection of Model Context Protocol (MCP) servers for enhancing Claude's capabilities in Cursor IDE
shellmcpservergit clone https://github.com/fpardon-upeo/mcp-servers-collection - mixpanel-mcp-server 📜 🏠 (⭐ 1) - MCP server for Mixpanel Analytics integration with AI assistants. Enables Claude and other MCP clients to track events, pageviews, and user profiles through conversational interfaces.
filehttpgitgithubanalyticsnpm install ciaraadkins/mixpanel-mcp-server - odoo-accounting-mcp 🐍 🏠 (⭐ 1) - Experimental MCP Server for Odoo ERP
httpaigitgithubpythonpip install git+https://github.com/jeevanism/odoo-accounting-mcp - mcp-temple 📜 🏠 (⭐ 1) - 模型上下文协议服务器,构建自己的 cursor mcp 模板
httpgitgithubjavascriptcursornpm install ndlxp2008/mcp-temple - me_mcp_server 🎯 🏠 (⭐ 1)
filehttpgitgithubdartgit clone https://github.com/jhgaylor/me_mcp_server - monad-bridge-mcp-server 📘 🏠 (⭐ 1) - Monad MCP server for Bridge tools
httpgitgithubtypescriptmcpnpm install rawakinode/monad-bridge-mcp-server - monad-mcp 📘 🏠 (⭐ 1) - TypeScript-based
httpgitgithubtypescriptnpm install AlexVagrant/monad-mcp - monad-mcp-magiceden 📘 🏠 (⭐ 1, 🍴 3, 🐛 2) - Monad MCP (TypeScript-based)
httpgitgithubtypescriptmcpnpm install Sifu213/monad-mcp-magiceden - myssl-mcp-server-python 🐍 🏠 (⭐ 1) - The MySSL MCP Server
httpllmgitgithubpythonpip install git+https://github.com/trustasia-com/myssl-mcp-server-python - ns-lookup-mcp 🐍 🏠 📇 (⭐ 1) - A simple MCP Server that exposes the nslookup command functionality
apiresthttpgitgithubpip install git+https://github.com/wgr1984/ns-lookup-mcp - nysse-mcp-server 📘 🏠 (⭐ 1) - Nysse bus tracking MCP server for LLM AI agents
httpaigitgithubtypescriptnpm install tlaukkanen/nysse-mcp-server - Offensive-MCP-Servers-List 🏠 (⭐ 1, 🍴 1) - List of Public Offensive MCP Server Repositories
mcpservergit clone https://github.com/scboln/Offensive-MCP-Servers-List - openapi-mcpserver-generator 📜 🏠 📇 (⭐ 1) - Generate MCP server from openapi specifications
apihttpmlllmgitnpm install vincent-pli/openapi-mcpserver-generator - os-info-mcp-server 📘 🏠 (⭐ 1) - TypeScript-based
httpgitgithubtypescriptnpm install anurag-dhamala/os-info-mcp-server - plainsignal-mcp 📜 🏠 📇 (⭐ 1) - PlainSignal Official MCP Server
httpaigitgithubanalyticsnpm install plainsignal/plainsignal-mcp - py-az-mcp 🐍 🏠 (⭐ 1) - An Azure MCP Server
httpazuremlgitgithubpip install git+https://github.com/JCallico/py-az-mcp - peer-mcp 🏠 (⭐ 1) - MCP Proxy to Expose Local MCP Server
mcpservergit clone https://github.com/aiworkspace/peer-mcp - perm-shell-mcp 📘 🏠 (⭐ 1, 🍴 3, 🐛 3) - TypeScript-based
httpgitgithubtypescriptnpm install mcollina/perm-shell-mcp - playlist-mcp 🐍 🏠 (⭐ 1, 🍴 1, 🐛 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/luebken/playlist-mcp - project-mem-mcp 🐍 🏠 (⭐ 1) - An MCP server that enables AI agents to persistently store and retrieve project information from a memory file.
filehttpaimlgitpip install git+https://github.com/PyneSys/project-mem-mcp - RaRdq/RR.MCP 🏠 (⭐ 1) - Facilitates AI-driven .NET project analysis by extracting interfaces, models, and data structures using PowerShell scripts.
httpaigitgithub - Vulnerable-file-reader-server 🐍 🏠 (⭐ 1) - A deliberately vulnerable MCP server demonstrating command injection flaws. This Python implementation shows how lack of input sanitization in file paths leads to critical security vulnerabilities allowing attackers to execute arbitrary commands. For educational purposes only - demonstrates both the vulnerability and proper security practices.
filehttpgitgithubpythonpip install git+https://github.com/Eliran79/Vulnerable-file-reader-server - zellij-mcp-server 🏠 (⭐ 1) - A MCP Server to over zellij over STDIO
mcpservergit clone https://github.com/superposition/zellij-mcp-server - location-mcp-server 🦉 🏠 (⭐ 1) - An MCP (Model Context Protocol) server that provides location data from a local macOS app.
httpgitgithubswiftmcpgit clone https://github.com/sokyran/location-mcp-server - maxcompute-mcp-server 🐍 🏠 (⭐ 1, 🍴 1, 🐛 2) - Alibaba cloud MaxCompute (ODPS) MCP server implemented by python
httpgitgithubpythonalibabacloudpip install git+https://github.com/datafe/maxcompute-mcp-server - lumbretravel-mcp 📘 🏠 📇 (⭐ 1, 🍴 3, 🐛 3) - TypeScript-based
apihttpmlgitgithubnpm install lumile/lumbretravel-mcp - mcp_control_table_lamp 🐍 🏠 ☁️ (⭐ 1) - A complete IoT solution with Model Context Protocol to control a table lamp (or any other appliance) remotely using a NodeMCU, relay module, and MQTT communication through HiveMQ cloud service.
remotehttpgitgithubpythonpip install git+https://github.com/shelwyn/mcp_control_table_lamp - mcp_server_nasa 🐍 🏠 📇 (⭐ 1) - MCP demo server (Python-based)
apihttpgitgithubpythonpip install git+https://github.com/fdmocho/mcp_server_nasa - mcp_video_analysis 📜 🏠 (⭐ 1) - Node.js-based
httpgitgithubjavascriptnpm install tjh19971228/mcp_video_analysis - mcp-compare-zipcodes 🐍 🏠 (⭐ 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/anna8murphy/mcp-compare-zipcodes - mcp-experiments 🐍 🏠 (⭐ 1) - This project provides an MCP (Model Context Protocol) server that allows LLMs to perform actions to control a Mac desktop computer using bash and AppleScript.
httpllmgitgithubpythonpip install git+https://github.com/jordanperr/mcp-experiments - mcp-gpt-image 📘 🏠 📇 (⭐ 1) - TypeScript-based
apihttpdockeraiopenainpm install 4kk11/mcp-gpt-image - mcp-openweathermap 🐍 🏠 📇 (⭐ 1) - Python-based
apihttpgitgithubpythonpip install git+https://github.com/leonhardholz/mcp-openweathermap - remote-cloudflare-youtube-transcript-mcp-server 📘 🏠 ☁️ (⭐ 1, 🍴 1) - TypeScript-based
remotehttpgitgithubtypescriptnpm install objones25/remote-cloudflare-youtube-transcript-mcp-server - rssmcp 🐍 🏠 (⭐ 1, 🍴 1, 🐛 2) - Simple RSS MCP Server
httpgitgithubpythonmcp-serverpip install git+https://github.com/Lunran/rssmcp - rtc-mcp-server 🏠 (⭐ 1, 🍴 1) - A Model Context Protocol (MCP) server implementation for managing Alibaba Cloud Realtime Computing Flink resources
mcpservergit clone https://github.com/gnuhpc/rtc-mcp-server - sanxxit/my-aws-cost-explorer 🐍 🏠 (⭐ 1) - Facilitates AWS spend analysis and visualization through an MCP server, integrating with Anthropic's Claude model for natural language queries.
httpawsanthropicgitgithub - mcp-qdrant-server-with-qdrant-db 🐚 🏠 (⭐ 1) - qdrant + mcp-qdrant-server
shellmcpservergit clone https://github.com/ChangJunPark/mcp-qdrant-server-with-qdrant-db - mcp-server-nodemcu 📜 🏠 (⭐ 1, 🍴 3, 🐛 2) - Node.js-based
httpaigitgithubjavascriptnpm install amanasmuei/mcp-server-nodemcu - mcp-sse-servers 🏠 (⭐ 1) - Model Context Protocol Servers with SSE
servergit clone https://github.com/erhwenkuo/mcp-sse-servers - sbb-mcp-server 🏠 (⭐ 1)
httpgitgithubhtmlgit clone https://github.com/ralf-boltshauser/sbb-mcp-server - searchAPI-mcp 📜 🏠 📇 (⭐ 1) - Node.js-based
apihttpgitgithubjavascriptnpm install RikGmee/searchAPI-mcp - software-checker-mcp 🐍 🏠 (⭐ 1) - Python-based
httpgitgithubpythonpip install git+https://github.com/Tomatio13/software-checker-mcp - swift-sdk 🦉 🏠 (⭐ 1) - Swift SDK for Model Context Protocol servers and clients
swiftservergit clone https://github.com/adamwulf/mcp-swift-sdk - the-wordpress-mcp-server 📜 🏠 📇 (⭐ 1, 🍴 3, 🐛 2) - Node.js-based
apiresthttpjsonmlnpm install Leonelberio/the-wordpress-mcp-server - xlsm-mcp-server 🐍 🏠 (⭐ 1) - Este servidor implementa el Model Context Protocol (MCP) para manipular archivos Excel que contienen macros (.xlsm). Utiliza el protocolo stdio para la comunicación, lo que permite integrarse fácilmente con clientes MCP como Claude.
filehttpaigitgithubpip install git+https://github.com/orlando2019/xlsm-mcp-server - Instructions: Add to
~/.cursor/mcp.jsonor.cursor/mcp.json(project* - specific)json - *Server URL:
https://mcp.my** - awesome-server.com/ssehttp - Vaadin - Search Vaadin documentation, get the full documentation, and get version information. Designed for AI agents.
httpaigitgithub - Vercel - Access logs, search docs, and manage projects and deployments.
http - AltTester® - Use AltTester® capabilities to connect and test your Unity or Unreal game. Write game test automation faster and smarter, using AltTester and the AltTester® MCP server.
httpaiml - GoLogin MCP server - Manage your GoLogin browser profiles and automation directly through AI conversations!
apifilehttpaigit - Apify - Use 6,000+ pre-built cloud tools to extract data from websites, e-commerce, social media, search engines, maps, and more
apiwebhttpgitgithub - Apollo MCP Server - Connect your GraphQL APIs to AI agents
apigraphqlhttpaigit - Codacy - Interact with Codacy API to query code quality issues, vulnerabilities, and coverage insights about your code.
apihttpgitgithub - Cycode - Boost security in your dev lifecycle via SAST, SCA, Secrets & IaC scanning with Cycode.
httpgitgithub - Glean - Enterprise search and chat using Glean's API.
apihttpgitgithub - Hyperbolic - Interact with Hyperbolic's GPU cloud, enabling agents and LLMs to view and rent available GPUs, SSH into them, and run GPU-powered workloads for you.
httpaillmgitgithub - Norman Finance - MCP server for managing accounting and taxes with Norman Finance.
httpgitgithub - Paper - Realistic paper trading platform with market simulation, 22 broker emulations, and professional tools for risk-free trading practice. First trading platform with MCP integration.
httpgitgithub - Snyk - Enhance security posture by embedding Snyk vulnerability scanning directly into agentic workflows.
httpaigitgithub - Nerve - Search and Act on all your company data across all your SaaS apps via Nerve
httpgitgithub - Backdocket - Search, Retrieve, and Update your Backdocket data. This currently includes Claims, Matters, Contacts, Tasks and Advanced Searches. To easily use the Remote Mcp Server utilize the following url: https://ai.backdocket.com/mcp)
remotehttpai - Atlan - The Atlan Model Context Protocol server allows you to interact with the Atlan services through multiple tools.
httpaigitgithub - Thena - Thena's MCP server for enabling users and AI agents to interact with Thena's services and manage customers across different channels such as Slack, Email, Web, Discord etc.
webhttpaigitgithub - Render - The official Render MCP server: spin up new services, run queries against your databases, and debug rapidly with direct access to service metrics and logs.
apidatabasehttpaigit - Redis - The Redis official MCP Server offers an interface to manage and search data in Redis.
httpredisgitgithub - Redis Cloud API - The Redis Cloud API MCP Server allows you to manage your Redis Cloud resources using natural language.
apihttpredisgitgithub - Teradata - This MCP Server support tools and prompts for multi task data analytics on a Teradata platform.
httpgitgithubanalyticsdatabase - Ragie - Retrieve context from your Ragie (RAG) knowledge base connected to integrations like Google Drive, Notion, JIRA and more.
httpaigitgithub - VictoriaLogs - Integration with VictoriaLogs APIs and documentation for working with logs and debugging tasks related to your VictoriaLogs instances.
apihttpgitgithubmetrics - VictoriaTraces - Integration with VictoriaTraces APIs and documentation for working with distributed tracing and debugging tasks related to your VictoriaTraces instances.
apihttpgitgithubmetrics - Linkup - (Python version) MCP server that provides web search capabilities through Linkup's advanced search API. This server enables AI assistants and development tools to perform intelligent web searches with natural language queries.
apiwebhttpaigit - Nodit - Official Nodit MCP Server enabling access to multi-chain RPC Nodes and Data APIs for blockchain data.
apihttpaigitgithub - Offorte - Offorte Proposal Software official MCP server enables creation and sending of business proposals.
httpgitgithub - Storybook - Interact with Storybook to automate UI component testing and documentation
httpgitgithub - ThingsBoard - The ThingsBoard MCP Server provides a natural language interface for LLMs and AI agents to interact with your ThingsBoard IoT platform.
httpaillmgitgithub - Kaltura - Manage Kaltura Event Platform. Provide tools and resources for creating, managing, and interacting with Kaltura virtual events.
httpgitgithub - Google Maps Platform Code Assist - Ground agents on fresh, official documentation and code samples for optimal geo-related guidance and code..
httpaigitgithub - NanoVMs - Easily Build and Deploy unikernels to any cloud.
httpgitgithub - QuantConnect - Interact with your QuantConnect account to update projects, write strategies, run backtest, and deploying strategies to production live-trading.
httpgitgithubapilocal - Notion - This project implements an MCP server for the Notion API.
apihttpgitgithub - Kintone - The official local MCP server for Kintone.
localhttpgitgithub - CTERA Edge Filer - CTERA Edge Filer delivers intelligent edge caching and multiprotocol file access, enabling fast, secure access to files across core and remote sites.
fileremotehttpgitgithub - CTERA Portal - CTERA Portal is a multi-tenant, multi-cloud platform that delivers a global namespace and unified management across petabytes of distributed content.
httpgitgithub - Drata - Get hands-on with our experimental MCP server—bringing real-time compliance intelligence into your AI workflows.
httpaigitgithub - Tencent RTC - The MCP Server enables AI IDEs to more effectively understand and use Tencent's Real-Time Communication SDKs and APIs, which significantly streamlines the process for developers to build audio/video call applications.
apihttpaimlgit - Unblocked Help your AI-powered IDEs generate faster, more accurate code by giving them access to context from Slack, Confluence, Google Docs, JIRA, and more with Unblocked.
httpaigitgithubslack - Tldv - Connect your AI agents to Google-Meet, Zoom & Microsoft Teams through tl;dv
webhttpaigitgitlab - Baserow - Query data from Baserow self-hosted or SaaS databases using MCP integration.
apidatabasehttpgitgitlab - Buildable (TypeScript) - Official MCP server for Buildable AI-powered development platform. Enables AI assistants to manage tasks, track progress, get project context, and collaborate with humans on software projects.
httpaigitgithub - Boikot - Learn about the ethical and unethical actions of major companies with boikot.xyz.
httpgitgithub - BoldSign - Search, request, and manage e-signature contracts effortlessly with BoldSign.
httpgitgithub - Boost.space - An MCP server integrating with Boost.space for centralized, automated business data from 2000+ sources.
httpgitgithub - BoostSecurity - Powered by BoostSecurity, the MCP guardrails coding agents against introducing dependencies with vulnerabilities, malware or typosquatting.
httpaigitgithub - ClickSend - This is the official ClickSend MCP Server developed by ClickSend team.
httpgitgithub - Homebrew Allows Homebrew users to run Homebrew commands locally.
localhttp - BuiltWith - Identify the technology stack behind any website.
webhttpgitgithub - Azure DevOps - Interact with Azure DevOps services like repositories, work items, builds, releases, test plans, and code search.
httpazuregitgithub - Azure - The Azure MCP Server gives MCP Clients access to key Azure services and tools like Azure Storage, Cosmos DB, the Azure CLI, and more.
httpazureaigitgithub - AllVoiceLab - An AI voice toolkit with TTS, voice cloning, and video translation, now available as an MCP server for smarter agent integration.
httpai - Databricks - Connect to data, AI tools & agents, and the rest of the Databricks platform using turnkey managed MCP servers. Or, host your own custom MCP servers within the Databricks security and data governance boundary.
webresthttpawsai - PagerDuty - Interact with your PagerDuty account, allowing you to manage incidents, services, schedules, and more directly from your MCP-enabled client.
httpgitgithub - Chiki StudIO - Create your own configurable MCP servers purely via configuration (no code), with instructions, prompts, and tools support.
http - Roblox Studio - Roblox Studio MCP Server, create and manipulate scenes, scripts in Roblox Studio
httpgitgithub - Mixpanel - Query and analyze your product analytics data through natural language. This Mixpanel MCP connects AI assistants to your Mixpanel workspace, enabling conversational access to user behavior insights, funnels, retention analysis, and custom reports.
httpaianalytics - GitGuardian - GitGuardian official MCP server - Scan projects using GitGuardian's industry-leading API, which features over 500 secret detectors to prevent credential leaks before they reach public repositories. Resolve security incidents directly with rich contextual data for rapid, automated remediation.
apiwebfilehttpgit - Grain - Access your Grain meetings notes & transcripts directly in claude and generate reports with native Claude Prompts.
webfilehttpai - Knit MCP Server - Production-ready remote MCP servers that enable you to connect with 10000+ tools across CRM, HRIS, Payroll, Accounting, ERP, Calendar, Expense Management, and Chat categories.
webfileremotehttp - Harper - An MCP server providing an interface for MCP clients to access data within Harper.
webfilehttpgitgithub - Gremlin - The official Gremlin MCP server. Analyze your reliability posture, review recent tests and chaos engineering experiments, and create detailed reports.
webfilehttpaiml - Endor Labs - Find and fix security risks in you code. Integrate Endor Labs to scan and secure your code from vulnerabilities and secret leaks.
webfilehttp - Conductor - Interact with Conductor (OSS and Orkes) REST APIs.
apiwebfileresthttp - Atla - Enable AI agents to interact with the Atla API for state-of-the-art LLMJ evaluation.
apiwebfilehttpai - Bauplan - Manage the Bauplan lakehouse: query tables, create data branches, run pipelines, retrieve logs.
webfilehttpgitgithub - Reflag - Create and manage feature flags using Reflag
webfilehttpaigit - JetBrains - Work on your code with JetBrains IDEs: IntelliJ IDEA, PhpStorm, etc.
httpaiml - Token Metrics - Token Metrics integration for fetching real-time crypto market data, trading signals, price predictions, and advanced analytics.
httpgitgithubmetricsanalytics - Zapier - Connect your AI Agents to 8,000 apps instantly.
apihttpai - Cheqd - Enable AI Agents to be trusted, verified, prevent fraud, protect your reputation, and more through cheqd's Trust Registries and Credentials.
httpaigitgithub - Cleanup Crew - Real-time human support service for non-technical founders using AI coding tools. When AI hits a wall, request instant human help directly from your IDE.
httpai - ConfigCat - Enables AI tools to interact with ConfigCat, a feature flag service for teams. Supports managing ConfigCat feature flags, configs, environments, products and organizations. Helps to integrate ConfigCat SDK, implement feature flags and remove zombie (stale) flags.
httpaigitgithub - Microsoft Dataverse - Chat over your business data using NL - Discover tables, run queries, retrieve data, insert or update records, and execute custom prompts grounded in business knowledge and context.
httpazure - Customer.io - Let any LLM work directly with your Customer.io workspace to create segments, inspect user profiles, search for customers, and access workspace data. Analyze customer attributes, manage audience targeting, and explore your workspace without switching tabs.
filehttpaillm - Tako - Use natural language to search Tako for real-time financial, sports, weather, and public data with visualization
httpgitgithub - Alkemi - Query Snowflake, Google BigQuery, DataBricks Data Products through Alkemi.ai.
httpaigitgithub - Debugg.AI - Zero-Config, Fully AI-Managed End-to-End Testing for any code gen platform via Debugg.AI remote browsing test agents.
remotehttpaigitgithub - Defang - Deploy your project to the cloud seamlessly with the Defang platform without leaving your integrated development environment
httpaimlgitgithub - Detailer - Instantly generate rich, AI-powered documentation for your GitHub repositories. Designed for AI agents to gain deep project context before taking action.
httpaigitgithub - DevCycle - Create and monitor feature flags using natural language in your AI coding assistant.
httpai - Aqara MCP Server - Control Aqara smart home devices, query status, execute scenes, and much more using natural language.
httpgitgithub - WordPress.com - Connect your AI assistant to WordPress.com, giving you direct visibility into your site's content, analytics, and settings.
httpaianalytics - TomTom-MCP - The TomTom MCP Server simplifies geospatial development by providing seamless access to TomTom's location services, including search, routing, traffic and static maps data.
httpmlgitgithub - Mulesoft - Build, deploy, and manage MuleSoft applications with natural language, directly inside any compatible IDE.
http - VCAgents - Interact with investor agents—think Wilson or Thiel—continuously updated with market intel.
httpaigitgithub - proxymock - An MCP server that automatically generates tests and mocks by recording a live app.
http - Apache Doris - MCP Server For Apache Doris, an MPP-based real-time data warehouse.
httpgitgithub - Dot (GetDot.ai) - Fetch, analyze or visualize data from your favorite database or data warehouse (Snowflake, BigQuery, Redshift, Databricks, Clickhouse, ...) with Dot, your AI Data Analyst. This remote MCP server is a one-click integration for user that have setup Dot.
databaseremotehttpai - Yeelight MCP Server - The official Yeelight MCP Server enables users to control and query their Yeelight smart devices using natural language, offering a seamless and efficient human-AI interaction experience.
httpaimlgitgithub - fetchSERP - All-in-One SEO & Web Intelligence Toolkit API fetchSERP
apiwebhttpgitgithub - Alpaca - Alpaca's MCP server lets you trade stocks and options, analyze market data, and build strategies through Alpaca's Trading API
apiwebfilehttpgit - Firecrawl - Extract web data with Firecrawl
webhttpgitgithub - FIXParser - A modern FIX Protocol engine for AI-powered trading agents
httpaigitgitlab - Flutterwave - Interact with Flutterwave payment solutions API, to manage transactions, payment links and more.
apihttpaigitgithub - ForeverVM - Run Python in a code sandbox.
httpaigitgithub - Razorpay - Razorpay's official MCP server
httpgitgithub - ActionKit by Paragon - Connect to 130+ SaaS integrations (e.g. Slack, Salesforce, Gmail) with Paragon’s ActionKit API.
apihttpaigitgithub - Gcore - Interact with Gcore platform services via LLM assistants, providing unified access to CDN, GPU Cloud & AI Inference, Video Streaming, WAAP, and cloud resources including instances and networks.
httpaillmgitgithub - Gitea - Interact with Gitea instances with MCP.
httpgit - Sugar - Autonomous AI development platform for Claude Code with task management, specialized agents, and workflow automation. Full MCP server bridges Claude with Python CLI for rich task context and autonomous execution.
httpaigitgithub - Dolt - The official MCP server for version-controlled Dolt databases.
databasehttpaigitgithub - Ember AI - A unified MCP server that enables AI agents to execute cross-chain DeFi strategies.
httpaigitgithub - Construe - FastMCP server for intelligent Obsidian vault context management with frontmatter filtering, automatic chunking, and secure bidirectional knowledge operations.
httpgitgithub - PromptHouse - Personal prompt library with MCP integration for AI clients.
httpaigitgithub - Memalot - Finds memory leaks in Python programs.
filehttpaigitgithub - GitLab - GitLab's official MCP server enabling AI tools to securely access GitLab project data, manage issues, and perform repository operations via OAuth 2.0.
authoauthhttpaigit - MCP Toolbox for Databases - Open source MCP server specializing in easy, fast, and secure tools for Databases. Supports AlloyDB, BigQuery, Bigtable, Cloud SQL, Dgraph, Looker, MySQL, Neo4j, Postgres, Spanner, and more.
apidatabasehttpmysqlpostgres - Grafbase - Turn your GraphQL API into an efficient MCP server with schema intelligence in a single command.
apigraphqlhttpaigit - GROWI - Official MCP Server to integrate with GROWI APIs.
apihttpgitgithub - Gyazo - Search, fetch, upload, and interact with Gyazo images, including metadata and OCR data.
httpgitgithub - HeyOnCall - Page a human, sending critical or non-critical alerts to the free HeyOnCall iOS or Android apps.
http - Hugging Face - Connect to the Hugging Face Hub APIs programmatically: semantic search for spaces and papers, exploration of datasets and models, and access to all compatible MCP Gradio tool spaces!
apihttpai - Hunter - Interact with the Hunter API to get B2B data using natural language.
apihttpgitgithub - Trade Agent - Execute stock and crypto trades on your brokerage via Trade Agent
httpaigitgithub - Improve Digital Publisher MCP - An MCP server that enables publishers to integrate Improve Digital’s inventory management system with their AI tools or agents.
httpaigitgithub - Integration App - Interact with any other SaaS applications on behalf of your customers.
httpgitgithub - Jellyfish - Give your AI agent context about your team's software engineering allocations and workflow via the Jellyfish platform
httpaigitgithub - Jenkins - Official Jenkins MCP Server plugin enabling AI assistants to manage builds, check job statuses, retrieve logs, and integrate with CI/CD pipelines through standardized MCP interface.
httpai - Keywords Everywhere - Access SEO data through the official Keywords Everywhere API MCP server.
apihttp - Kiln - A free open-source platform for building production-ready AI systems. It supports RAG pipelines, AI agents, MCP tool-calling, evaluations, synthetic data generation, and fine-tuning — all in one unified framework by Kiln-AI.
httpaigitgithub - KirokuForms - KirokuForms is an AI-powered form platform combining professional form building with Human-in-the-Loop (HITL) capabilities. Create custom forms, collect submissions, and integrate human oversight into AI workflows through MCP integration.
httpai - Knock MCP Server - Send product and customer messaging across email, in-app, push, SMS, Slack, MS Teams.
httpaigitgithubslack - Microsoft Business Central - Manage Dynamics 365 Business Central customers, contacts, sales opportunities, invoices, and vendors
httpaigitgithub - Neo4j Agent Memory - Memory management for AI agents using Neo4j knowledge graphs
httpaigitgithub - Kumo - MCP Server to interact with KumoRFM, a foundation model for generating predictions from your relational data.
httpawsaigitgithub - kweenkl - Send push notifications from AI assistants using natural language. Pre-launch demo available with example webhook token.
webhttpaigitgithub - Label Studio - Open Source data labeling platform.
httpgitgithub - Microsoft Learn Docs - An MCP server that provides structured access to Microsoft's official documentation. Retrieves accurate, authoritative, and context-aware technical content for code generation, question answering, and workflow grounding.
authhttpgitgithub - SQL Server - Official Microsoft SQL Server MCP1
httpazureaigitgithub - Linear - Search, create, and update Linear issues, projects, and comments.
http - Lingo.dev - Make your AI agent speak every language on the planet, using Lingo.dev Localization Engine.
localhttpaigitgithub - Magic Meal Kits - Unleash Make's Full Potential by Magic Meal Kits
httpgitgithub - OlaMaps - Official Ola Maps MCP Server for services like geocode, directions, place details and many more.
httpai - Kernel - Access Kernel's cloud‑based browsers via MCP.
httpgitgithub - Paubox - Official MCP server which allows AI agents to interact with Paubox Email API. HITRUST certified.
apihttpaiemail - MCPProxy - Open-source local app that enables access to multiple MCP servers and thousands of tools with intelligent discovery via MCP protocol, runs servers in isolated environments, and features automatic quarantine protection against malicious tools.
localhttpaigitgithub - Archbee - Write and publish documentation that becomes the trusted source for instant answers with AI. Stop cobbling tools and use Archbee — the first complete documentation platform.
httpai - Memgraph - Query your data in Memgraph graph database.
databasehttpaigitgithub - mkinf - An Open Source registry of hosted MCP Servers to accelerate AI agent workflows.
httpai - Moorcheh - Embed, store, and search your documents, and build secure chatbots and RAG systems with Moorcheh's information-theoretic semantic search engine
httpaigitgithub - Needle - Production-ready RAG out of the box to search and retrieve data from your own documents.
httpaigitgithub - Neo4j - Neo4j graph database server (schema + read/write-cypher) and separate graph database backed memory
databasehttpgitgithub - Neo4j GDS - Neo4j graph data science server with comprehensive graph algorithms that enables complex graph reasoning and Q&A.
httpgitgithub - Nx - Makes Nx's understanding of your codebase accessible to LLMs, providing insights into the codebase architecture, project relationships and runnable tasks thus allowing AI to make precise code suggestions.
httpaillmgitgithub - OctoEverywhere - A 3D Printing MCP server that allows for querying for live state, webcam snapshots, and 3D printer control.
webhttpgitgithub - OpenMetadata - The first Enterprise-grade MCP server for metadata
http - Alibaba Cloud OpenSearch - This MCP server equips AI Agents with tools to interact with OpenSearch through a standardized and extensible interface.
httpaigitgithub - OpenSearch - MCP server that enables AI agents to perform search and analytics use cases on data stored in OpenSearch.
httpaigitgithubanalytics - OpenTools - An open registry for finding, installing, and building with MCP servers by opentoolsteam
httpgitgithub - Optuna - Official MCP server enabling seamless orchestration of hyperparameter search and other optimization tasks with Optuna.
httpmlgitgithub - Parallel Task MCP - Initiate Deep Research and Batch Tasks
webhttpaigitgithub - Arize Phoenix - Inspect traces, manage prompts, curate datasets, and run experiments using Arize Phoenix, an open-source AI and LLM observability tool.
httpaillmgitgithub - Pipedream 🏠 📇 - Connect with 2,500 APIs with 8,000+ prebuilt tools, and manage servers for your users, in your own app.
apihttpgitgithub - Composio - Use Composio to connect 100+ tools. Zero setup. Auth built-in. Made for agents, works for humans.
authhttp - Rube - Rube is a Model Context Protocol (MCP) server that connects your AI tools to 500+ apps like Gmail, Slack, GitHub, and Notion. Simply install it in your AI client, authenticate once with your apps, and start asking your AI to perform real actions like "Send an email" or "Create a task."
authhttpaigitgithub - kluster.ai - kluster.ai provides MCP servers that bring AI services directly into your development workflow, including guardrails like hallucination detection.
httpai - Polymarket - Real-time prediction market data from Polymarket - search markets, analyze prices, identify trading opportunities.
httpgitgithub - Powerdrill - An MCP server that provides tools to interact with Powerdrill datasets, enabling smart AI data analysis and insights.
webhttpaigitgithub - Probe.dev - Comprehensive media analysis and validation powered by Probe.dev. Hosted MCP server with FFprobe, MediaInfo, and Probe Report analysis capabilities.
httpai - Program Integrity Alliance (PIA) - Local and Hosted MCP servers providing AI-friendly access to U.S. Government Open Datasets. Also available on Docker MCP Catalog. See our website for more details.
weblocalhttpdockerai - ESP RainMaker - Official Espressif MCP Server to Control and Manage ESP RainMaker Devices.
httpaigitgithub - Cloudsway SmartSearch - Web search MCP server powered by Cloudsway, supporting keyword search, language, and safety options. Returns structured JSON results.
webhttpjsonaigit - Kiteworks - Official MCP server to interact with the Kiteworks Private Data Network (PDN) platform.
httpaigitgithub - Klavis AI - Open Source MCP Infra. Hosted MCP servers and MCP clients on Slack and Discord.
httpaigitgithubslack - Klavis ReportGen - Create professional reports from a simple user query.
httpaigitgithub - Strata - One MCP server that guides your AI agents through thousands of tools in multiple apps progressively. It eliminates context overload and ensures accurate tool selection, enabling agents to handle complex, multi-app workflows with ease.
httpaigitgithub - Vizro - Tools and templates to create validated and maintainable data charts and dashboards
httpaigitgithub - Nango - Integrate your AI agent with 500+ APIs: Auth, custom tools, and observability. Open-source.
apiauthhttpaigit - Oracle - Official Oracle Database: SQLcl MCP server enabling all access to any Oracle Database via native MCP support directly in SQLcl.
databasehttpaimlgit - SafeDep - SafeDep vet-mcp helps in vetting open source packages for security risks—such as vulnerabilities and malicious code—before they're used in your project, especially with AI-generated code suggestions.
httpaigitgithublocal - AtomGit - Official AtomGit server for integration with repository management, PRs, issues, branches, labels, and more.
httpgit - Audiense Insights - Marketing insights and audience analysis from Audiense reports, covering demographic, cultural, influencer, and content engagement analysis.
httpgitgithub - ScrAPI - Web scraping using ScrAPI. Extract website content that is difficult to access because of bot detection, captchas or even geolocation restrictions.
apiwebresthttpgit - ScreenshotOne - Render website screenshots with ScreenshotOne
webhttpgitgithub - Secureframe - Query security controls, monitor compliance tests, and access audit data across SOC 2, ISO 27001, CMMC, FedRAMP, and other frameworks from Secureframe.
httpgitgithub - SmartBear - Provides access to multiple capabilities across SmartBear's API Hub, Test Hub, and Insight Hub, all through dedicated tools and resources.
apihttpgitgithub - JFrog - Model Context Protocol (MCP) Server for the JFrog Platform API, enabling repository management, build tracking, release lifecycle management, and more.
apihttpgitgithub - Mapbox - Unlock geospatial intelligence through Mapbox APIs like geocoding, POI search, directions, isochrones and more.
apihttpgitgithub - Canva — Provide AI - powered development assistance for Canva apps and integrations.
httpai - HubSpot - Connect, manage, and interact with HubSpot CRM data
http - ONLYOFFICE DocSpace - Interact with ONLYOFFICE DocSpace API to create rooms, manage files and folders.
apifilehttpgitgithub - WhatsApp Business - WhatsApp Business MCP connector enabling AI agents to send messages, manage conversations, access templates, and integrate with WhatsApp Business API for automated customer communication.
apihttpai - Microsoft Teams - Official Microsoft Teams AI Library with MCP support enabling advanced agent orchestration, multi-agent collaboration, and seamless integration with Teams messaging and collaboration features.
httpaiml - Steuerboard - Interact with the accounting data in your business using our official MCP server
httpgitgithub - Plainly Videos - The official MCP server for Plainly Videos, allowing users to browse designs and projects, as well as render videos using various LLM clients.
apihttpaillmgit - Stripe - Interact with Stripe API
apihttpgitgithub - Sunra AI - Search for and run AI models on Sunra.ai. Discover models, create video, image, and 3D model content, track their status, and manage the generated media.
httpaigitgithub - Supabase - Interact with Supabase: Create tables, query data, deploy edge functions, and more.
httpgitgithubaidatabase - Supadata - Official MCP server for Supadata - YouTube, TikTok, X and Web data for makers.
webhttpaigitgithub - TextArtTools - Transform text with 23 Unicode styles and create stylized banners with 322+ figlet fonts.
httpgitgithub - Thirdweb - Read/write to over 2k blockchains, enabling data querying, contract analysis/deployment, and transaction execution, powered by Thirdweb
webhttpaigitgithub - Tianji - Interact with Tianji platform whatever selfhosted or cloud platform, powered by Tianji.
httpgitgithub - Uberall – Manage multi - location presence, including listings, reviews, and social posting, via uberall.
httpgitgithub - Rill Data - Interact with Rill Data to query and analyze your data.
http - ScreenshotMCP - A Model Context Protocol MCP server for capturing website screenshots with full page, element, and device size features.
webhttpgitgithub - Upstash - Manage Redis databases and run Redis commands on Upstash with natural language.
databasehttpredisgitgithub - Verodat - Interact with Verodat AI Ready Data platform
httpaigitgithub - SafeLine - SafeLine is a self-hosted WAF(Web Application Firewall) to protect your web apps from attacks and exploits.
webhttpaigitgithub - WaveSpeed - WaveSpeed MCP server providing AI agents with image and video generation capabilities.
webhttpaigitgithub - WayStation - Universal MCP server to connect to popular productivity tools such as Notion, Monday, AirTable, and many more
httpaigitgithubml - WebScraping.AI - Interact with WebScraping.AI for web data extraction and scraping
apiwebhttpaigit - Winston AI - AI detector MCP server with industry leading accuracy rates in detecting use of AI in text and images. The Winston AI MCP server also offers a robust plagiarism checker to help maintain integrity.
httpawsaigitgithub - MCP for WooCommerce - Connect your WooCommerce store to AI assistants with read-only access to products, categories, reviews, and WordPress content. WordPress plugin
httpaigitgithub - WooCommerce.com - Manaage your WooCommerce.com store, products, and orders with our MCP integration.
http - 2slides - An MCP server that provides tools to convert content into slides/PPT/presentation or generate slides/PPT/presentation with user intention.
httpgitgithub - Alation - Unlock the power of the enterprise Data Catalog by harnessing tools provided by the Alation MCP server.
httpaigitgithub - AlipayPlus - Connect your AI Agents to AlipayPlus Checkout Payment.
httpaigitgithub - AlphaVantage - Connect to 100+ APIs for financial market data, including stock prices, fundamentals, and more from AlphaVantage
apihttp - Antom - Connect your AI Agents to Antom Checkout Payment.
httpaigitgithub - Atlassian - Securely interact with Jira work items and Confluence pages, and search across both.
remotehttp - Bitnovo Pay - Cryptocurrency payment integration enabling AI agents to create payments, manage QR codes, and process transactions through the Bitnovo Pay API with support for Bitcoin, Ethereum, and other cryptocurrencies.
apihttpaigitgithub - Cashfree - Cashfree Payments official MCP server.
httpgitgithub - CloudBees - Enable AI access to your CloudBees Unify environment.
httpai - Cloudbet - Structured sports and esports data via Cloudbet API: fixtures, live odds, stake limits, and markets.
apihttpgitgithub - CoinGecko - Official CoinGecko API MCP Server for Crypto Price & Market Data, across 200+ Blockchain Networks and 8M+ Tokens.
apihttpaigitgithub - Commerce Layer - Interact with Commerce Layer Metrics API.
apihttpgitgithubmetrics - Convex - Introspect and query your apps deployed to Convex.
http - Cortex - Official MCP server for Cortex.
httpgitgithub - Courier - Build, update, and send multi-channel notifications across email, sms, push, Slack, and Microsoft Teams.
httpaigitgithubslack - CrowdStrike Falcon - Connects AI agents with the CrowdStrike Falcon platform for intelligent security analysis, providing programmatic access to detections, incidents, behaviors, threat intelligence, hosts, vulnerabilities, and identity protection capabilities.
httpaigitgithub - Daytona - Fast and secure execution of your AI generated code with Daytona sandboxes
httpaigitgithub - DeepL - Translate or rewrite text with DeepL's very own AI models using the DeepL API
apihttpaigitgithub - Edgee - Deploy and manage Edgee components and projects
httpgitgithub - Elasticsearch Memory - Persistent memory with hierarchical categorization, semantic search, and intelligent auto-detection. Install via PyPI.
httpgitgithub - Explorium - B2B data and infrastructure for AI SDR & GTM Agents Explorium
httpaigitgithub - PDFActionInspector - A Model Context Protocol server for extracting and analyzing JavaScript Actions from PDF files. Provides comprehensive security analysis to detect malicious PDF behaviors, hidden scripts, and potential security threats through AI-assisted risk assessment.
filehttpaigitgithub - Inbox Zero - AI personal assistant for email Inbox Zero
httpaigitgithubemail - GitKraken - A CLI for interacting with GitKraken APIs. Includes an MCP server via gk mcp that not only wraps GitKraken APIs, but also Jira, GitHub, GitLab, and more.
apifilehttpgitgithub - Chrome DevTools - Enable AI coding assistants to debug web pages directly in Chrome, providing runtime insights and debugging capabilities.
webhttpaigitgithub - Google Cloud Run - Deploy code to Google Cloud Run
httpgitgithub - Firebase - Firebase's experimental MCP Server to power your AI Tools
httpaigitgithub - Hiveflow - Create, manage, and execute agentic AI workflows directly from your assistant.
httpaigitgithub - Inflectra Spira - Connect to your instance of the SpiraTest, SpiraTeam or SpiraPlan application lifecycle management platform by Inflectra
httpgitgithub - Klaviyo - Interact with your Klaviyo marketing data.
http - KurrentDB - This is a simple MCP server to help you explore data and prototype projections faster on top of KurrentDB.
httpgitgithub - LaunchDarkly - LaunchDarkly is a continuous delivery platform that provides feature flags as a service and allows developers to iterate quickly and safely.
httpgitgithub - ThinQ Connect - Interact with LG ThinQ smart home devices and appliances through the ThinQ Connect MCP server.
httpgitgithub - Mailjet - Official MCP server which allows AI agents to interact with contact, campaign, segmentation, statistics, workflow (and more) APIs from Sinch Mailjet.
apihttpaigitgithub - MariaDB - A standard interface for managing and querying MariaDB databases, supporting both standard SQL operations and advanced vector/embedding-based search.
databasehttpgitgithub - Mercado Libre - Mercado Libre's official MCP server.
http - Mercado Pago - Mercado Pago's official MCP server.
http - Multiplayer - Analyze your full stack session recordings easily. Record a bug with Multiplayer, analyze and fix it with LLM
httpaillm - Netdata - Discovery, exploration, reporting and root cause analysis using all observability data, including metrics, logs, systems, containers, processes, and network connections
webhttpaigitgithub - Netlify - Create, build, deploy, and manage your websites with Netlify web platform.
webhttpai - Nutrient - Create, Edit, Sign, Extract Documents using Natural Language
httpgitgithub - Openfort - Connect your AI to Openfort's smart wallet, auth, and project infrastructure.
authhttpaigitgithub - PayPal - PayPal's official MCP server.
webhttp - PGA (Golf) - PGA's official MCP Server for all things golf-related. Find a coach, play golf, improve your game, and more.
http - TiDB - MCP Server to interact with TiDB database platform.
databasehttpgitgithub - PinMeTo - MCP server that enables users with authorized credentials to unlock their location data.
authhttpgitgithub - Plugged.in - A comprehensive proxy that combines multiple MCP servers into a single MCP. It provides discovery and management of tools, prompts, resources, and templates across servers, plus a playground for debugging when building MCP servers.
httpgitgithub - Prisma - Create and manage Prisma Postgres databases
databasehttppostgres - Red Hat Insights - Interact with Red Hat Insights - build images, manage vulnerabilities, or view targeted recommendations.
httpgitgithub - Reltio - A lightweight, plugin-based MCP server designed to perform advanced entity matching with language models in Reltio environments.
httpaigitgithub - SearchUnify - SearchUnify MCP Server (su-mcp) enables seamless integration of SearchUnify with Claude Desktop
httpmlgitgithub - SonarQube - Enables seamless integration with SonarQube Server or Cloud and allows for code snippet analysis within the agent context.
httpmlgitgithub - StackHawk - Use StackHawk to test for and FIX security problems in your code or vibe coded app.
httpgitgithub - ThoughtSpot - AI is the new BI. A dedicated data analyst for everyone on your team. Bring ThoughtSpot powers into Claude or any MCP host.
httpaigitgithub - Todoist - Search, add, and update Todoist tasks, projects, sections, comments, and more.
httpaigitgithub - Twilio - Interact with Twilio APIs to send SMS messages, manage phone numbers, configure your account, and more.
apihttpgitgithub - Zenable - Clean up sloppy AI code and prevent vulnerabilities
httpai - Zine - Your memory, everywhere AI goes. Think iPhoto for your knowledge - upload and curate. Like ChatGPT but portable - context that travels with you.
httpai - ZIZAI Recruitment - Interact with the next-generation intelligent recruitment platform for employees and employers, powered by ZIZAI Recruitment.
httpaigitgithub - Twelve Data - Integrate your AI agents with real-time and historical financial market data through our official Twelve Data MCP server.
httpaigitgithubapi - Cloudera Iceberg - enabling AI on the Open Data Lakehouse.
httpaimlgitgithub - Shell 🏠 📇 - Autonomous shell execution and computer control (Mac)
apihttpgitgithub - Qorus - Connect to any application, system, or technology and automate your business processes without coding and with AI
apihttpaiml - Cal.com - Connect to the Cal.com API to schedule and manage bookings and appointments.
apihttp - Lippia - MCP Server to accelerate Test Automation using Lippia Framework.
httpaigitgithub - Qonto - Access and interact your Qonto account through LLMs using MCP.
httpllmgitgithub - Lambda Capture - Macroeconomic Forecasts & Semantic Context from Federal Reserve, Bank of England, ECB.
httpgitgithub - Coreflux MQTT 🏠 - MCP server for the Coreflux MQTT broker, enabling AI agents to transfom the broker into a automation hub and interact with IoT devices and messaging systems through the MQTT protocol.
httpaigitgithub - Mobb - The Mobb Vibe Shield MCP server identifies and remediates vulnerabilities in both human and AI-written code, ensuring your applications remain secure without slowing development.
filehttpaigitgithub - Campertunity 🏠 - Search campgrounds around the world on campertunity, check availability, and provide booking links
httpaigitgithub - PandaDoc - Configure AI development tools to connect to PandaDoc's Model Context Protocol server and leverage AI-powered PandaDoc integrations.
webhttpai - Cloudinary - Exposes Cloudinary's media upload, transformation, AI analysis, management, optimization and delivery as tools usable by AI agents
webfilehttpaigit - Agent Mindshare - Track and monitor AI agent mindshare across platforms - measure brand visibility in AI conversations.
httpaianalytics - OpenNutrition 🏠 - Search 300,000+ foods, nutrition facts, and barcodes from the OpenNutrition database
databasehttpgitgithublocal - Apple Notes 🏠 - Read from local Apple Notes database (macOS only)
databaselocalhttpgitgithub - Git 🏠 - Direct Git repository operations including reading, searching, and analyzing local repositories
localhttpaigitgithub - unified-diff-mcp 🏠 - Generate visual diff comparisons from text changes with HTML/PNG export. Perfect for code reviews and document analysis with side-by-side visualization.
httpmlgitgithubfile - GitHub2 🏠 📇 - Token-based GitHub automation management. No Docker for optimal performance, Flexible configuration for fine-grained control, 80+ tools with direct API integration.
apihttpdockeraigit - GitLab 🏠 - GitLab platform integration for project management and CI/CD operations
httpaigitgithubgitlab - Google Drive 🏠 - Google Drive integration for file access, search, and management
filehttpaigitgithub - Google Maps 🏠 - Google Maps integration for location services, routing, and place details
httpaigitgithub - tom28881/mcp-jira-server 🏠 - Comprehensive TypeScript MCP server for Jira with 20+ tools covering complete project management workflow: issue CRUD, sprint management, comments/history, attachments, batch operations. Features universal field auto-detection, full Czech/localization support, and date parsing with multiple formats. Created by Tomáš Gregorovič.
localhttpgitgithub - Kubernetes2 🏠 - Kubernetes multi-cluster management and operations, featuring a management ui, logging, and nearly 50 built-in tools covering common DevOps and development scenarios. Supports both standard and CRD resources.
httpkubernetesgitgithublogging - MKP3 🏠 📇 - Model Kontext Protocol Server for Kubernetes with native Go implementation, direct API integration, and comprehensive resource management
apihttpkubernetesgitgithub - Phabricator 🏠 📇 - Phabricator API integration for repository and project management
apihttpgitgithub - Stripe⭐ 🏠 📇 - Allows you to integrate with Stripe APIs
apihttpaigitgithub - Unity Engine3 🏠 - Advanced Unity MCP from Code Maestro. Build, debug, profile, and manage assets, scenes, and scripts with natural language via MCP.
filehttpaigitgithub - CAKM 🏠 - MCP server for Thales CDSP CAKM integration, enabling secure key management, cryptographic operations, and compliance monitoring through AI assistants for Ms SQL and Oracle Databases.
databasehttpaigitgithub - CDSP 🏠 - MCP server for Thales CipherTrust Manager integration, enabling secure key management, cryptographic operations, and compliance monitoring through AI assistants.
httpaigitgithubmonitoring - CRDP 🏠 - MCP server for Thales CipherTrust Manager RestFul Data Protection service.
resthttpgitgithub - CSM 🏠 - MCP server for Thales CipherTrust Secrets Management
httpgitgithub - Congress 🏠 - Query and reeason about legislative data from Congress.gov
httpaigitgithub - Contrast Security - Brings Contrast's vulnerability and SCA data into your coding agent to quickly remediate vulnerabilities.
httpgitgithub - DefangLabs/defang 🏠 - CLI and MCP server for building and deploying Docker Compose-compatible projects to your own AWS, GCP, or DigitalOcean account.
httpawsgcpdockergit - DexPaprika⭐ 🏠 📇 - Comprehensive cryptocurrency and DEX data API across multiple blockchains, providing real-time token pricing, liquidity pools, and OHLCV data for market analysis
apihttpaigitgithub - ECharts 🏠 - Generate visual charts using Apache ECharts with AI MCP dynamically.
httpaigitgithub - VideoDB⭐ 🏠 📇 - A serverless video database to easily store, index, search, and stream videos. VideoDB uses AI to automatically tag scenes, generate accurate transcriptions, and quickly retrieve video moments with simple queries.
databasehttpaigitgithub - Bucket 🏠 - Flag features, manage company data, and control feature access using Bucket
httpaigitgithub - GitKraken⭐ 🏠 ☁️ 📇 - A CLI for interacting with GitKraken APIs. Includes an MCP server via gk mcp that not only wraps GitKraken APIs, but also Jira, GitHub, GitLab, and more. Works with local tools and remote services.
apiremotelocalhttpgit - Lisply - Flexible frontend for compliant Lisp-speaking backends.
httpgitgithub - Rodin - Generate 3D Models with Hyper3D Rodin
apihttpaigitgithub - Google Ads 🏠 - MCP server acting as an interface to the Google Ads, enabling programmatic access to Google Ads data and management features.
httpaigitgithub - aymericzip/intlayer - A MCP Server that enhance your IDE with AI-powered assistance for Intlayer i18n / CMS tool: smart CLI access, docs.
httpaigitgithub - Mastra/mcp⭐ 🏠 - Provides AI assistants with direct access to Mastra.ai's complete knowledge base.
httpaigitgithubml - Maven Tools MCP 🏠 - Maven Central dependency intelligence for JVM build tools (Maven, Gradle, SBT, Mill) with Context7 integration for documentation support.
httpgitgithub - Open Strategy Partners Marketing Tools⭐ 🏠 - a standardized editing code system, writing guidelines, web metadata generator, and product communication framework.
webfilehttpgitgithub - OSV 🏠 - Access the OSV (Open Source Vulnerabilities) database for vulnerability information. Query vulnerabilities by package version or commit, batch query multiple packages, and get detailed vulnerability information by ID.
databasehttpaigitgithub - Slite 🏠 - Model Context Protocol server for Slite integration. Search and retrieve notes, browse note hierarchies, and access content from your Slite workspace.
httpgitgithub - Probe.dev - Professional media analysis and validation MCP server with FFprobe, MediaInfo, and comprehensive reporting capabilities
httpai - LongPort OpenAPI⭐ 🏠 📇 - Provides real-time stock market data, provides AI access analysis and trading capabilities through MCP.
apifilehttpaigit - ShopSavvy⭐ 🏠 - Complete product and pricing data solution for AI assistants. Search for products by barcode/ASIN/URL, access detailed product metadata, access comprehensive pricing data from thousands of retailers, view and track price history, and more. Published as @shopsavvy/mcp-server.
httpaigitgithub - Smooth Operator - Tools to automate Windows via AI Vision, Mouse, Keyboard, Automation Trees, Webbrowser
apiwebhttpai - Sophtron - Connect to your bank, credit card, utilities accounts to retrieve account balances and transactions with Sophtron Bank Integration.
httpaigitgithub - IPLocate 🏠 - Look up IP address geolocation, network information, detect proxies and VPNs, and find abuse contact details using IPLocate.io
httpaigitgithub - Tinybird⭐ 🏠 - Interact with a Tinybird Workspace from any MCP client.
httpgitgithub - Windows Control 🏠 - Windows automation MCP server providing mouse, keyboard, screen capture, clipboard, and window management capabilities using NutJS.
httpgitgithub - Vulert - Vulert secures software by detecting vulnerabilities in open-source dependencies—without accessing your code. It supports Js, PHP, Java, Python, and more
http - Box⭐ - Box MCP Server allows third party AI agents from platforms like Copilot Studio, Cursor, Claude for Desktop to access Box content seamlessly. It extends the agent's capabilities by allowing it to perform actions related to content stored in Box.
httpaiml - Chargebee⭐ 🏠 - MCP Server that connects AI agents to Chargebee platform.
httpaigitgithub - LambdaTest - LambdaTest MCP Servers ranging from Accessibility, SmartUI, Automation, and HyperExecute allows you to connect AI assistants with your testing workflow, streamlining setup, analyzing failures, and generating fixes to speed up testing and improve efficiency.
httpaiml - Mercado Libre - Mercado Libre's official MCP server, offering tools to interact with our marketplace, simplifying tasks and product integration.
http - Mercado Pago - Mercado Pago's official MCP server, offering tools to interact with our API, simplifing tasks and product integration.
apihttp - mimilabs - A US healthcare data discovery guide for 50+ gov sources and thousands of publicly available US healthcare datasets regarding gov-funded programs, policies, drug pricings, clinical trials, etc.
httpai - PayPal⭐ 🏠 📇 - The PayPal Agent Toolkit enables popular agent frameworks including Model Context Protocol (MCP) to integrate with PayPal APIs through function calling.
apiwebhttpaigit - CentralMind/Gateway 🏠 📇 - MCP and MCP SSE Server that automatically generate production ready API based on database schema and data. Supports PostgreSQL, Clickhouse, MySQL, Snowflake, BigQuery, Supabase
apidatabasehttpmysqlpostgres - ZBD⭐ 🏠 📇 - Interact with ZBD's payment processing APIs for instant global payments with Bitcoin and Lightning Network
apihttpaigitgithub - 📅 Kalendis - Generate TypeScript clients and API route handlers for the Kalendis scheduling API across multiple frameworks (Next.js, Express, Fastify, NestJS), streamlining integration of availability management and booking functionality.
apihttpaimlgit - 1282saa/newsse 🏠 - Facilitates AI model access to Seoul Economic Daily's stylebook data with advanced search and authentication features.
authhttpaigitgithub - 1mcpserver - MCP of MCPs. Automatically discover, configure, and add MCP servers on your local machine.
localhttpgitgithubremote - 2560_mcp 🏠 - A repository for 2560_mcp. Includes instructions in README for enabling GitHub MCP server in VS Code.
mcpservergit clone https://github.com/t1ina2003/2560_mcp - 2niuhe/plantumlweb 🐍 🏠 ☁️ 🍎 🪟 🐧 🏠 - A web-based PlantUML frontend with MCP server integration, enable plantuml image generation and plantuml syntax validation.
webhttpmlgitgithub - 2niuhe/qrcodemcp 🐍 🏠 🍎 🪟 🐧 🏠 - A QR code generation MCP server that converts any text (including Chinese characters) to QR codes with customizable colors and base64 encoding output.
httpgitgithub - 302ai/302websearchmcp 🏠 - Facilitates web search integration with Claude Desktop through a configurable MCP server.
webhttpaigitgithub - A2A - An MCP server that bridges the Model Context Protocol (MCP) with the Agent-to-Agent (A2A) protocol, enabling MCP-compatible AI assistants (like Claude) to seamlessly interact with A2A agents.
httpaimlgitgithub - A2A-MCP Java Bridge - A2AJava brings powerful A2A-MCP integration directly into your Java applications. It enables developers to annotate standard Java methods and instantly expose them as MCP Server, A2A-discoverable actions — with no boilerplate or service registration overhead.
httpgitgithub - Aas-ee/open-webSearch 🐍 📇 ☁️ 🏠 📇 - Web search using free multi-engine search (NO API KEYS REQUIRED) — Supports Bing, Baidu, DuckDuckGo, Brave, Exa, and CSDN.
apiwebhttpaigit - aashari/mcp-server-aws-sso 📇 ☁️ 🏠 🏠 - AWS Single Sign-On (SSO) integration enabling AI systems to securely interact with AWS resources by initiating SSO login, listing accounts/roles, and executing AWS CLI commands using temporary credentials.
httpawsaigitgithub - Ableton Live (by ahujasid) - Ableton integration allowing prompt enabled music creation.
httpgitgithub - abrinsmead/mindpilot-mcp 📇 🏠 🏠 - Visualizes code, architecture and other concepts as mermaid diagrams in a locally hosted web app. Just ask your agent to "show me this in a diagram".
weblocalhttpaigit - ACNet-AI/OmniTaskAgent 🏠 - OmniTaskAgent is a versatile multi-model task management system that integrates with various task management solutions and editors via the MCP protocol, enhancing intelligent workflow processes.
httpaigitgithub - ActivityPub MCP - A comprehensive MCP server that enables LLMs to explore and interact with the Fediverse through ActivityPub protocol, supporting actor discovery, timeline fetching, instance exploration, and WebFinger resolution across decentralized social networks.
webhttpllmgitgithub - Actor Critic Thinking - Actor-critic thinking for performance evaluation
httpgitgithub - adawalli/nexus 📇 ☁️ 🏠 📇 - AI-powered web search server using Perplexity Sonar models with source citations. Zero-install setup via NPX.
webhttpaigitgithub - Adobe Commerce - MCP to interact with Adobe Commerce GraphQL API, including orders, products, customers, etc.
apigraphqlhttpgitgithub - ADR Analysis - AI-powered Architectural Decision Records (ADR) analysis server that provides architectural insights, technology stack detection, security checks, and TDD workflow enhancement for software development projects.
httpaigitgithub - Agent Mindshare - Track and monitor AI agent mindshare across platforms - measure brand visibility in AI conversations with Agent Mindshare.
httpai - Agentic Framework - Multi-agent collaboration framework enabling AI agents to register, discover each other, exchange asynchronous messages via HTTP transport, and work together on complex tasks with persistent message history.
httpaigitgithub - AgentMode - Connect to dozens of databases, data warehouses, Github & more, from a single MCP server. Run the Docker image locally, in the cloud, or on-premise.
databaselocalhttpdockergit - AgentQL MCP Server - Model Context Protocol server that integrates AgentQL's data extraction capabilities.
agentqldata-extraction - AgentR Universal MCP SDK - A python SDK to build MCP Servers with inbuilt credential management by Agentr
httpgitgithub - AgentRPC - Connect to any function, any language, across network boundaries using AgentRPC
httpgitgithubrpcnetworking - AI Agent Marketplace Index - MCP server to search more than 5000+ AI agents and tools of various categories from AI Agent Marketplace Index and monitor traffic of AI Agents.
httpaigitgithub - AI Tasks - Let the AI manage complex plans with integrated task management and tracking tools. Supports STDIO, SSE and Streamable HTTP transports.
httpaigitgithub - ai-Bible - Search the bible reliably and repeatably ai-Bible Labs
httpaigitgithub - AI-Strategy-Enablement/mcp-economic 🏠 📇 - Facilitates seamless interaction with e-conomic's API for comprehensive financial management through standardized MCP commands.
apihttpaimlgit - AIDC-AI/Pixelle-MCP 🏠 - An omnimodal AIGC framework that seamlessly converts ComfyUI workflows into MCP tools with zero code, enabling full-modal support for Text, Image, Sound, and Video generation with Chainlit-based web interface.
webhttpaimlgit - aikts/yandex-tracker-mcp 🐍 ☁️ 🏠 🏠 - MCP Server for Yandex Tracker. Provides tools for searching and retrieving information about issues, queues, users.
httpaigitgithub - AIM-Intelligence/AIM-Guard-MCP 📇 🏠 🍎 🪟 🐧 🏠 - Security-focused MCP server that provides safety guidelines and content analysis for AI agents.
httpaigitgithub - AiMCP - A collection of MCP clients&servers to find the right mcp tools by Hekmon
httpaigitgithub - aircodelabs/grasp 📇 🏠 🏠 - Self-hosted browser using agent with built-in MCP and A2A support.
httpaigitgithub - airtable-mcp 🐍 🏠 - Python-based
databasehttpaigitgithubpip install git+https://github.com/alexbruf/airtable-mcp - akramIOT/MCPAISOCSher 🐍 ☁️ 📇 🏠 - MCP Server to do dynamic AI SOC Security Threat analysis for a Text2SQL AI Agent.
httpaigitgithub - alaria-wiki-mcp 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install CaptainCrouton89/alaria-wiki-mcp - Alby Bitcoin Payments MCP 🏠 - Connect any bitcoin lightning wallet to agents to send and receive payments instantly at low cost.
httpgitgithub - alchemy/alchemy-mcp-server 🎖️ 📇 ☁️ 🏠 📇 - Allow AI agents to interact with Alchemy's blockchain APIs.
apihttpaigitgithub - Alertmanager 🏠 - A Model Context Protocol (MCP) server that enables AI assistants to integrate with Prometheus Alertmanager
httpaigitgithub - alesr/gh-self-reviewer 🐹 🏠 - A Go-based Anthropic MCP server facilitating self-review of GitHub pull requests with Claude AI integration.
httpaianthropicgitgithub - Algolia - Use AI agents to provision, configure, and query your Algolia search indices.
httpaigitgithub - allenporter/mcp-server-home-assistant 🐍 🏠 🏠 - Expose all Home Assistant voice intents through a Model Context Protocol Server allowing home control.
httpgitgithub - AllVoiceLab - An AI voice toolkit with TTS, voice cloning, and video translation, now available as an MCP server for smarter agent integration.
httpai - Allyson 🏠 - AI-powered SVG animation generator that transforms static files into animated SVG components using the Allyson platform
filehttpaigitgithub - altinoren/utopia #️⃣ 🏠 🏠 - MCP that simulates a set of smart home and lifestyle devices, allowing you to test agent's reasoning and discovery capabilities.
httpgitgithub - Amap Maps - 高德地图官方 MCP Server
amapmapslocation - Amazon Ads - MCP Server that provides interaction capabilities with Amazon Advertising through MarketplaceAdPros/
httpgitgithubaimetrics - ananddtyagi/gif-creator-mcp 📇 🏠 🏠 - A MCP server for creating GIFs from your videos.
httpaigitgithub - ananddtyagi/webpage-screenshot-mcp 📇 🏠 🏠 - A MCP server for taking screenshots of webpages to use as feedback during UI developement.
webhttpgitgithub - andrzejsliwa/6510emuinc 🏠 - A modern C implementation of a 6510/6502 CPU emulator with disassembly support, used in the Commodore 64.
httpgitgithub - angrysky56/NeoCoder-neo4j-ai-workflow 🏠 - Enables AI assistants to utilize a Neo4j knowledge graph for dynamic coding workflows and project memory management.
httpaigitgithub - Anki - MCP server to run locally with Anki and Ankiconnect. Supports creating, updating, searching and filtering cards and decks. Include mass update and other advanced tools.
localhttpgitgithub - AnkiConnect 🏠 - AnkiConnect MCP server for interacting with Anki via AnkiConnect.
httpgitgithub - ankit1057/nexuscontroller 🐍 🏠 - NexusController offers advanced Android automation with MCP support for seamless AI integration, enabling robust device control and UI testing.
httpaimlgitgithub - ankitmalik84/notion-mcp-server 🐍 ☁️ 🏠 - A comprehensive Model Context Protocol (MCP) server for Notion integration with enhanced functionality, robust error handling, production-ready feature.
httpaigitgithub - ankushdeore/citystack-agent-kumbh-nashik 🏠 - CityStack Agent provides real-time civic service location data for large events, starting with the Kumbh Mela 2027 in Nashik, using the Model Context Protocol.
httpgitgithub - Anubis MCP (Elixir) - A high-performance and high-level Model Context Protocol (MCP) implementation in Elixir. Think like "Live View" for MCP.
httpgitgithub - AnyCrawl 🏠 📇 - AnyCrawl MCP Server, Powerful web scraping and crawling for Cursor, Claude, and other LLM clients via the Model Context Protocol (MCP).
apiwebhttpaillm - Apache Gravitino(incubating) - Allow LLMs to explore metadata of structured data and unstructured data with Gravitino, and perform data governance tasks including tagging/classification.
httpllmgitgithub - Apache Pinot – MCP server for running real - time analytics queries on Apache Pinot, an open-source OLAP database built for high-throughput, low-latency powering real-time applications.
databasehttpgitgithubanalytics - apecloud/ApeRAG 🐍 ☁️ 🏠 🏠 - Production-ready RAG platform combining Graph RAG, vector search, and full-text search. Best choice for building your own Knowledge Graph and for Context Engineering
httpgitgithub - API Lab MCP - Transform Claude into your AI-powered API testing laboratory. Test, debug, and document APIs through natural conversation with authentication support, response validation, and performance metrics.
apiauthhttpaigit - APIWeaver - An MCP server that dynamically creates MCP servers from web API configurations. This allows you to easily integrate any REST API, GraphQL endpoint, or web service into an MCP-compatible tool that can be used by AI assistants like Claude.
apiwebrestgraphqlhttp - Apollo IO MCP Server - apollo.io mcp server. Get/enrich contact data for people and organizations agentically.
httpaigitgithub - Apple Docs - A powerful Model Context Protocol (MCP) server that provides seamless access to Apple Developer Documentation through natural language queries. Search, explore, and get detailed information about Apple frameworks, APIs, sample code, and more directly in your AI-powered development environment.
apihttpaimlgit - Apple Script - MCP server that lets LLM run AppleScript code to to fully control anything on Mac, no setup needed.
httpllmgitgithub - APT MCP - MCP server which runs debian package manager (apt) commands for you using ai agents.
httpaigitgithub - araa47/jupiter-mcp 🐍 ☁️ 🏠 📇 - Jupiter API Access (allow AI to Trade Tokens on Solana + Access Balances + Search Tokens + Create Limit Orders )
apihttpaigitgithub - aradtamako/DnfApiServer 📘 🏠 📇 - Facilitates interaction with DNF APIs through an MCP server setup, enabling seamless integration with tools like Copilot and Claude.
apihttpmlgitgithub - Aranet4 - MCP Server to manage your Aranet4 CO2 sensor. Fetch data and store in a local SQLite. Ask questions about historical data.
localhttpsqlitegitgithub - ArangoDB Graph - Async-first Python architecture, wrapping the official python-arango driver with graph management capabilities, content conversion utilities (JSON, Markdown, YAML and Table), backup/restore functionality, and graph analytics capabilities; the 33 MCP tools use strict Pydantic validation.
resthttpjsonmlgit - Arc-Computer/arc-mcp-server 🏠 - Arc Memory MCP Server bridges Arc Memory TKG with MCP clients, enabling AI-assisted development through structured, temporal knowledge graph access.
httpaigitgithub - archethic-uco-mcp 📜 🏠 📇 - Node.js-based
apigraphqlhttpaigitnpm install redDwarf03/archethic-uco-mcp - Arduino - MCP Server that enables AI-powered robotics using Claude AI and Arduino (ESP32) for real-world automation and interaction with robots.
httpaigitgithub - arman_mcp_server_rep 🏠 - Repository for MCP server
mcpservergit clone https://github.com/Arman-ali-khan-786/arman_mcp_server_rep - artmann/package-registry-mcp 🏠 📇 🍎 🪟 🐧 🏠 - MCP server for searching and getting up-to-date information about NPM, Cargo, PyPi, and NuGet packages.
httpgitgithub - arxiv_mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/hiyenwong/arxiv_mcp - arxiv-mcp-server 🏠 - Basic arXiv MCP server
mcpservergit clone https://github.com/tleguen833/arxiv-mcp-server - ArxivMCP 🐍 🏠 - Python-based
httpmlgitgithubpythonpip install git+https://github.com/liuyixin-louis/ArxivMCP - atompsv/my-red-envelope 📘 🏠 - Facilitates querying MON token balances on the Monad testnet via an MCP server.
httpgitgithub - Attestable MCP - An MCP server running inside a trusted execution environment (TEE) via Gramine, showcasing remote attestation using RA-TLS. This allows an MCP client to verify the server before connecting.
remotehttpmlgitgithub - Audioscrape - Search 1M+ hours of podcasts, interviews, talks and your private audio uploads with speaker identification and timestamps. Official Remote MCP server (via https://mcp.audioscrape.com) enabling AI assistants to access and analyze audio content through semantic and text-based search.
remotehttpai - Augments - Comprehensive framework documentation and code examples for popular development tools and libraries.
http - augmnt/augments-mcp-server 📇 ☁️ 🏠 🏠 📇 - Transform Claude Code with intelligent, real-time access to 90+ framework documentation sources. Get accurate, up-to-date code generation that follows current best practices for React, Next.js, Laravel, FastAPI, Tailwind CSS, and more.
apihttpaigitgithub - AutoGen documentation 🏠 - A Model Context Protocol (MCP) server that provides AI assistants with the ability to search and retrieve Microsoft AutoGen documentation.
httpaigitgithub - AutoML - An MCP server for data analysis workflows including reading, preprocessing, feature engineering, model selection, visualization, and hyperparameter tuning.
httpmlgitgithub - avisangle/calculator-server 🏎️ 🏠 🏠 - A comprehensive Go-based MCP server for mathematical computations, implementing 13 mathematical tools across basic arithmetic, advanced functions, statistical analysis, unit conversions, and financial calculations.
httpgitgithub - awesome 🏠 - Awesome lists about all kinds of interesting topics.
resthttpgitgithub - Awesome Remote MCP Servers by JAW9C - A curated list of remote MCP servers, including their authentication support by JAW9C
remoteauthhttpgitgithub - awesome-mcp-clients 🏠 - A list of MCP clients.
httpgitgithub - awesome-remote-mcp-servers 🏠 - awesome remote mcp servers
mcpservergit clone https://github.com/weekend-project-space/awesome-remote-mcp-servers - AWS Bedrock KB Retrieval 🏠 - Query Amazon Bedrock Knowledge Bases using natural language to retrieve relevant information from your data sources.
httpawsaigitgithub - AWS CDK 🏠 - Get prescriptive CDK advice, explain CDK Nag rules, check suppressions, generate Bedrock Agent schemas, and discover AWS Solutions Constructs patterns.
httpawsaigitgithub - AWS Cognito - An MCP server that connects to AWS Cognito for authentication and user management.
authhttpawsgitgithub - AWS Core 🏠 - Core AWS MCP server providing prompt understanding and server management capabilities.
httpawsaigitgithub - AWS Cost Analysis 🏠 📇 - Analyze CDK projects to identify AWS services used and get pricing information from AWS pricing webpages and API.
apiwebhttpawsai - AWS Documentation 🏠 - Fetch, convert, and search AWS documentation pages, with recommendations for related content.
httpawsaigitgithub - AWS KB Retrieval - Retrieval from AWS Knowledge Base using Bedrock Agent Runtime.
httpawsaigitgithub - AWS Nova Canvas 🏠 - Generate images using Amazon Nova Canvas with text prompts and color guidance.
httpawsaigitgithub - AWS Open Data - Search and explore datasets from the AWS Open Data Registry with fuzzy matching and detailed dataset information.
httpawsaigitgithub - AWS SES Sample MCP Server for Amazon SES (SESv2). See AWS blog post for more details.
httpawsaigitgithub - aws-postgress-mcp-server 📜 🏠 - Node.js-based
databasehttppostgresawsgitnpm install T1nker-1220/aws-postgress-mcp-server - AX-Platform - AI Agent collaboration platform. Collaborate on tasks, share context, and coordinate workflows.
filehttpaigitgithub - axliupore/mcp-code-runner 📇 🏠 🏠 - An MCP server for running code locally via Docker and supporting multiple programming languages.
localhttpdockergitgithub - aymericzip/intlayer 📇 ☁️ 🏠 🏠 - A MCP Server that enhance your IDE with AI-powered assistance for Intlayer i18n / CMS tool: smart CLI access, access to the docs.
httpaigitgithub - azer/react-analyzer-mcp 📇 🏠 🏠 - Analyze React code locally, generate docs / llm.txt for whole project at once
localhttpllmgitgithub - Azure OpenAI DALL-E 3 MCP Server - An MCP server for Azure OpenAI DALL-E 3 service to generate image from text.
httpazureaiopenaigit - Azure Wiki Search - An MCP that enables AI to query the wiki hosted on Azure Devops Wiki.
httpazureaigitgithub - Azure/azure-mcp 🏠 - Official Microsoft MCP server for Azure services including Storage, Cosmos DB, and Azure Monitor.
httpazuregitgithub - Baidu AI Search - Web search with Baidu Cloud's AI Search
webhttpaigitgithub - Baidu Map - 百度地图核心API现已全面兼容MCP协议,是国内首家兼容MCP协议的地图服务商。
baidumapslocation - bankless/onchain-mcp 📇 ☁️ 🏠 📇 - Bankless Onchain API to interact with smart contracts, query transaction and token information
apihttpaigitgithub - bart6114/my-bear-mcp-server 📇 🏠 🍎 🏠 - Allows to read notes and tags for the Bear Note taking app, through a direct integration with Bear's sqlitedb.
httpsqlitegitgithub - Baserow - Read and write access to your Baserow tables.
http - Basic Memory - Local-first knowledge management system that builds a semantic graph from Markdown files, enabling persistent memory across conversations with LLMs.
filelocalhttpllmgit - beauty1-mcp 🏠 - MCP server configuration for beauty1 project
mcpservergit clone https://github.com/Spa42/beauty1-mcp - beswindev/simpleshopify 🏠 📇 - Facilitates seamless interaction with Shopify store data via GraphQL API, offering comprehensive management of products, customers, and orders.
apigraphqlhttpmlgit - BGG MCP (by kkjdaniel) - MCP to enable interaction with the BoardGameGeek API via AI tooling.
apihttpaigitgithub - bgg-mcp-server 📘 🏠 📇 - MCP server for BoardGameGeek API
apihttpmlgitgithubnpm install attilad/bgg-mcp-server - Bible - Add biblical context to your generative AI applications.
httpaigitgithub - Bilibili - This MCP server provides tools to fetch Bilibili user profiles, video metadata, search videos, and more.
filehttpgitgithub - Binance - Cryptocurrency trading and market data access through Binance API integration.
apihttpgitgithub - Binance (by dosseh shalom) - Unofficial tools and server implementation for Binance's Model Context Protocol (MCP). Designed to support developers building crypto trading AI Agents.
httpaigitgithub - binance-p2p-mcp-server 🏠 - Binance (focus in P2P firstly) Model Context Protocol Server
servergit clone https://github.com/espinozasenior/binance-p2p-mcp-server - Bing Webmaster Tools 🏠 📇 - MCP server for Bing Webmaster Tools API integration providing access to search analytics, site management, URL submission, and SEO insights
apiwebhttpgitgithub - bioinformatics-mcp-example 🐍 🏠 - Example of how to build a bioinformatics repository for bioinformatics.
httpdockergitgithubpythonpip install git+https://github.com/entropic-digital/bioinformatics-mcp-example - bioRxiv - 🔍 Enable AI assistants to search and access bioRxiv papers through a simple MCP interface.
httpaigitgithub - bitteprotocol/mcp 📇 🏠 - Bitte Protocol integration to run AI Agents on several blockchains.
httpaigitgithub - bivex/kanboard-mcp 🏎️ ☁️ 🏠 🏠 📇 - A Model Context Protocol (MCP) server written in Go that empowers AI agents and Large Language Models (LLMs) to seamlessly interact with Kanboard. It transforms natural language commands into Kanboard API calls, enabling intelligent automation of project, task, and user management, streamlining workflows, and enhancing productivity.
apihttpaimlllm - Blender - BlenderMCP connects Blender to Claude AI through the Model Context Protocol (MCP), allowing Claude to directly interact with and control Blender.
blender3dmodeling - Blender MCP - MCP server to create professional like 3d scenes on blender using natural language.
httpgitgithub - Blockbench MCP Plugin (by jasonjgardner) - Blockbench plugin to connect AI agents to Blockbench's JavaScript API. Allows for creating and editing 3D models or pixel art textures with AI in Blockbench.
apihttpaigitgithub - Blockchain MCP - MCP Server for Blockchain Data from Tatum that instantly unlocks blockchain access for your AI agents. This official Tatum MCP server connects to any LLM in seconds.
httpaillmgitgithub - Bluesky (by semioz) - An MCP server for Bluesky, a decentralized social network. It enables automated interactions with the AT Protocol, supporting features like posting, liking, reposting, timeline management, and profile operations.
filehttpgitgithub - Bluetooth MCP Server - Control Bluetooth devices and manage connections through natural language commands, including device discovery, pairing, and audio controls.
httpaigitgithub - BNBChain MCP - An MCP server for interacting with BSC, opBNB, and the Greenfield blockchain.
httpaigitgithub - bocchiczennie/aws-monthly-cost-report-mcp-server 🏠 - Facilitates the generation of monthly AWS cost reports through an MCP server, integrating seamlessly with Claude Desktop.
httpawsmlgitgithub - bourbonkk/k8s-pilot 🏠 📇 - Centralized control plane server for managing multiple Kubernetes clusters with intuitive APIs and multi-cluster context switching.
apihttpkubernetesgitgithub - Braintree - Unofficial PayPal Braintree payment gateway MCP Server for AI agents to process payments, manage customers, and handle transactions securely.
httpaigitgithub - Brave Search - Web and local search using Brave's Search API. Has been replaced by the official server.
apiweblocalhttpai - Brazilian Law (by pdmtt) - Agent-driven research on Brazilian law using official sources.
httpgitgithub - BreakoutRoom - Agents accomplishing goals together in p2p rooms
httpgitgithub - brianxiadong/ones-wiki-mcp-server ☕ ☁️/🏠 🏠 - A Spring AI MCP-based service for retrieving ONES Waiki content and converting it to AI-friendly text format.
httpaigitgithub - Bright Data 🏠 - Discover, extract, and interact with the web - one interface powering automated access across the public internet.
webhttpgitgithub - Bright-L01/networkx-mcp-server 🐍 🏠 🏠 - The first NetworkX integration for Model Context Protocol, enabling graph analysis and visualization directly in AI conversations. Supports 13 operations including centrality algorithms, community detection, PageRank, and graph visualization.
httpaigitgithub - Browser MCP (by UI-TARS) - A fast, lightweight MCP server that empowers LLMs with browser automation via Puppeteer’s structured accessibility data, featuring optional vision mode for complex visual understanding and flexible, cross-platform configuration.
httpaillmgitgithub - BrowserLoop - An MCP server for taking screenshots of web pages using Playwright. Supports high-quality capture with configurable formats, viewport sizes, cookie-based authentication, and both full page and element-specific screenshots.
webauthhttpgitgithub - bsmith925/mcp-examples 🏠 - Explore deployment configurations and custom implementations for team-wide MCP servers, focusing on Git repository management and Kubernetes deployment.
httpkubernetesgitgithub - BugBug MCP Server - Unofficial MCP server for BugBug API.
apihttpgitgithub - builtwith-mcp-server 📜 🏠 📇 - Node.js-based
apiwebhttpaigitnpm install Meerkats-Ai/builtwith-mcp-server - BVG MCP Server - (Unofficial) - Unofficial MCP server for Berliner Verkehrsbetriebe Api.
apihttpaigitgithub - Bybit - A Model Context Protocol (MCP) server for integrating AI assistants with Bybit cryptocurrency exchange APIs, enabling automated trading, market data access, and account management.
apihttpaigitgithub - bytebase/dbhub 🏠 - 📇 Universal database MCP server supporting mainstream databases.\
databasehttpaigitgithub - C# MCP SDK
httpgitgithub - CAD-MCP (by daobataotie) - Drawing CAD(Line,Circle,Text,Annotation...) through MCP server, supporting mainstream CAD software.
httpaigitgithub - calendar-mcp-server 📘 🏠 - MCP server to get google calendar
httpgitgithubtypescriptmcpnpm install menma-at-here/calendar-mcp-server - Calendly-mcp-server - Open source calendly mcp server.
httpgitgithub - CallHub 🏠 - Python-based MCP tool providing a comprehensive set of functions for managing contacts, phonebooks, agents, teams, campaigns, and other CallHub resources.
httpaigitgithub - cantian-ai/bazi-mcp 📇 🏠 ☁️ 🍎 🪟 🏠 - Provides comprehensive and accurate Bazi (Chinese Astrology) charting and analysis
httpaigitgithub - caol64/wenyan-mcp 📇 🏠 🍎 🪟 🐧 🏠 - Wenyan MCP Server, which lets AI automatically format Markdown articles and publish them to WeChat GZH.
httpaigitgithub - cappt-team/mcp-server-nodejs 🏠 - Facilitates the generation of outlines and presentations using Cappt with NodeJS.
httpgitgithub - Career Site Jobs - A MCP server to retrieve up-to-date jobs from company career sites.
apihttp - carsol/monarch-mcp-server 🐍 ☁️ 🏠 - MCP server providing read-only access to Monarch Money financial data, enabling AI assistants to analyze transactions, budgets, accounts, and cashflow data with MFA support.
httpaigitgithub - Catalysis Hub - Unofficial MCP server for searching and retrieving scientific data from the Catalysis Hub database, providing access to computational catalysis research and surface reaction data.
databasehttpgitgithub - CB Insights - Use the CB Insights MCP Server to connect to ChatCBI
httpgitgithub - Chaitin IP Intelligence 🏠 📇 - Search for IP addresses using Chaitin's IP Intelligence API.
apihttpaigitgithub - chargenow-mcp 📜 🏠 📇 - MCP server for finding ChargeNow EV charging points.
apihttpaigitgithubnpm install cevatkerim/chargenow-mcp - Chart 🏠 - This server offers a wide variety of chart types with comprehensive Zod schema validation for type-safe chart configuration.
httpgitgithub - ChatSum - Query and Summarize chat messages with LLM. by mcpso
httpllmgitgithub - chcharcharlie/10XResearcher 🏠 - 10XResearcher enhances Claude into a systematic research agent with local data storage, enabling iterative research methodologies and high-quality outcomes.
localhttpgitgithub - CheMiguel23/MemoryMesh 📇 🏠 🏠 - Enhanced graph-based memory with a focus on AI role-play and story generation
httpaigitgithub - ChemRxiv-MCP-Server 🏠 - A MCP Server for ChemRxiv
mcpservergit clone https://github.com/JackKuo666/ChemRxiv-MCP-Server - ChessPal Chess Engine (stockfish) - A Stockfish-powered chess engine exposed as an MCP server. Calculates best moves and supports both HTTP/SSE and stdio transports.
httpgitgithub - ChrisMethsillo/ReyxGPT 🐍 🏠 - ReyxGPT enables seamless management of Minecraft servers through the Model Context Protocol, facilitating command execution and status monitoring via RCON.
httpmlgitgithubmonitoring - Chroma - Vector database server for semantic document search and metadata filtering, built on Chroma
databasehttpgitgithub - Chroma Package Search - Add to coding agents like Claude or Cursor to give them the ability to understand and better use thousands of dependencies.
http - Chrome history - Talk with AI about your browser history, get fun ^^
httpaigitgithub - ChuckNorris 🏠 - A specialized MCP gateway for LLM enhancement prompts and jailbreaks with dynamic schema adaptation. Provides prompts for different LLMs using an enum-based approach.
httpaillmgitgithub - ciaraadkins/mixpanel-mcp-wrapper 🏠 - Facilitates seamless integration of Mixpanel analytics with Claude Desktop by automatically injecting project tokens into MCP requests.
httpmlgitgithubanalytics - CIViC - MCP server for the Clinical Interpretation of Variants in Cancer (CIViC) database, providing access to clinical variant interpretations and genomic evidence for cancer research.
databasehttpgitgithub - cjo4m06/mcp-shrimp-task-manager 📇 ☁️ 🏠 🏠 - A programming-focused task management system that boosts coding agents like Cursor AI with advanced task memory, self-reflection, and dependency management. ShrimpTaskManager
httpaigitgithub - clarion-builder-mcp-server 🏠 - MCP server providing Clarion development and build capabilities
mcpservergit clone https://github.com/peterparker57/clarion-builder-mcp-server - Claude Thread Continuity - Persistent memory system enabling Claude Desktop conversations to resume with full context across sessions. Maintains conversation history, project states, and user preferences for seamless multi-session workflows.
httpaimlgitgithub - Claude-Code-MCP 🏠 - Claude Code MCP servers
claudemcpmcp-serverservergit clone https://github.com/boysoai/Claude-Code-MCP - claude-faf-mcp - MCP server for .faf format. Context scoring engine with project context management.
httpgitgithub - ClaudePost - ClaudePost enables seamless email management for Gmail, offering secure features like email search, reading, and sending.
httpaimlgitgithub - CLDGeminiPDF Analyzer - MCP server tool enabling sharing large PDF files to Google LLMs via API for further/additional analysis and response retrieval to Claude Desktop.
apifilehttpllmgit - ClearML MCP - Get comprehensive ML experiment context and analysis directly from ClearML in your AI conversations.
httpaimlgitgithub - clickup-mcp 📜 🏠 - Node.js-based
httpaimlgitgithubnpm install bravoure/clickup-mcp - clojure-mcp 🏠 - Clojure development tools, direct access to the running program via REPL.
httpgitgithub - CloudBase - One-stop backend services for WeChat Mini-Programs and full-stack apps with serverless cloud functions and databases by Tencent CloudBase
databasehttpaigitgithub - cloudflare-remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install nhc/cloudflare-remote-mcp-server - cobanov/teslamate-mcp 🐍 🏠 🏠 - A Model Context Protocol (MCP) server that provides access to your TeslaMate database, allowing AI assistants to query Tesla vehicle data and analytics.
databasehttpaigitgithub - CockroachDB MCP Server – Full - featured MCP implementation built with FastAPI and CockroachDB. Supports schema bootstrapping, JSONB storage, LLM-ready CLI, and optional /debug endpoints.
apihttpjsonllmgit - Code Screenshot Generator - Generate beautiful syntax-highlighted code screenshots with professional themes directly from Claude. Supports file reading, line selection, git diff visualization, and batch processing.
filehttpgitgithub - code_search_mcp 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install p1atdev/code_search_mcp - code-assistant - A coding assistant MCP server that allows to explore a code-base and make changes to code. Should be used with trusted repos only (insufficient protection against prompt injections).
httpaigitgithubweb - code-explorer-mcp 📜 🏠 - TypeScript-based MCP server that implements a simple notes system
httpgitgithubjavascriptmcpnpm install jordankamto/code-explorer-mcp - CodeContextMCP 🏠 - An MCP server for adding additional repos context using the MCP protocol
mcpservergit clone https://github.com/offeka/CodeContextMCP - CodeCrunchMCP 🐍 🏠 - Python-based
filehttpcsvazuregitpip install git+https://github.com/rithik-perera/CodeCrunchMCP - coderider-mcp 🏠 - jihulab mcp servers
mcpservergit clone https://github.com/victorzxj/coderider-mcp - Codesys-mcp-toolkit 🏠 - A Model Context Protocol (MCP) server for CODESYS V3 programming environments.
httpgitgithub - codex-mcp 🏠 - a mcp server for codex
mcpservergit clone https://github.com/fatu/codex-mcp - codex-vitea-mcp 📘 🏠 - TypeScript-based
httpmongodbaigitgithubnpm install KawaroX/codex-vitea-mcp - codingaslu/PubMed-MCP-Server 🏠 - Leverages the FastMCP framework to asynchronously search PubMed for article abstracts using BioPython's Entrez module.
httpgitgithub - cognee-mcp - GraphRAG memory server with customizable ingestion, data processing and search
httpaigitgithub - cognigraph-mcp-server 📜 🏠 - use markmap-cli,mermaid-cli to create cognigraph
localhttpaigitgithubnpm install xsp52Hz/cognigraph-mcp-server - CoinGecko - Official CoinGecko API MCP Server for Crypto Price & Market Data, across 200+ blokchain networks and 8M+ tokens.
apihttpai - CoinMarketCap - Implements the complete CoinMarketCap API for accessing cryptocurrency market data, exchange information, and other blockchain-related metrics.
apihttpaigitgithub - Companies House MCP (by Stefano Amorelli) - MCP server to connect with the UK Companies House API.
apihttpgitgithub - computer-use-mcp - Control your computer with screen capture, mouse, and keyboard capabilities for automated desktop interaction and task execution.
httpgitgithub - ConechoAI/openai-websearch-mcp 🐍 🏠 ☁️ 🏠 - This is a Python-based MCP server that provides OpenAI websearch build-in tool.
webhttpaiopenaigit - Congress.gov API - An MCP server to interact with real-time data from the Congress.gov API, which is the official API for the United States Congress.
apihttpgitgithub - Console Automation - Production-ready MCP server for AI-driven console automation and monitoring. 40 tools for session management, SSH, testing, monitoring, and background jobs. Like Playwright for terminal applications.
httpaigitgithubmonitoring - consult7 - Analyze large codebases and document collections using high-context models via OpenRouter, OpenAI, or Google AI -- very useful, e.g., with Claude Code
httpaiopenaigitgithub - Context 7 🏠 - Context7 MCP - Up-to-date Docs For Any Cursor Prompt
httpgitgithub - Context Crystallizer - AI Context Engineering tool that transforms large repositories into crystallized, AI-consumable knowledge through systematic analysis and optimization.
httpaigitgithub - Continue vscode auto complete and chat tool (full feature support) 🏠
httpgitgithub - Convex - Introspect and query your apps deployed to Convex.
http - Coresignal 🏠 - Access comprehensive B2B data on companies, employees, and job postings for your LLMs and AI workflows.
httpaillmgitgithub - cplusplus-mcp - Semantic C++ code analysis using libclang. Enables Claude to understand C++ codebases through AST parsing rather than text search - find classes, navigate inheritance, trace function calls, and explore code relationships.
httpgitgithub - cpp-builder-mcp-server 🏠 - MCP server providing C++ DLL compilation and analysis capabilities
mcpservergit clone https://github.com/peterparker57/cpp-builder-mcp-server - cqfn/aibolit-mcp-server ☕ 🏠 - Helping Your AI Agent Identify Hotspots for Refactoring; Help AI Understand How to 'Make Code Better'
httpaigitgithub - cqtrinv/trinvmcp 📇 ☁️ 🏠 - Explore French communes and cadastral parcels based on name and surface
httpgitgithub - CRASH - MCP server for structured, iterative reasoning and thinking with flexible validation, confidence tracking, revision mechanisms, and branching support.
httpgitgithub - Crawlbase MCP 🏠 - Enables AI agents to access real-time web data with HTML, markdown, and screenshot support. SDKs: Node.js, Python, Java, PHP, .NET.
webhttpaimlgit - crawler-mcp-server 🏠 - crawler-mcp-server
mcpservergit clone https://github.com/m1ggle/crawler-mcp-server - Cronlytic - Create CRUD operations for serverless cron jobs through Cronlytic MCP Server
httpgitgithub - CSV Editor - Comprehensive CSV processing with 40+ operations for data manipulation, analysis, and validation. Features auto-save, undo/redo, and handles GB+ files. Built with FastMCP & Pandas.
filehttpcsvgitgithub - Cua 🏠 - MCP server for the Computer-Use Agent (CUA), allowing you to run CUA through Claude Desktop or other MCP clients.
httpaigitgithub - curious-pm/mcp-digitaloceanbilling 🏠 📇 - Facilitates seamless integration with Digital Ocean's Billing API, offering tools for viewing account balances, billing history, and invoices.
apihttpmlgitgithub - curious-pm/mcp-googlecloudbilling 🏠 📇 - Facilitates integration with Google Cloud Billing API, enabling AI assistants to analyze and manage cloud costs efficiently.
apihttpaigitgithub - curiousguyinhis30s/simple-task-master 🏠 - A task management system that integrates with Desktop Commander MCP to organize and track tasks for Claude desktop code projects.
httpgitgithub - Cursor MCP Installer - A tool to easily install and configure other MCP servers within Cursor IDE, with support for npm packages, local directories, and Git repositories.
localhttpgitgithub - cursor_mcpserver 🏠 - Repository created using MCP GitHub server
mcpservergit clone https://github.com/mayur29/cursor_mcpserver - Cursor-MCP-test 🏠 - A test repository for Cursor MCP integration
httpmlgitgithubmcpgit clone https://github.com/4workspace/Cursor-MCP-test - custom_mcp_server 🏠
git clone https://github.com/ronnitburman/custom_mcp_server - CVE Intelligence Server – Provides vulnerability intelligence via multi - source CVE data, essential exploit discovery, and EPSS risk scoring through the MCP. Useful for security research, automation, and agent workflows.
httpgitgithub - d-stoll/attio-js 🏠 - A JavaScript/TypeScript SDK for Attio that doubles as an MCP server, enabling AI applications to invoke CRM-related operations.
httpaigitgithub - D365FO - A comprehensive MCP server for Microsoft Dynamics 365 Finance & Operations (D365 F&O) that provides easy access to OData endpoints, metadata operations, label management, and AI assistant integration.
httpaigitgithub - dagger/container-use 🏎️ 🏠 🐧 🍎 🪟 🏠 - Containerized environments for coding agents. Multiple agents can work independently, isolated in fresh containers and git branches. No conflicts, many experiments. Full execution history, terminal access to agent environments, git workflow. Any agent/model/infra stack.
httpaigitgithub - Dagster - An MCP server to easily build data pipelines using Dagster.
httpgitgithub - daisys-ai/daisys-mcp 🐍 🏠 🍎 🪟 🐧 🏠 - Generate high-quality text-to-speech and text-to-voice outputs using the DAISYS platform and make it able to play and store audio generated.
httpaigitgithub - dandacompany/webhook-trigger 🐍 🏠 - Facilitates dynamic webhook transmission using FastMCP framework with support for various HTTP methods and custom headers.
webhttpgitgithub - Dangoron/defillama-mcp 🏠 - Facilitates the execution of DeFiLlama data processing scripts through an MCP server configuration.
httpgitgithub - danielkennedy1/pdf-tools-mcp 🐍 🏠 - PDF download, view & manipulation utilities.
httpgitgithub - daoch4n/mcp-git 🏠 - A TypeScript-based MCP server that facilitates Git operations by managing text notes with URIs and metadata, offering tools for note creation and summarization prompts.
httpgitgithub - Dash0 🏠 - Navigate your OpenTelemetry resources, investigate incidents and query metrics, logs and traces on Dash0.
httpgitgithubmetrics - Data-Everything/mcp-server-templates 📇 🏠 🍎 🪟 🐧 🏠 - One server. All tools. A unified MCP platform that connects many apps, tools, and services behind one powerful interface—ideal for local devs or production agents.
localhttpgitgithub - data-viz-mcp-server 🏠 - data-viz-mcp-server
mcpservergit clone https://github.com/AminKhorramii/data-viz-mcp-server - Databricks Smart SQL - Leveraging Databricks Unity Catalog metadata, perform smart efficient SQL queries to solve Ad-hoc queries and explore data.
httpgitgithub - DataCite - Unofficial MCP server for DataCite, providing access to research data and publication metadata through DataCite's REST API and GraphQL interface for scholarly research discovery.
apirestgraphqlhttpgit - Datadog - Datadog MCP Server for application tracing, monitoring, dashboard, incidents queries built on official datadog api.
apihttpgitgithubmonitoring - DataEval/dingo 🎖️ 🐍 🏠 🍎 🪟 🐧 🏠 - MCP server for the Dingo: a comprehensive data quality evaluation tool. Server Enables interaction with Dingo's rule-based and LLM-based evaluation capabilities and rules&prompts listing.
httpllmgitgithub - datalayer/jupyter-earth-mcp-server 🏠 - Facilitates geospatial analysis in Jupyter notebooks by integrating NASA Earthdata with Model Context Protocol.
httpgitgithub - Dataset Viewer - Browse and analyze Hugging Face datasets with features like search, filtering, statistics, and data export
httpgitgithub - Dataverse DevTools MCP Server - An MCP server exposing ready-to-use Dataverse/Dynamics 365 tools for user and security administration, data operations, Web API executions, metadata exploration, and troubleshooting.
apiwebhttpgitgithub - davalmeyda/serper-productos 🏠 📇 - Facilitates online product searches using Google Serper API, seamlessly integrating with AI assistants via MCP.
apihttpaimlgit - davidan90/time-node-mcp 📇 🏠 🏠 - Timezone-aware date and time operations with support for IANA timezones, timezone conversion, and Daylight Saving Time handling.
httpgitgithub - DBHub - Universal database MCP server connecting to MySQL, MariaDB, PostgreSQL, and SQL Server.
databasehttpmysqlpostgresgit - dbsanfte/topdesk-mcp 🐍 ☁️ 🏠 - MCP server for the Topdesk ticketing system, allowing AI models to interact with and add comments to incident tickets.
httpaigitgithub - ddsky/gamebrain-api-clients ☁️ 🏠 📇 - Search and discover hundreds of thousands of video games on any platform through the GameBrain API.
apihttpaigitgithub - dealx/mcp-server ☁️ 🏠 - MCP Server for DealX platform
httpgitgithub - Decodo 🏠 - Easy web data access. Simplified retrieval of information from websites and online sources.
webhttpgitgithub - Deebo - Agentic debugging MCP server that helps AI coding agents delegate and fix hard bugs through isolated multi-agent hypothesis testing.
httpaigitgithub - DeepWiki by Devin - Remote, no-auth MCP server providing AI-powered codebase context and answers
remoteauthhttpai - DeFi Rates - Query real-time DeFi lending rates across 13+ protocols (Aave, Morpho, Compound, Venus, Solend, Drift, Jupiter, etc.). Compare rates, search best opportunities, and calculate looping strategies across Ethereum, Arbitrum, Base, BSC, Solana, and HyperEVM.
httpgitgithub - Defuddle Fetch - Fetch web content with enhanced extraction using Defuddle, converting pages to clean markdown with better results than standard HTML-to-markdown converters.
webhttpmlgitgithub - deploy-mcp - Universal deployment tracker for AI assistants with live status badges and deployment monitoring.
httpaigitgithubmonitoring - Depyler - Energy-efficient Python-to-Rust transpiler with progressive verification, enabling AI assistants to convert Python code to safe, performant Rust while reducing energy consumption by 75-85%.
httpaimlgitgithub - Devcontainer - An MCP server for devcontainer to generate and configure development containers directly from devcontainer configuration files.
filehttpaigitgithub - DevDb - An MCP server that runs right inside the IDE, for connecting to MySQL, Postgres, SQLite, and MSSQL databases.
databasefilehttpmysqlpostgres - devflowinc/trieve 🎖️ 📇 ☁️ 🏠 🏠 - Crawl, embed, chunk, search, and retrieve information from datasets through Trieve
httpaigitgithub - device-info-mcp 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install Guidogl/device-info-mcp - DEVNADS-Monad-TESNET-MCP-Tools 📘 🏠 - TypeScript-based
httpaigitgithubtypescriptnpm install ccassini/DEVNADS-Monad-TESNET-MCP-Tools - DevOps AI Toolkit - AI-powered development productivity platform that enhances software development workflows through intelligent automation and AI-driven assistance.
httpaigitgithub - DevOps-MCP - Dynamic Azure DevOps MCP server with directory-based authentication switching, supporting work items, repositories, builds, pipelines, and multi-project management with local configuration files.
filelocalauthhttpazure - DGIdb - MCP server for the Drug Gene Interaction Database (DGIdb), providing access to drug-gene interaction data, druggable genome information, and pharmacogenomics research.
databasehttpgitgithub - doc-lib-mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/shifusen329/doc-lib-mcp - DICOM-MCP 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/shaunporwal/DICOM-MCP - digdir-mcp-servers 🏠 - Model Context Protocol Servers from Digdir
mcp-serverservergit clone https://github.com/Altinn/digdir-mcp-servers - digila/linear-mcp 🏠 - A TypeScript-based MCP server for managing and summarizing text notes with URI-based access and LLM integration.
httpllmgitgithub - DigitalOcean MCP Server 🏠 📇 - A Model Context Protocol (MCP) server that provides programmatic access to DigitalOcean's API. This server exposes tools for managing droplets, Kubernetes clusters, and container registries through the MCP interface.
apihttpkubernetesaigit - digitalocean-mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/oliverbenns/digitalocean-mcp - Digma 🏠 - A code observability MCP enabling dynamic code analysis based on OTEL/APM data to assist in code reviews, issues identification and fix, highlighting risky code etc.
httpaigitgithub - DINO-X 🏠 - Advanced computer vision and object detection MCP server powered by Dino-X, enabling AI agents to analyze images, detect objects, identify keypoints, and perform visual understanding tasks.
httpaigitgithub - Discogs - An MCP server that connects to the Discogs API for interacting with your music collection.
apihttpgitgithub - Discord - For Discord API integration by Klavis AI
apihttpaigitgithub - Discord Server - A community discord server dedicated to MCP by Frank Fiegel
httpaigitgithubdiscord - Discord Server (ModelContextProtocol) - Connect with developers, share insights, and collaborate on projects in an active Discord community dedicated to the Model Context Protocol by Alex Andru
httpgitgithubdiscord - Dispatch Agent - An intelligent MCP server that provides specialized filesystem operations through ReAct sub-agents.
filehttpgitgithub - Django REST Framework MCP 🏠 📇 - Expose Django REST Framework APIs as MCP tools for LLMs and agentic applications
apiresthttpllmgit - dkvdm/onepassword-mcp-server 🏠 - Facilitates secure credential retrieval from 1Password for integration with Agentic AI.
httpaigitgithub - DocBase - Official MCP server for DocBase API integration, enabling post management, user collaboration, group administration, and more.
apihttp - Docker - Docker MCP Server provides advanced, unified Docker management via CLI and MCP workflows, supporting containers, images, volumes, networks, and orchestration.
httpdockeraigitgithub - docker-mcp 🐍 🏠 - Python-based
httpdockergitgithubpythonpip install git+https://github.com/kappaexpress/docker-mcp - docker-mcp 🐍 🏠 - Python-based
httpdockeraigitgithubpip install git+https://github.com/cpecf/docker-mcp - docker/hub-mcp 🎖️ 📇 ☁️ 🏠 🏠 - Official MCP server to interact with Docker Hub, providing access to repositories, hub search and Docker Hardened Images
httpdockergitgithub - Docs - Enable documentation access for the AI agent, supporting llms.txt and other remote or local files.
fileremotelocalhttpai - documcp - An MCP server for intelligent document processing and management, supporting multiple formats and document operations.
httpgitgithub - Docy - Docy gives your AI direct access to the technical documentation it needs, right when it needs it. No more outdated information, broken links, or rate limits - just accurate, real-time documentation access for more precise coding assistance.
httpaigitgithub - Dodo Payments - Enables AI agents to securely perform payment operations via a lightweight, serverless-compatible interface to the Dodo Payments API.
apihttpaigitgithub - doggybee/mcp-server-ccxt 📇 ☁️ 🏠 - An MCP server for accessing real-time crypto market data and trading via 20+ exchanges using the CCXT library. Supports spot, futures, OHLCV, balances, orders, and more.
httpgitgithub - doma2k/monad-contract-deployment-mcp 🏠 - Facilitates the compilation and deployment of smart contracts within the Monad ecosystem, enabling interactions directly from chat prompts or compatible MCP clients.
httpgitgithub - Domain Tools - A Model Context Protocol (MCP) server for comprehensive domain analysis: WHOIS, DNS records, and DNS health checks.
httpaigitgithub - dotemacs/domain-lookup-mcp 🏎️ 🏠 - Domain name lookup service, first via RDAP and then as a fallback via WHOIS
httpaigitgithub - dotnet-powerplatform-mcp 🏠 - A MCP server for powerplatform/dataverse implemented in .Net
mcpservergit clone https://github.com/dotnetprog/dotnet-powerplatform-mcp - Downdetector - Check service status and outage information from Downdetector for real-time monitoring of service availability across various platforms and regions.
httpaigitgithubmonitoring - drakonkat/wizzy-mcp-tmdb 📇 ☁️ 🏠 📇 - A MCP server for The Movie Database API that enables AI assistants to search and retrieve movie, TV show, and person information.
apidatabasehttpaigit - DreamFactory 🏠 - An MCP server for securely (via RBAC) talking to on-premise and cloud MS SQL Server, MySQL, PostgreSQL databases and other data sources.
databasehttpmysqlpostgresgit - DropBin - Remote SSE MCP server for hosting HTML webpages and sharing content through temporary URLs without authentication
webremoteauthhttpml - Druid MCP Server - STDIO/SEE MCP Server for Apache Druid by iunera that provides extensive tools, resources, and prompts for managing and analyzing Druid clusters.
httpgitgithub - duaraghav8/MCPJungle 🏎️ 🏠 🏠 - Self-hosted MCP Server registry for enterprise AI Agents
httpaigitgithub - DuneRaccoon/financial-markets-analyser 🐍 🏠 - FastMCP server providing financial data endpoints for stocks and cryptocurrencies with multi-source fallback for reliability.
httpgitgithub - dwd-mcp-server 📜 🏠 📇 - A simple mcp-server via the Deutscher Wetterdienst API
apihttpgitgithubjavascriptnpm install lincw/dwd-mcp-server - DynamoDB-Toolbox - Leverages your Schemas and Access Patterns to interact with your DynamoDB Database using natural language.
databasehttpaws - EasyMCP (TypeScript)
httpgitgithub - echozyr2001/ali-flux-mcp 🏠 📇 - Facilitates image generation and management using Alibaba Cloud's DashScope API, with task tracking and local storage capabilities.
apilocalhttpgitgithub - EDA MCP Server - A comprehensive Model Context Protocol server for Electronic Design Automation tools, enabling AI assistants to synthesize Verilog with Yosys, simulate designs with Icarus Verilog, run complete ASIC flows with OpenLane, and view results with GTKWave and KLayout.
httpaigitgithub - EdgeOne Pages MCP - An MCP service designed for deploying HTML content to EdgeOne Pages and obtaining an accessible public URL.
deploymenthtmlpages - edupoli/zapdelivery 🏠 📇 - ZapDelivery API facilitates self-service delivery projects with an integrated MCP endpoint for seamless operations.
apihttpmlgitgithub - Edwin - MCP server for edwin SDK - enabling AI agents to interact with DeFi protocols across EVM, Solana and other blockchains.
httpaigitgithub - eechat - An open-source, cross-platform desktop application that seamlessly connects with MCP servers, across Linux, macOS, and Windows.
httpmlgitgithub - eiz/fooddb 🏠 - Query USDA Food Data Central with smart keyword and semantic vector search capabilities.
httpgitgithub - ELEMENT.FM - Create and publish unlimited podcast shows and episodes with ELEMENT.FM
httpgitgitlab - elementfm/mcp 🎖️ 🐍 📇 🏠 ☁️ - Open source podcast hosting platform
httpgitgitlab - elisp-dev-mcp 🏠 - elisp (Emacs Lisp) development support tools, running in Emacs.
httpgitgithub - elixir_linux_mcp_server 🐍 🏠 - 基于Elixir的Linux源码查询MCP Server
httpllmgitgithubpythonpip install git+https://github.com/KilluaYZ/elixir_linux_mcp_server - Email Send MCP 🏠 - A fixed one from above one. More user-friendly.
httpaigitgithubemail - Email SMTP - A simple MCP server that lets your AI agent send emails and attach files through SMTP.
filehttpaigitgithub - emicklei/mcp-log-proxy 🏎️ 🏠 🏠 - MCP server proxy that offers a Web UI to the full message flow
webhttpgitgithub - emicklei/melrose-mcp 🏎️ 🏠 🏠 - Plays Melrōse music expressions as MIDI
httpgitgithub - endorhq/cli 📇 ☁️ 🏠 🪟 🐧 🍎 🏠 - Endor lets your AI agents run services like MariaDB, Postgres, Redis, Memcached, Alpine, or Valkey in isolated sandboxes. Get pre-configured applications that boot in less than 5 seconds.
httppostgresredisaigit - Enhance Prompt - An MCP service for enhance you prompt.
httpgitgithub - EnterpriseMCP 🏠 - MCP-Server for connecting Enterprise functionality such as SAP or Salesforce Integration
mcpservergit clone https://github.com/sebi5000/EnterpriseMCP - Entrez - Unofficial MCP server for NCBI Entrez databases, providing access to PubMed articles, gene information, protein data, and other biomedical research resources through NCBI's E-utilities API.
apidatabasehttpgitgithub - eqozqq_MCPE-Alpha-Server-for-Pterodactyl 🏠 - Mirror of https://github.com/eqozqq/MCPE-Alpha-Server-for-Pterodactyl
mcpserverhttpgit clone https://github.com/MCP-Mirror/eqozqq_MCPE-Alpha-Server-for-Pterodactyl - etsd-tech/mcp-pointer 📇 🏠 🍎 🪟 🐧 🏠 - Visual DOM element selector for agentic coding tools. Chrome extension + MCP server bridge for Claude Code, Cursor, Windsurf etc. Option+Click to capture elements.
httpgitgithub - Eunomia - Extension of the Eunomia framework that connects Eunomia instruments with MCP servers
httpaigitgithub - EverArt - AI image generation using various models.
httpaigitgithub - Everything - Reference / test server with prompts, resources, and tools.
- Everything 🏠 - Reference / test server with prompts, resources, and tools
httpaigitgithub - executeautomation/mcp-playwright-server 📇 🏠 - An MCP server using Playwright for browser automation and webscrapping
webhttpgitgithub - Experimental-MCP-Server-created-by-Github-MCP 🏠 - Experimental MCP Server created via Github-MCP integration.
mcpservergit clone https://github.com/sonadukane18/Experimental-MCP-Server-created-by-Github-MCP - Express_MCP_server 🏠 - Basic Express server template
servergit clone https://github.com/udaya38/Express_MCP_server - Extended Memory - Persistent memory across Claude conversations with multi-project support, automatic importance scoring, and tag-based organization. Production-ready with 400+ tests.
httpgitgithub - extreme-p-mcp 🐍 🏠 📇 - Python-based
apihttpgitgithubpythonpip install git+https://github.com/koido/extreme-p-mcp - F1 - Access to Formula 1 data including race results, driver information, lap times, telemetry, and circuit details.
httpaigitgithub - Fabric MCP - Microsoft Fabric MCP server to accelerate working in your Fabric Tenant with the help of your favorite LLM models.
httpllmgitgithub - Fabric Real-Time Intelligence MCP - Official Microsoft Fabric RTI server to accelerate working with Eventhouse, Azure Data Explorer(Kusto), Eventstreams and other RTI items using your favorite LLM models.
httpazurellmgitgithub - fabric-mcp-server - The fabric-mcp-server is an MCP server that integrates Fabric patterns with Cline, exposing them as tools for AI-driven task execution and enhancing Cline's capabilities.
httpaigitgithub - Facebook Ads 10xeR - Advanced Facebook Ads MCP server with enhanced creative insights, multi-dimensional breakdowns, and comprehensive ad performance analytics.
httpgitgithubanalytics - Fal MCP Server - Generate AI images, videos, and music using Fal.ai models (FLUX, Stable Diffusion, MusicGen) directly in Claude
httpaigitgithub - falahgs/gemini-vision-art-studio 📘 🏠 - Gemini Vision Art Studio harnesses Google's Gemini AI to generate 3D cartoons and transform images with artistic flair.
httpaigitgithub - Fastmail MCP - Access Fastmail via JMAP: list/search emails, send and move mail, handle attachments/threads, plus contacts and calendar tools.
httpaigitgithubemail - Federal Reserve Economic Data (FRED) (by Stefano Amorelli) - Community developed MCP server to interact with the Federal Reserve Economic Data.
httpgitgithub - ferdousbhai/investor-agent 🐍 ☁️ 🏠 - Yahoo Finance integration to fetch stock market data including options recommendations
httpaigitgithub - ferdousbhai/tasty-agent 🐍 ☁️ 🏠 📇 - Tastyworks API integration to handle trading activities on Tastytrade
apihttpaigitgithub - ferdousbhai/wsb-analyst-mcp 🐍 ☁️ 🏠 - Reddit integration to analyze content on WallStreetBets community
httpaigitgithub - Fetch - Web content fetching and conversion for efficient LLM usage.
webllm - Feyod - A server that answers questions about football matches, and specialised in the football club Feyenoord.
httpgitgithub - FHIR - A Model Context Protocol server that provides seamless, standardized access to Fast Healthcare Interoperability Resources (FHIR) data from any compatible FHIR server. Designed for easy integration with AI tools, developer workflows, and healthcare applications, it enables natural language and programmatic search, retrieval, and analysis of clinical data.
httpaimlgitgithub - FHIR 🏠 📇 - Model Context Protocol server for Fast Healthcare Interoperability Resources (FHIR) APIs, enabling seamless integration with healthcare data through SMART-on-FHIR authentication and comprehensive FHIR operations.
apiauthhttpmlgit - Fibaro HC3 - MCP server for Fibaro Home Center 3 smart home systems.
httpaigitgithub - Figma - A blazingly fast MCP server to read and export your Figma design files.
filehttpgitgithub - Figma to Flutter - Write down clean and better Flutter code from Figma design tokens and enrich nodes data in Flutter terminology.
httpgitgithub - figma-mcp 🐍 🏠 - Python-based
filehttpgitgithubpythonpip install git+https://github.com/raj-mehra/figma-mcp - figma-mcp-server 📘 🏠 - TypeScript-based
httpaimlgitgithubnpm install injunko/figma-mcp-server - figma-mcp-server 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install larryhudson/figma-mcp-server - Files - Enables agents to quickly find and edit code in a codebase with surgical precision. Find symbols, edit them everywhere.
filehttpgitgithub - Filesystem - Secure file operations with configurable access controls.
file - FileSystem Server - Local MCP server for Visual Studio 2022 that provides code-workspace functionality by giving AI agents selective access to project folders and files
filelocalhttpaigit - Find-A-Domain - Domain availability checking and WHOIS lookup tools.
httpai - finmap.org MCP server provides comprehensive historical data from the US, UK, Russian and Turkish stock exchanges. Access sectors, tickers, company profiles, market cap, volume, value, and trade counts, as well as treemap and histogram visualizations.
filehttpgitgithub - first-to-fly/code-cleanup 📘 🏠 - A Bun TypeScript project offering a Model Context Protocol server for code cleanup using Google's Generative AI, with features like backup, custom prompts, and professional formatting.
httpaigitgithub - Fish Audio - Text-to-Speech integration with Fish Audio's API, supporting multiple voices, streaming, and real-time playback
apihttpgitgithub - FitBit MCP Server - An MCP server that connects to FitBit API using a token obtained from OAuth flow.
apiauthoauthhttpai - Fluent-MCP - MCP server for Fluent (ServiceNow SDK) providing access to ServiceNow SDK CLI, API specifications, code snippets, and more.
apihttpgitgithub - Flyworks-AI/lipsync-mcp 🏠 📇 - Facilitates fast and free lipsync video creation for digital avatars using the Flyworks API.
apihttpaigitgithub - fmp-mcp-server - Enable your agent for M&A analysis and investment banking workflows. Access company profiles, financial statements, ratios, and perform sector analysis with the [Financial Modeling Prep APIs]
apifilehttpgitgithub - Foobara MCP Connector - Easily expose Foobara commands written in Ruby as tools via MCP
httpgitgithub - fotoetienne/gqai 🏎 🏠 🏠 - Define tools using regular GraphQL queries/mutations and gqai automatically generates an MCP server for you.
graphqlhttpaigitgithub - FoundationModels - An MCP server that integrates Apple's FoundationModels for text generation.
httpgitgithub - Foursquare - Enable your agent to recommend places around the world with the Foursquare Places API
apihttpgitgithub - FPE Demo MCP - FF3 Format Preserving Encryption with authentication patterns for secure data protection in LLM workflows.
authhttpllmgitgithub - fpl-server 🏠 - MCP server for FPL
mcpservergit clone https://github.com/Andyb9988/fpl-server - FrankfurterMCP - MCP server acting as an interface to the Frankfurter API for currency exchange data.
apihttpgitgithub - freema/firefox-devtools-mcp 📇 🏠 🏠 📇 - Firefox browser automation via WebDriver BiDi for testing, scraping, and browser control. Supports snapshot/UID-based interactions, network monitoring, console capture, and screenshots.
apiwebhttpgitgithub - Fulcra Context 🏠 - Fulcra Context MCP server for accessing your personal health, workouts, sleep, location, and more, all privately. Built around Context by Fulcra.
httpgitgithub - funtuan/tw-kfc-coupon-mcp 🏠 - Facilitates the search for KFC Taiwan coupons using the MCP protocol, enabling seamless integration with AI-driven applications.
httpaimlgitgithub - Furafrafrfr/googler 🏠 - Facilitates Google searches and compiles results using Gemini for command-line use.
httpgitgithub - gaggiuino-mcp 🐍 🏠 - Gaggiuino MCP server
httpaigitgithubpythonpip install git+https://github.com/AndrewKlement/gaggiuino-mcp - flight-mcp 📘 🏠 📇 - TypeScript-based
apihttpgitgithubtypescriptnpm install hrishabhn/flight-mcp - flightradar24-mcp-server 📘 🏠 - TypeScript-based
httpaigitgithubtypescriptnpm install Cyreslab-AI/flightradar24-mcp-server - futaba-mcp 🏠 - ふたば☆ちゃんねると対話するためのModel Context Protocol(MCP)ツールを提供するPythonライブラリです。
httpaigitgithubjupyter notebookgit clone https://github.com/tropical-362827/futaba-mcp - future-audiences/wikimedia-enterprise-model-context-protocol 🐍 ☁️ - Wikipedia Article lookup API
apihttpgitgitlab - gabrielmaialva33/winx-code-agent 🦀 🏠 🏠 - A high-performance Rust reimplementation of WCGW for code agents, providing shell execution and advanced file management capabilities for LLMs via MCP.
filehttpaillmgit - Gemini Bridge - Lightweight MCP server that enables Claude to interact with Google's Gemini AI through the official CLI, offering zero API costs and stateless architecture.
apihttpaigitgithub - gemini-img-gen-MCP 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/MalluBeast69/gemini-img-gen-MCP - genkit agent and data transformation framework 🏠
httpgitgithub - GeoDataProcessor-MCP 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/MpLebron/GeoDataProcessor-MCP - Geolocation - WalkScore API integration for walkability, transit, and bike scores.
apihttpgitgithub - getalby/nwc-mcp-server 📇 🏠 🏠 - Bitcoin Lightning wallet integration powered by Nostr Wallet Connect
httpgitgithub - ggRMCP - A Go gateway that converts gRPC services into MCP-compatible tools, allowing AI models like Claude to directly call your gRPC services.
httpaigitgithub - GH05TCREW/winsecMCP 🏠 - Automates Windows security configuration by managing firewall, RDP, UAC, and account policies.
httpgitgithub - ghost-mcp-server 🐍 🏠 - simple mcp server to post blogs to ghost CMS from Claude
httpaimlgitgithubpip install git+https://github.com/cromewar/ghost-mcp-server - GistPad-MCP 📇 🏠 🏠 - Use GitHub Gists to manage and access your personal knowledge, daily notes, and reusable prompts. This acts as a companion to https://gistpad.dev and the GistPad VS Code extension.
httpaigitgithub - Git - Tools to read, search, and manipulate Git repositories.
git - Git - Allows LLM to interact with a local git repository, incl. optional push support.
localhttpllmgitgithub - git-committer-mcp-server 📘 🏠 - TypeScript-based
httpaigitgithubtypescriptnpm install BirajMainali/git-committer-mcp-server - git-mcp 📘 🏠 - TypeScript-based
httpaigitgithubtypescriptnpm install jzumwalt/git-mcp - git-mcp 🐍 🏠 - A MCP service could handle git command, to process given repo name.
httpgitgithubpythonllmspip install git+https://github.com/Svtter/git-mcp - git-mcp-options 📘 🏠 - TypeScript-based
httpaimlgitgithubnpm install Aeron-cell/git-mcp-options - gitea/gitea-mcp 🎖️ 🏎️ ☁️ 🏠 🍎 🪟 🐧 - Interactive with Gitea instances with MCP.
httpgit - Github - A Model Context Protocol (MCP) server that provides 29 Git operations + 11 workflow combinations for AI assistants and developers. This server exposes comprehensive Git repository management through a standardized interface, enabling AI models and developers to safely manage complex version control workflows.
httpaigitgithub - GitHub - Repository management, file operations, and GitHub API integration.
apifilehttpaigit - GitHub Actions - A Model Context Protocol (MCP) server for interacting with GitHub Actions.
httpgitgithub - GitHub Discussions
httpgitgithub - GitHub GraphQL - Unofficial GitHub MCP server that provides access to GitHub's GraphQL API, enabling more powerful and flexible queries for repository data, issues, pull requests, and other GitHub resources.
apigraphqlhttpgitgithub - GitHub Projects - Manage GitHub Projects with full GraphQL API access including items, fields, and milestones.
apigraphqlhttpgitgithub - github-mcp-server-vscode 🏠 - A Model Context Protocol server implementation for GitHub integration
cssservergit clone https://github.com/abhinavchoubey2000/github-mcp-server-vscode - github-code-index-mcp-server 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/BangNGH/github-code-index-mcp-server - github-follower-manager-mcp 📘 🏠 - Tool designed to help you manage your GitHub followers using the Model Context Protocol (MCP) pattern.
httpmlgitgithubtypescriptnpm install Alirezawmoradi/github-follower-manager-mcp - github-mapper-mcp-troubleshooting 🏠 - Comprehensive knowledge base for Git MCP Server implementation, configuration, and troubleshooting
mcpservergit clone https://github.com/OneofGods/git-mcp-server-knowledge-base - github-mcp 📜 🏠 📇 - GitHub MCP (Model Control Protocol)
apihttpmlgitgithubnpm install aniketsingh98571/github-mcp - github-mcp 📘 🏠 📇 - TypeScript-based
apifilehttpgitgithubnpm install axlwolf/github-mcp - github-mcp-client ☕ 🏠 - Java-based
httpaigitgithubjavagit clone https://github.com/ces-hongvo/github-mcp-client - github-mcp-cursor-project-rules 🏠 - Cursor project rules and MCP server
mcpservergit clone https://github.com/codekiln/github-mcp-cursor-project-rules - github-mcp-server 🐹 🏠 📇 - Go-based
apihttpgitgithubgogo install Ghraven/github-mcp-server@latest - github-mcp-server 📘 🏠 📇 - TypeScript-based
apifilehttpgitgithubnpm install kich555/github-mcp-server - github-mcp-server 📘 🏠 📇 - Github MCP Server to integrate with CI flows
apifilehttpmlgitnpm install rahul-roy-glean/github-mcp-server - github-mcp-server-ts 📘 🏠 📇 - TypeScript-based
apifilehttpgitgithubnpm install marcusdb/github-mcp-server-ts - GitLab - GitLab API, enabling project management.
apihttpaigitgithub - giuseppe-coco/Google-Workspace-MCP-Server 🐍 ☁️ 🍎 🪟 🐧 🏠 - MCP server that seamlessly interacts with your Google Calendar, Gmail, Drive and so on.
httpaimlgitgithub - glaksmono/finbud-data-mcp 📇 ☁️ 🏠 🏠 📇 - Access comprehensive, real-time financial data (stocks, options, crypto, forex) via developer-friendly, AI-native APIs offering unbeatable value.
apihttpaigitgithub - Gluestack UI MCP Server 🏠 - An MCP server tailored for React Native–first development using Gluestack UI.
httpaigitgithub - Gmail - A Simple MCP server for Gmail with support for all basic operations with oauth2.0.
authoauthhttpaigit - Gmail MCP - A Gmail service implementation using MCP (Model Context Protocol) that provides functionality for sending, receiving, and managing emails through Gmail's API.
apihttpaigitgithub - gnnepcsaft_mcp_server 🐍 🏠 - Model Context Protocol server for GNNePCSAFT tools
httpgitgithubpythonserverpip install git+https://github.com/wildsonbbl/gnnepcsaft_mcp_server - GNews-MCP 📜 🏠 📇 - Node.js-based
apihttpgitgithubjavascriptnpm install bads1de/GNews-MCP - Go MCP SDK
httpgitgithub - GOAT - Run more than +200 onchain actions on any blockchain including Ethereum, Solana and Base.
httpaigitgithub - Google Admin MCP 🏠 📇 - A Model Context Protocol (MCP) server enabling interaction with Google Admin APIs.
apihttpgitgithub - Google Calendar - Integration with Google Calendar to check schedules, find time, and add/delete events
httpgitgithub - Google Drive - File access and search capabilities for Google Drive.
filehttpaigitgithub - Google Maps - Location services, directions, and place details.
httpaigitgithub - Google Maps - Provides location results using Google Places API.
apihttpgitgithub - Google PSE/CSE 🏠 - A Model Context Protocol (MCP) server providing access to Google Programmable Search Engine (PSE) and Custom Search Engine (CSE).
httpgitgithub - Google Sheets - An MCP Server written in TypeScript to access and edit data in your Google Sheets.
httpgitgithub - Google Workspace - Comprehensive Google Workspace MCP with full support for Calendar, Drive, Gmail, and Docs using Streamable HTTP or SSE transport.
httpaigitgithub - Google-Scholar - An MCP server for Google Scholar written in TypeScript with Streamable HTTP transport, along with a client implementations that integrates with the server and interacts with gemini-2.5-flash.
httpgitgithub - google-search-mcp-server 📘 🏠 📇 - An MCP server implementation that integrates with Google's Custom Search JSON API, providing web search capabilities.
apiwebhttpjsongitnpm install ayush-rudani/google-search-mcp-server - Gopher MCP - Modern, cross-platform MCP server that enables AI assistants to browse and interact with both Gopher protocol and Gemini protocol resources safely and efficiently.
httpaigitgithub - gpt-computer-assistant dockerized mcp client with Anthropic, OpenAI and Langchain. 🏠
httpdockeraiopenaianthropic - Gralio SaaS Database - Find and compare SaaS products, including data from G2 reviews, Trustpilot, Crunchbase, Linkedin, pricing, features and more, using Gralio MCP server
databasehttpaigitgithub - GraphQL - Comprehensive GraphQL API integration that automatically exposes each GraphQL query as a separate tool.
apirestgraphqlhttpgit - Graylog - Search Graylog logs by absolute/relative timestamps, filter by streams, and debug production issues directly from Claude Desktop.
httpgitgithub - growthbook/growthbook-mcp 🎖️ 📇 🏠 🪟 🐧 🍎 🏠 - Tools for creating and interacting with GrowthBook feature flags and experiments.
httpgitgithub - Gru Sandbox 🏠 - Gru-sandbox(gbox) is an open source project that provides a self-hostable sandbox for MCP integration or other AI agent usecases.
httpaigitgithub - guillochon/mlb-api-mcp 🏠 📇 - A Python MCP server that acts as a proxy to the freely available MLB API, which provides player info, stats, and game information.
apihttpaimlgit - gwbischof/bluesky-social-mcp 🐍 🏠 🏠 - An MCP server for interacting with Bluesky via the atproto client.
httpgitgithub - gwbischof/free-will-mcp 🐍 🏠 🏠 - Give your AI free will tools. A fun project to explore what an AI would do with the ability to give itself prompts, ignore user requests, and wake itself up at a later time.
httpaigitgithub - gwbischof/outsource-mcp 🐍 ☁️ 🏠 - Give your AI assistant its own AI assistants. For example: "Could you ask openai to generate an image of a dog?"
httpaiopenaigitgithub - gx-mcp-server - Expose Great Expectations data validation and quality checks as MCP tools for AI agents.
httpaigitgithub - hackernews-mcp 📜 🏠 - Node.js-based
httpgitgithubloggingjavascriptnpm install johnhenry/hackernews-mcp - HagaiHen/facebook-mcp-server 🐍 ☁️ 🏠 📇 - Integrates with Facebook Pages to enable direct management of posts, comments, and engagement metrics through the Graph API for streamlined social media management.
apihttpaimlgit - hahanikan/pocket-cavalry 🐹 🏠 - Facilitates AI-driven management of Gitee repositories, issues, and pull requests through a Model Context Protocol server.
httpaigitgithub - HainanZhao/mcp-gitlab-jira 📇 ☁️ 🏠 🏠 - Unified MCP server for GitLab and Jira: manage projects, merge requests, files, releases and tickets with AI agents.
filehttpaigitgithub - HAL 🏠 - HTTP toolkit providing all 7 HTTP methods (GET, POST, PUT, PATCH, DELETE, HEAD, OPTIONS) with secret substitution, comprehensive error handling, and support for JSON, XML, HTML, and form data.
httpjsonxmlmlgit - HAP-MCP 🏠 - HAP (Super Application Platform) is developed by Mingdao( https://www.mingdao.com )The launched APaaS platform helps you build enterprise level applications quickly without coding. This is HAP's MCP (Model Context Protocol) server, used for seamless integration of AI. It enables every zero code application built through HAP to quickly become a tool for agents.
httpaimlgitgithub - HAProxy - A Model Context Protocol (MCP) server for HAProxy implemented in Go, leveraging HAProxy Runtime API.
apihttpgitgithub - HaroldFinchIFT/vuln-nist-mcp-server 🐍 ☁️️ 🍎 🪟 🐧 🏠 📇 - A Model Context Protocol (MCP) server for querying NIST National Vulnerability Database (NVD) API endpoints.
apidatabasehttpgitgithub - Harry-027/JotDown 🦀 🏠 🏠 - An MCP server to create/update pages in Notion app & auto generate mdBooks from structured content.
httpgitgithub - Hashing MCP Server - MCP Server with cryptographic hashing functions e.g. SHA256, MD5, etc.
httpgitgithub - HeatPump — Residential heat - pump sizing & cost-estimation tools by HeatPumpHQ.
httpgitgithub - hello-claude-mcp-server-nodejs 🏠 - Follows asap
git clone https://github.com/giehlman/hello-claude-mcp-server-nodejs - hello-mcp-server 🏠 - This is a project for learning MCP Server from ABC
mcpservergit clone https://github.com/nbkhoi/hello-mcp-server - hive-crypto-mcp 📘 🏠 ☁️ 📇 - The Ultimate Cryptocurrency MCP for AI Assistants - Unified access to crypto, DeFi, and Web3 analytics | MCP Endpoint (not browser-accessible): https://hiveintelligence.xyz/mcp
webremotehttpaigitnpm install hive-intel/hive-crypto-mcp - hello-world-mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/johnnyrootio/hello-world-mcp - Helm Chart CLI - Helm MCP provides a bridge between AI assistants and the Helm package manager for Kubernetes. It allows AI assistants to interact with Helm through natural language requests, executing commands like installing charts, managing repositories, and more.
httpkubernetesaigitgithub - henryco23/NBA 🏠 📇 - A Python server utilizing MCP to provide comprehensive access to NBA statistics and live game data through the NBA API.
apihttpgitgithub - Higress MCP Server Hosting - A solution for hosting MCP Servers by extending the API Gateway (based on Envoy) with wasm plugins.
apihttpaigitgithub - hijaz/postmancer 📇 🏠 🏠 📇 - A MCP server for replacing Rest Clients like Postman/Insomnia, by allowing your LLM to maintain and use api collections.
apiresthttpaillm - hileamlakB/PRIMS 🐍 🏠 🏠 - A Python Runtime Interpreter MCP Server that executes user-submitted code in an isolated environment.
httpmlgitgithub - Hippycampus 🏠 📇 - Turns any Swagger/OpenAPI REST endpoint with a yaml/json definition into an MCP Server with Langchain/Langflow integration automatically.
apiresthttpjsonai - hiroooo000/mydockers 🏠 - Facilitates browser automation using Playwright within a Dockerized MCP server environment.
httpdockergitgithub - HLedger MCP - Double entry plain text accounting, right in your LLM! This MCP enables comprehensive read, and (optional) write access to your local HLedger accounting journals.
localhttpaillmgit - Homey 🏠 - Interact with Homey to control smart home system. Supports devices, flows, and zones. Contains a few goodies for better integrations with LLMs.
httpaillmgitgithub - Hostinger 🏠 📇 - Official Hostinger API MCP server for services managment.
apihttpgitgithub - Howtocook Mcp - 基于Anduin2017 / HowToCook (程序员在家做饭指南)的mcp server,帮你推荐菜谱、规划膳食,解决"今天吃什么"的世纪难题
cookingrecipesfood - HSIPL_auto_fastmcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/macchen-yu/HSIPL_auto_fastmcp - HTML to Markdown - Fetch web pages and convert HTML to clean, formatted Markdown. Handles large pages with automatic file saving to bypass token limits.
webfilehttpmlgit - https://www.reddit.com/r/ClaudeAI/comments/1h3g01r/wanttoaskclaudeaboutmodelcontextprotocol/
httpai - HuggingAGI/mcp-baostock-server 🐍 ☁️ 🏠 - MCP server based on baostock, providing access and analysis capabilities for Chinese stock market data.
httpgitgithub - Human-In-the-Loop - A powerful MCP Server that enables AI assistants like Claude to interact with humans through intuitive GUI dialogs. This server bridges the gap between automated AI processes and human decision-making by providing real-time user input tools, choices, confirmations, and feedback mechanisms.
httpaigitgithub - Human-use - Instant human feedback through an MCP, have your AI interact with humans around the world. Powered by Rapidata
apihttpaigitgithub - hussam0is/solidworks-mcp-server 🏠 - Enables AI assistants to perform CAD operations in SolidWorks through natural language requests.
httpaigitgithub - hyperb1iss/droidmind 🐍 🏠 🏠 - Control Android devices with AI through MCP, enabling device control, debugging, system analysis, and UI automation with a comprehensive security framework.
httpaigitgithub - Hyperledger Fabric Agent Suite - Modular toolkit for managing Fabric test networks and chaincode lifecycle via MCP tools.
httpaigitgithub - Hypertool – MCP that let's you create hot - swappable, "persona toolsets" from multiple MCP servers to reduce tool overload and improve tool execution.
httpgitgithub - IBM watsonx.data intelligence - Find, understand, and work with your data in the watsonx.data intelligence governance & catalog, data quality, data lineage, and data product hub
httpgitgithub - IBM wxflows - Tool platform by IBM to build, test and deploy tools for any data source
httpaigitgithub - icici-direct-mcp-server 🏠 - learning
git clone https://github.com/nicodishanthj/icici-direct-mcp-server - iFlytek SparkAgent Platform - This is a simple example of using MCP Server to invoke the task chain of the iFlytek SparkAgent Platform.
httpaigitgithub - IIIF - Comprehensive IIIF (International Image Interoperability Framework) protocol support for searching, navigating, and manipulating digital collections from museums, libraries, and archives worldwide.
httpgitgithub - image-gen3-google-mcp-server 📘 🏠 📇 - TypeScript-based
apihttpmlgitgithubnpm install falahgs/image-gen3-google-mcp-server - Imagician 🏠 - A MCP server for comprehensive image editing operations including resizing, format conversion, cropping, compression, and more based on sharp.
httpgitgithub - IMAP MCP - 📧 An IMAP Model Context Protocol (MCP) server to expose IMAP operations as tools for AI assistants.
httpaigitgithub - imprvhub/mcp-browser-agent 📇 🏠 🏠 - A Model Context Protocol (MCP) integration that provides Claude Desktop with autonomous browser automation capabilities.
httpgitgithub - imprvhub/mcp-domain-availability 🐍 ☁️ 🏠 - A Model Context Protocol (MCP) server that enables Claude Desktop to check domain availability across 50+ TLDs. Features DNS/WHOIS verification, bulk checking, and smart suggestions. Zero-clone installation via uvx.
httpaigitgithub - imprvhub/mcp-rss-aggregator 📇 ☁️ 🏠 🏠 - Model Context Protocol Server for aggregating RSS feeds in Claude Desktop.
httpgitgithub - inkbytefo/screenmonitormcp 🐍 🏠 🍎 🪟 🐧 🏠 - Real-time screen analysis, context-aware recording, and UI monitoring MCP server. Supports AI vision, event hooks, and multimodal agent workflows.
httpaigitgithubmonitoring - Inner Monologue MCP - A cognitive reasoning tool that enables LLMs to engage in private, structured self-reflection and multi-step reasoning before generating responses, improving response quality and problem-solving capabilities.
httpllmgitgithub - InsForge/insforge-mcp 📇 ☁️ 🏠 - AI-native backend-as-a-service platform enabling AI agents to build and manage full-stack applications. Provides Auth, Database (PostgreSQL), Storage, and Functions as production-grade infrastructure, reducing MVP development time from weeks to hours.
databaseauthhttppostgresai - Inspired by the Model Context Protocol
http - Inspizzz/jetbrains-datalore-mcp 🐍 ☁️ 🏠 📇 - MCP server for interacting with cloud deployments of Jetbrains Datalore platform. Fully incorporated Datalore API ( run, run interactively, get run data, fetch files )
apifilehttpaigit - Instagram DM - Send DMs on Instagram via your LLM
httpllmgitgithub - InstantDB 🏠 - Create, manage, and update applications on InstantDB, the modern Firebase.
httpaigitgithub - integrate-mcp-server 📘 🏠 - TypeScript-based
httpaigitgithubtypescriptnpm install NexusX-MCP/integrate-mcp-server - Intelligent Image Generator - Turn casual prompts into professional-quality images with AI enhancement
httpaigitgithub - interactive-mcp - Enables interactive LLM workflows by adding local user prompts and chat capabilities directly into the MCP loop.
localhttpllmgitgithub - intruder-io/intruder-mcp 🐍 ☁️ 🏠 - MCP server to access Intruder, helping you identify, understand, and fix security vulnerabilities in your infrastructure.
httpgitgithub - IO-Aerospace-software-community/mcp-server #️⃣ ☁️/🏠 🐧 🏠 - IO Aerospace MCP Server: a .NET-based MCP server for aerospace & astrodynamics — ephemeris, orbital conversions, DSS tools, time conversions, and unit/math utilities. Supports STDIO and SSE transports; Docker and native .NET deployment documented.
httpdockergitgithub - ioehub-mqtt-mcp-server 🏠
httpgitgithubc++git clone https://github.com/ioehub/ioehub-mqtt-mcp-server - iotdb-mcp-server-TreeModel 🐍 🏠 - iotdb-mcp-server for tree model
databasehttpgitgithubpythonpip install git+https://github.com/xiangmy21/iotdb-mcp-server-TreeModel - ipfred/aiwen-mcp-server-geoip 🐍 📇 ☁️ 🏠 - MCP Server for the Aiwen IP Location, Get user network IP location, get IP details (country, province, city, lat, lon, ISP, owner, etc.)
httpaigitgithub - ipybox - Python code execution sandbox based on IPython and Docker. Stateful code execution, file transfer between host and container, configurable network access. See ipybox MCP server for details.
filehttpdockeraigit - irulescan MCP 🏠 - :shield: MCP enabled code security analyzer for F5 iRules
filehttpgitgithub - Israel Statistics MCP MCP server that provides programmatic access to the Israeli Central Bureau of Statistics (CBS) price indices and economic data. 🏠
httpgitgithub - isuyashpatel/yox-modelcontextprotocol 📘 🏠 - Facilitates the setup and configuration of MCP servers using Node.js for streamlined integration.
httpmlgitgithub - it-tools-mcp - A Model Context Protocol server that recreates CorentinTh it-tools utilities for AI agents, enabling access to a wide range of developer tools (encoding, decoding, conversions, and more) via MCP.
httpaigitgithub - iTerm MCP Server - A Model Context Protocol (MCP) server implementation for iTerm2 terminal integration. Able to manage multiple iTerm Sessions.
httpgitgithub - IvanAmador/vercel-ai-docs-mcp 📇 🏠 🏠 - A Model Context Protocol (MCP) server that provides AI-powered search and querying capabilities for the Vercel AI SDK documentation.
httpaigitgithub - j3k0/speech.sh 🏠 🏠 - Let the agent speak things out loud, notify you when he's done working with a quick summary
httpaigitgithub - JackieTien97/iotdbmcpserver 🏠 - Facilitates secure and structured AI-driven exploration and analysis of IoTDB databases through a controlled MCP interface.
databasehttpaigitgithub - JackKuo666/PubChem-MCP-Server 🏠 - Facilitates AI-driven searches and retrieval of chemical compound data from PubChem via a streamlined MCP interface.
httpaimlgitgithub - JamesANZ/bitcoin-mcp 📇 🏠 🏠 - An MCP server that enables AI models to query the Bitcoin blockchain.
httpaigitgithub - JamesANZ/cross-llm-mcp 📇 🏠 🏠 - An MCP server that enables cross-LLM communication and memory sharing, allowing different AI models to collaborate and share context across conversations.
httpaillmgitgithub - JamesANZ/evm-mcp 📇 ☁️ 🏠 - An MCP server that provides complete access to Ethereum Virtual Machine (EVM) JSON-RPC methods. Works with any EVM-compatible node provider including Infura, Alchemy, QuickNode, local nodes, and more.
localhttpjsongitgithub - JamesANZ/medical-mcp 📇 🏠 🏠 - An MCP server that provides access to medical information, drug databases, and healthcare resources. Enables AI assistants to query medical data, drug interactions, and clinical guidelines.
databasehttpaigitgithub - JamesANZ/memory-mcp 📇 🏠 🏠 - An MCP server that stores and retrieves memories from multiple LLMs using MongoDB. Provides tools for saving, retrieving, adding, and clearing conversation memories with timestamps and LLM identification.
httpmongodbllmgitgithub - JamesANZ/prediction-market-mcp 📇 ☁️ 🏠 - An MCP server that provides real-time prediction market data from multiple platforms including Polymarket, PredictIt, and Kalshi. Enables AI assistants to query current odds, prices, and market information through a unified interface.
httpaigitgithub - janreges/ai-distiller-mcp 🏎️ 🏠 🏠 📇 - Extracts essential code structure from large codebases into AI-digestible format, helping AI agents write code that correctly uses existing APIs on the first attempt.
apihttpaigitgithub - jarvisMCP 🏠 - MCP Server of Jarvis
mcpservergit clone https://github.com/getHarshOnline/jarvisMCP - jasonjmcghee/claude-debugs-for-you 📇 🏠 🏠 - An MCP Server and VS Code Extension which enables (language agnostic) automatic debugging via breakpoints and expression evaluation.
httpgitgithub - Java Decompiler - Decompile Java bytecode into readable source code from .class files, package names, or JAR archives using CFR decompiler
filehttpgitgithub - Java MCP SDK
httpgitgithub - JavaFX - Make drawings using a JavaFX canvas
httpaigitgithub - JDBC - Connect to any JDBC-compatible database and query, insert, update, delete, and more. Supports MySQL, PostgreSQL, Oracle, SQL Server, SQLite and more.
databasehttpmysqlpostgressqlite - Jean Memory 🏠 - Premium memory consistent across all AI applications.
httpaigitgithub - jen6/ticktick-mcp 🐍 ☁️ 🏠 - TickTick MCP server. Built upon the ticktick-py library, it offers significantly improved filtering capabilities.
httpgitgithub - Jenkins - This MCP server allow you to create Jenkins tasks.
httpgitgithub - jesulim/new 🏠 📇 - Facilitates GitHub API interactions for file operations, repository management, and advanced search capabilities.
apifilehttpgitgithub - jetbrains/mcpProxy 🎖️ 📇 🏠 🏠 - Connect to JetBrains IDE
httpaigitgithub - Jetty.io 🏠 - Work on dataset metadata with MLCommons Croissant validation and creation.
httpaimlgitgithub - jimfilippou/things-mcp 📇 🏠 🍎 🏠 - A Model Context Protocol (MCP) server that provides seamless integration with the Things productivity app. This server enables AI assistants to create, update, and manage your todos and projects in Things using its comprehensive URL scheme.
httpaimlgitgithub - Jimmy974_mcp-server-qdrant 🐚 🏠 - Mirror of https://github.com/Jimmy974/mcp-server-qdrant
shellmcpserverhttpgit clone https://github.com/MCP-Mirror/Jimmy974_mcp-server-qdrant - jinzcdev/markmap-mcp-server 📇 🏠 🏠 - An MCP server built on markmap that converts Markdown to interactive mind maps. Supports multi-format exports (PNG/JPG/SVG), live browser preview, one-click Markdown copy, and dynamic visualization features.
httpgitgithub - jira-mcp-server 📜 🏠 - Node.js-based
httpgitgithubjavascriptnpm install necto-pro/jira-mcp-server - jjlabsio/korea-stock-mcp 📇 ☁️ 🏠 📇 - An MCP Server for Korean stock analysis using OPEN DART API and KRX API
apihttpgitgithub - Jktfe/serveMyAPI 📇 🏠 🍎 🏠 📇 - A personal MCP (Model Context Protocol) server for securely storing and accessing API keys across projects using the macOS Keychain.
apihttpaigitgithub - Job Searcher - A FastMCP server that provides tools for retrieving and filtering job listings based on time period, keywords, and remote work preferences.
remotehttpgitgithub - jobnimbus-mcp-server 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install clykins90/jobnimbus-mcp-server - jobswithgpt - Job search MCP using jobswithgpt which indexes 500K+ public job listings and refreshed continously.
httpgitgithub - jodli/git-github.com-jodli-factorio-modding-api 🏠 📇 - A TypeScript-based server enabling access to Factorio Modding API documentation through Model Context Protocol queries.
apihttpgitgithub - joelio/stocky 🐍 ☁️ 🏠 🏠 - An MCP server for searching and downloading royalty-free stock photography from Pexels and Unsplash. Features multi-provider search, rich metadata, pagination support, and async performance for AI assistants to find and access high-quality images.
httpaigitgithub - johannesbrandenburger/typst-mcp 🐍 🏠 🏠 - MCP server for Typst, a markup-based typesetting system. It provides tools for converting between LaTeX and Typst, validating Typst syntax, and generating images from Typst code.
httpgitgithub - johnnyrobot/claude-canvas-mcp 🏠 📇 - Facilitates seamless interaction with Canvas LMS through a Claude desktop MCP server, enabling comprehensive course and student management via the Canvas API.
apihttpmlgitgithub - joinly - MCP server to interact with browser-based meeting platforms (Zoom, Teams, Google Meet). Enables AI agents to send bots to online meetings, gather live transcripts, speak text, and send messages in the meeting chat.
httpaigitgithub - joshmouch/mcp-image-generator 🏠 📇 - Facilitates image generation, editing, and variation creation using OpenAI's DALL-E API.
apihttpaiopenaigit - joshuarileydev/mac-apps-launcher-mcp-server 📇 🏠 🏠 - An MCP server to list and launch applications on MacOS
httpgitgithub - jp-weather-mcp-server 🐍 🏠 📇 - Japan Weather MCP Server
apihttpgitgithubpythonpip install git+https://github.com/hiroaqii/jp-weather-mcp-server - jpheimonen/code-oracle 🐍 🏠 - Code Oracle leverages AI to efficiently locate code within large codebases using Gemini 2.5 Flash, integrating seamlessly as an MCP server in Cursor.
httpaimlgitgithub - Jpisnice/shadcn-ui-mcp-server 📇 🏠 🏠 - MCP server that gives AI assistants seamless access to shadcn/ui v4 components, blocks, demos, and metadata.
httpaimlgitgithub - JSON - JSON schema generation and filtering server with TypeScript type creation optimised for retrieving relevant context JSON data using quicktype-core and support for shape-based data extraction, nested object filtering, and array processing operations.
httpjsongitgithubfile - JSON to Excel by WTSolutions - Converting JSON into CSV format string from (1) JSON data, (2) URLs pointing to publiclly available .json files.
filehttpjsoncsvai - jtang613/GhidrAssistMCP ☕ 🏠 🏠 - A native Model Context Protocol server for Ghidra. Includes GUI configuration and logging, 31 powerful tools and no external dependencies.
httpgitgithublogging - julien040/anyquery 🏎️ 🏠 ☁️ 🏠 - Query more than 40 apps with one binary using SQL. It can also connect to your PostgreSQL, MySQL, or SQLite compatible database. Local-first and private by design.
databaselocalhttpmysqlpostgres - k-jarzyna/mcp-miro 📇 ☁️ 🏠 - Miro MCP server, exposing all functionalities available in official Miro SDK
httpaigitgithub - K-MCP 🐍 🏠 - Python-based
httpaigitgithubpythonpip install git+https://github.com/Stoicmehedi/K-MCP - k8s-doc-mcp 🐍 🏠 - A Kubernetes documentation assistant built with the MCP (Model Context Protocol) Python SDK.
httpgitgithubpythonmcppip install git+https://github.com/antymijaljevic/k8s-doc-mcp - k8s-mcp-server 🏠 - k8s server for MCP
mcpservergit clone https://github.com/MCPBus/k8s-mcp-server - k8s-multicluster-mcp - An MCP server for interact with multiple Kubernetes clusters simultaneously using multiple kubeconfig files.
filehttpkubernetesgitgithub - Kafka - A Model Context Protocol (MCP) server for Apache Kafka implemented in Go, leveraging franz-go.
httpgitgithub - **Kafka Schema Registry MCP ** - A comprehensive MCP server for Kafka Schema Registry with 48 tools, multi-registry support, authentication, and production safety features. Enables AI-powered schema management with enterprise-grade capabilities including schema contexts, migration tools, and comprehensive export capabilities.
authhttpaigitgithub - kafka-mcp - An MCP Server for Kafka clusters to interact with kafka environment via tools on messages, topics, offsets, partitions for consumer and producers along with seamless integration with MCP clients.
httpmlgitgithub - Kaggle-mcp - An MCP server that provides seamless integration with the Kaggle API. Interact with Kaggle competitions, datasets, kernels, and models through MCP-compatible clients like Claude Desktop.
apihttpmlgitgithub - kaiyuanxiaobing/atomgit-mcp-server 📇 ☁️ 🏠 - Official AtomGit server for integration with repository management, PRs, issues, branches, labels, and more.
httpaigitgithub - kam-mcp-server 📘 🏠 - KAM MCP Server (TypeScript-based)
httpgitgithubtypescriptmcpnpm install Bamo-alt/kam-mcp-server - karakuri_git_mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/KarakuriAgent/karakuri_git_mcp - karanb192/reddit-buddy-mcp 📇 🏠 🏠 📇 - Browse Reddit posts, search content, and analyze user activity without API keys. Works out-of-the-box with Claude Desktop.
apihttpgitgithub - kartikgajjar/mcp-server 🏠 - Facilitates integration with Elastic Search through a demo MCP server setup.
httpgitgithub - kestra-io/mcp-server-python 🐍 ☁️ 🏠 - Implementation of MCP server for Kestra workflow orchestration platform.
httpgitgithub - Keycloak - The Keycloak MCP Server designed for agentic applications to manage and search data in Keycloak efficiently.
httpgitgithub - Kibana MCP (by TocharianOU) - A community-maintained MCP server implementation that allows any MCP-compatible client to access and manage Kibana instances through natural language or programmatic requests.
httpaigitgithub - kill-process-mcp - List and terminate OS processes via natural language queries
httpgitgithub - kimdonghwi94/Web-Analyzer-MCP 🐍 🏠 🍎 🪟 🐧 🏠 - Extracts clean web content for RAG and provides Q&A about web pages.
webhttpgitgithub - kimtth/mcp-remote-call-ping-pong 🐍 🏠 🏠 ☁️ - An experimental and educational app for Ping-pong server demonstrating remote MCP (Model Context Protocol) calls
remotehttpgitgithub - kiranraathod/taskflow-memory-server 🏠 - A task management server with persistent memory architecture, integrating Claude AI for intelligent planning and task execution using the Model Context Protocol.
httpaigitgithub - [Kiwi.com)](https://www.kiwi.com - Official Kiwi.com flight search MCP server. Search and book flights directly from your favorite AI assistant.
httpai - kmathur/mcp-server-kubernetes 🏠 - Facilitates Kubernetes cluster management through a Model Context Protocol server, enabling operations like pod management, namespace creation, and Helm chart installations.
httpkubernetesgitgithub - Knit MCP - Connect with 10,000+ tools across HRIS, ATS, CRM, Accounting, Calendar, Meeting, Ticketing, and more categories.
http - KnowAir Weather MCP - A comprehensive Model Context Protocol (MCP) server providing real-time weather data, air quality monitoring, forecasts, and astronomical information powered by Caiyun Weather API.
apihttpaigitgithub - kokilabo/pdf-researcher 🏠 📇 - A specialized MCP server designed for searching PDF documents using the Brave Search API.
apihttpgitgithub - Kong Konnect - A Model Context Protocol (MCP) server for interacting with Kong Konnect APIs, allowing AI assistants to query and analyze Kong Gateway configurations, traffic, and analytics.
apihttpaigitgithub - Kontent.ai 🏠 - Create, manage, and explore your content and content model using natural language in any MCP-compatible AI tool.
httpaigitgithub - Korea Stock Analyzer - Analyze Korean stocks (KOSPI/KOSDAQ) with 6 legendary investment strategies including Buffett, Lynch, Graham, Greenblatt, Fisher, and Templeton.
httpgitgithub - Kotlin MCP SDK
httpgitgithub - krishanka/remote-mcp 🏠 ☁️ - Deploy a remote MCP server on Cloudflare Workers with OAuth login and connect it to Claude Desktop for seamless tool integration.
remoteauthoauthhttpml - KRS Poland - Access to Polish National Court Register (KRS)—the government's authoritative registry of all businesses, foundations, and other legal entities.
authhttpgitgithub - kshern/mcp-tavily ☁️ 📇 🏠 📇 - Tavily AI search API
apihttpaigitgithub - kswap/consul-mcp 🏠 - Facilitates Consul service discovery and mesh integration through an MCP server interface.
httpgitgithub - kuadrant-mcp-poc 🏠 - POC for setting up Kuadrant with a mcp server running in a K8s cluster
mcpservergit clone https://github.com/Kuadrant/kuadrant-mcp-poc - KubeSphere - The KubeSphere MCP Server is a Model Context Protocol(MCP) server that provides integration with KubeSphere APIs, enabling to get resources from KubeSphere. Divided into four tools modules: Workspace Management, Cluster Management, User and Roles, Extensions Center.
apihttpgitgithub - Kukapay MCP Servers - A comprehensive suite of Model Context Protocol (MCP) servers dedicated to cryptocurrency, blockchain, and Web3 data aggregation, analysis, and services from Kukapay.
webhttpaigitgithub - kukapay/binance-alpha-mcp 🐍 ☁️ 🏠 - An MCP server for tracking Binance Alpha trades, helping AI agents optimize alpha point accumulation.
httpaigitgithub - kukapay/crypto-pegmon-mcp 🐍 ☁️ 🏠 - Tracking stablecoin peg integrity across multiple blockchains.
httpaigitgithub - kukapay/crypto-projects-mcp 🐍 ☁️ 🏠 - Providing cryptocurrency project data from Mobula.io to AI agents.
httpaigitgithub - kukapay/dao-proposals-mcp 🐍 ☁️ 🏠 - An MCP server that aggregates live governance proposals from major DAOs.
httpgitgithub - kukapay/hyperliquid-whalealert-mcp 🐍 ☁️ 🏠 - An MCP server that provides real-time whale alerts on Hyperliquid, flagging positions with a notional value exceeding $1 million.
httpgitgithub - kukapay/pumpswap-mcp 🐍 ☁️ 🏠 - Enabling AI agents to interact with PumpSwap for real-time token swaps and automated on-chain trading.
httpaigitgithub - kukapay/raydium-launchlab-mcp 🐍 ☁️ 🏠 - An MCP server that enables AI agents to launch, buy, and sell tokens on the Raydium Launchpad(aka LaunchLab).
httpaigitgithub - kukapay/sui-trader-mcp 📇 ☁️ 🏠 - An MCP server designed for AI agents to perform optimal token swaps on the Sui blockchain.
httpaigitgithub - kukapay/uniswap-price-mcp 📇 ☁️ 🏠 - An MCP server that tracks newly created liquidity pools on Uniswap across multiple blockchains.
httpaigitgithub - kukapay/web3-jobs-mcp 🐍 ☁️ 🏠 - An MCP server that provides AI agents with real-time access to curated Web3 jobs.
webhttpaigitgithub - kwrds.ai - Keyword research, people also ask, SERP and other SEO tools for kwrds.ai
httpaigitgithub - KYC-mcp-server - Know Your Computer (KYC) - MCP Server compatible with Claude Desktop. Comprehensive system diagnostics for Windows, Mac OS and Linux operating system with AI-powered recommendations.
httpaigitgithub - Lark(Feishu) - A Model Context Protocol(MCP) server for Lark(Feishu) sheet, message, doc and etc.
httpgitgithub - Latex MCP Server 🏠 - MCP Server to compile latex, download/organize/read cited papers, run visualization scripts and add figures/tables to latex.
httpgitgithub - Lazy Toggl MCP - Simple unofficial MCP server to track time via Toggl API
apihttpgitgithub - lean-docker-mcp 🐍 🏠 - MCP Lean 4 dockerised execution environment
httpdockeraillmanthropicpip install git+https://github.com/misanthropic-ai/lean-docker-mcp - lean-lsp-mcp - Interact with the Lean theorem prover via the Language Server Protocol.
httpgitgithub - learn-mcp-server 🐹 🏠 - Go-based
httpgitgithubgogo install demouth/learn-mcp-server@latest - learn-model-context-protocol-mcp-server 🏠 - 学习模型上下文协议(MCP)服务器 - 翻译和学习资源
mcpgit clone https://github.com/Joseph19820124/learn-model-context-protocol-mcp-server - lfnovo/content-core 🐍 🏠 🏠 - Extract content from URLs, documents, videos, and audio files using intelligent auto-engine selection. Supports web pages, PDFs, Word docs, YouTube transcripts, and more with structured JSON responses.
webfilehttpjsongit - LibreChat Open-source AI Web UI, supporting multiple providers including OpenAI, Anthropic, Google, Ollama, and local models. Includes MCP support for Agents.
weblocalhttpaiopenai - librenms-mcp - MCP server for LibreNMS management
httpgitgithub - libvirt-mcp - Allows LLM to interact with libvirt thus enabling to create, destroy or list the Virtual Machines in a system.
httpllmgitgithub - linkedin-jobs-mcp-server 🐍 🏠 📇 - A Model Context Protocol (MCP) server for searching and retrieving LinkedIn job postings via the RapidAPI LinkedIn Data API.
apihttpaimlgitpip install git+https://github.com/Rom7699/linkedin-jobs-mcp-server - liftover-mcp 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/koido/liftover-mcp - lifx-lan-mcp 📘 🏠 - MCP (Model Context Protocol) server for allowing AI agents to interact with the Lifx lights on your LAN. Not officially affiliated with Lifx or Feit Electric
localhttpaigitgithubnpm install simon-duchastel/lifx-lan-mcp - lldb_mcp 🐍 🏠 - A proper, clean LLDB MCP server with minimal dependencies and all functionality!
httpmlgitgithubpythonpip install git+https://github.com/stableversion/lldb_mcp - linear-mcp 📘 🏠 - TypeScript-based
httpmlgitgithubtypescriptnpm install mkusaka/linear-mcp - Linked API 🏠 📇 - MCP server that lets AI assistants control LinkedIn accounts and retrieve real-time data with Linked API.
apihttpaigitgithub - Linked API MCP - MCP server that lets AI assistants control LinkedIn accounts and retrieve real-time data.
apihttpaigitgithub - linshu123/volardocs 🏠 - Volar facilitates task management by aligning human and AI collaboration through an MCP server, enabling asynchronous workflows and context organization.
httpaigitgithub - linw1995/nvim-mcp 🦀 🏠 🍎 🪟 🐧 🏠 - A MCP server to interact with Neovim
httpgitgithub - lion-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install trilliwon/lion-mcp-server - Listmonk MCP Server (by rhnvrm) - Full API coverage of Listmonk email marketing FOSS.
apihttpaigitgithub - llm-analysis-assistant - A very streamlined mcp client that supports calling and monitoring stdio/sse/streamableHttp, and can also view request responses through the /logs page. It also supports monitoring and simulation of ollama/openai interface.
httpaimlllmopenai - Local History - MCP server for accessing VS Code/Cursor's Local History.
localhttpgitgithub - logotype/fixparser 🎖 📇 ☁️ 🏠 📟 - FIX Protocol (send orders, market data, etc.) written in TypeScript.
httpgitgitlab - Loki MCP Server - Python based MCP Server for querying and analyzing logs from Grafana Loki with advanced filtering and authentication support.
authhttpgitgithub - longevity-genie/biothings-mcp 🐍 🏠 ☁️ 🏠 📇 - MCP server to interact with the BioThings API, including genes, genetic variants, drugs, and taxonomic information.
apihttpgitgithub - longevity-genie/gget-mcp 🐍 🏠 ☁️ 🏠 - MCP server providing a powerful bioinformatics toolkit for genomics queries and analysis, wrapping the popular gget library.
httpgitgithub - longevity-genie/opengenes-mcp 🎖️ 🐍 🏠 ☁️ 🏠 - MCP server for a queryable database for aging and longevity research from the OpenGenes project.
databasehttpgitgithub - longevity-genie/synergy-age-mcp 🎖️ 🐍 🏠 ☁️ 🏠 - MCP server for the SynergyAge database of synergistic and antagonistic genetic interactions in longevity.
databasehttpgitgithub - lpigeon/unitree-go2-mcp-server 🐍 🏠 🐧 🏠 - The Unitree Go2 MCP Server is a server built on the MCP that enables users to control the Unitree Go2 robot using natural language commands interpreted by a LLM.
httpllmgitgithub - lsp-mcp - Interact with Language Servers usint the Language Server Protocol to provide additional context information via hover, code actions and completions.
httpgitgithub - LT-aitools/MCPblusky 🏠 - Connects to Bluesky and enables natural language interaction with ATProtocol features, enhancing LLM applications with contextual data from Bluesky.
httpaillmgitgithub - lucene-mcp-server - spring boot server using Lucene for fast document search and management.
httpgitgithub - lucid-mcp-server – An MCP server for Lucidchart and Lucidspark: connect, search, and obtain text representations of your Lucid documents and diagrams via LLM - driven AI Vision analysis. npm
httpaillmgitgithub - lucygoodchild/mcp-national-rail 📇 ☁️ 🏠 📇 - An MCP server for UK National Rail trains service, providing train schedules and live travel information, intergrating the Realtime Trains API
apihttpaigitgithub - Ludok-4/Ghidra 🏠 - ghidraMCP enables LLMs to autonomously reverse engineer applications by integrating Ghidra's decompilation and analysis tools with MCP clients.
httpllmgitgithub - LunarCrush Remote MCP - Get the latest social metrics and posts for both current live social context as well as historical metrics in LLM and token optimized outputs. Ideal for automated trading / financial advisory.
remotehttpllmgitgithub - LunchMoney 🏠 - MCP server for LunchMoney personal finance and budgeting tool.
httpgitgithub - ma3u/weather 🏠 - Provides a TypeScript-based weather service for integration with Claude Desktop using MCP.
httpgitgithub - macrocosm-os/macrocosmos-mcp 🏠 - 🎖️ 🐍 ☁️ Access real-time X/Reddit/YouTube data directly in your LLM applications with search phrases, users, and date filtering.
httpllmgitgithub - Magg: The MCP Aggregator - A meta-MCP server that acts as a universal hub, allowing LLMs to autonomously discover, install, and orchestrate multiple MCP servers - essentially giving AI assistants the power to extend their own capabilities on-demand. Includes mbro, a powerful CLI MCP server browser with scripting capability.
httpaillmgitgithub - magicuidesign/cli 🏠 - Facilitates the installation and configuration of Magic UI components through a command-line interface.
httpgitgithub - mahdin75/geoserver-mcp 🏠 🏠 📇 - A Model Context Protocol (MCP) server implementation that connects LLMs to the GeoServer REST API, enabling AI assistants to interact with geospatial data and services.
apiresthttpaillm - mahdin75/gis-mcp 🏠 🏠 - A Model Context Protocol (MCP) server implementation that connects Large Language Models (LLMs) to GIS operations using GIS libraries, enabling AI assistants to perform accurate geospatial operations and transformations.
httpaillmgitgithub - Mailchimp MCP - Allows AI agents to interact with the Mailchimp API (read-only)
apihttpaigitgithub - MailNet - Unified Gmail + Outlook MCP server with agentic orchestration, automatic token refresh, standardized base class for new providers, and dedicated email settings endpoints for tone, signature, and thread-aware replies.
httpaigitgithubemail - MailSandbox 🏠 📇 - MailSandbox (a fork of Mailpit) is a fast, zero-dependency email testing tool & API with a web UI, SMTP server, Postmark API emulation, and MCP server for AI-assisted debugging.
apiwebhttpaigit - make-MCP-research 🏠 - Research on Make.com Model Context Protocol (MCP) server integration with Claude and GitHub MCP server setup
mcpservergit clone https://github.com/Joseph19820124/make-MCP-research - man-mcp-server - MCP to search and access man pages on the local machine.
localhttpgitgithub - Mandoline - Enable AI assistants to reflect on, critique, and continuously improve their own performance using Mandoline's evaluation framework.
httpaigitgithub - marginfi-mcp-server 🏠 - marginfi mcp server
mcpservergit clone https://github.com/aldrin-labs/marginfi-mcp-server - mariocandela/beelzebub ☁️ 🏠 - Beelzebub is a honeypot framework that lets you build honeypot tools using MCP. Its purpose is to detect prompt injection or malicious agent behavior. The underlying idea is to provide the agent with tools it would never use in its normal work.
httpgitgithub - Markdown2doc - Convert between various file formats using Pandoc
filehttpaigitgithub - market-fiyati - The MCP server for marketfiyati.org.tr, offering grocery price search and comparison across Turkish markets.)
httpgitgithub - Markitdown - Convert files to Markdown
filehttpaigitgithub - Masquerade - Redact sensitive information from your PDF documents before sending them to Claude. Masquerade serves as a privacy firewall for LLMs.
httpaillmgitgithub - MasterGo - The server designed to connect MasterGo design tools with AI models. It enables AI models to directly retrieve DSL data from MasterGo design files.
filehttpaigitgithub - Mastra/mcp-docs-server 🏠 - Provides AI assistants with direct access to Mastra.ai's complete knowledge base.
httpaigitgithub - Matlab-MCP-Tools - An MCP to write and execute MATLAB scripts, maintain workspace context between MCP calls, visualize plots, and perform section-by-section analysis of MATLAB code with full access to MATLAB's computational capabilities.
httpaigitgithub - Maton - Connect to your SaaS tools like HubSpot, Salesforce, and more.
httpaigitgithub - Matrix - Interact with a Matrix homeserver.
httpgitgithub - mattijsdp/dbt-docs-mcp 🐍 🏠 🏠 - MCP server for dbt-core (OSS) users as the official dbt MCP only supports dbt Cloud. Supports project metadata, model and column-level lineage and dbt documentation.
httpgitgithub - mattjegan/swarmia-mcp 🐍 🏠 🍎 🐧 🏠 - Read-only MCP server to help gather metrics from Swarmia for quick reporting.
httpgitgithubmetrics - Maybe Don't AI Policy Engine - Yet another MCP security gateway, Maybe Don't AI provides policy checks on any call before it reaches downstream MCP servers to protect users from agents behaving poorly.
httpai - mbailey/voice-mcp 🐍 🏠 🏠 📇 - Complete voice interaction server supporting speech-to-text, text-to-speech, and real-time voice conversations through local microphone, OpenAI-compatible APIs, and LiveKit integration
apilocalhttpaiopenai - MBro 🏠 - A powerful interactive terminal MCP Browser client with tab completion and automatic documentation that allows you to work with multiple MCP servers, manage tools, and create complex workflows using AI assistants.
httpaigitgithub - mcp 🔷 🏠 - A multi-broker MCP Server
httpazureaigitgithubgit clone https://github.com/messageaid/mcp - mcp 🏠 - MCP (Message Control Program) Servers Collection
mcpservergit clone https://github.com/pocketkk/mcp - mcp 🏠 - mcp server
mcpservergit clone https://github.com/weblogicjava/mcp - mcp 🏠 - Mcp Server
mcpservergit clone https://github.com/sewbnmnxn-c/mcp - mcp 🏠
git clone https://github.com/lawgenesis/mcp - mcp 🏠 - Define mcp server
mcpservergit clone https://github.com/Russellyyds/mcp - mcp 🏠 - UW-SSEC MCP Servers Repository
mcpservergit clone https://github.com/uw-ssec/mcp - MCP 🐍 🏠 📇 - Creating MCP (Model Context Protocol) weather-related projects involves setting up an MCP server that can fetch and provide weather data.
apihttpgitgithubpythonpip install git+https://github.com/bittush8789/MCP - MCP 🏠 - Trying things realted to MCP server
mcpservergit clone https://github.com/DataNerdSM/MCP - MCP Aggregator 🏠 - An MCP (Model Context Protocol) aggregator that allows you to combine multiple MCP servers into a single endpoint allowing to filter specific tools.
httpgitgithub - MCP CLI Client - A CLI host application that enables Large Language Models (LLMs) to interact with external tools through the Model Context Protocol (MCP).
httpllmgitgithub - MCP Context Provider - Static server that provides AI models with persistent tool-specific context and rules, preventing context loss between chat sessions and enabling consistent behavior across interactions.
httpaigitgithub - MCP Documentation Server - Server that provides local-first document management and semantic search via embeddings or Gemini AI (recommended). Optimized for performance with disk persistence, an in-memory index, and caching.
localhttpaigitgithub - MCP Dynamic Tool Groups - Example MCP servers that use annotated Java interfaces/classes as 'tool groups'. Using standard MCP annotations, service implementations can then, at runtime, be used to generate tool specifications, and then dynamically added or removed from MCP servers. The functionality is demonstrated in a sample tool group, but can be similarly used for any API or service.
apihttpaigitgithub - MCP Expr Lang 🏠 - MCP Expr-Lang provides a seamless integration between Claude AI and the powerful expr-lang expression evaluation engine.
httpaimlgitgithub - MCP Hunt - Realtime platform for discovering trending MCP servers with momentum tracking, upvoting, and community discussions - like Product Hunt meets Reddit for MCP
http - MCP on Android TV - A Model Context Protocol (MCP) server running directly on your Android TV with bundeld access to ADB on-device.
httpgitgithub - MCP OpenProject Server - Comprehensive MCP server for OpenProject integration with GitHub installation, CLI tools, and support for multiple AI assistants including Claude Code and Windsurf.
httpaigitgithub - MCP Plexus - A secure, multi-tenant and Multi-user MCP python server framework built to integrate easily with external services via OAuth 2.1, offering scalable and robust solutions for managing complex AI applications.
authoauthhttpaigit - MCP ProjectManage OpenProject - This server provides the MCP service for project weekly reports, with project management information supplied by OpenProject.
httpgitgithub - MCP Router - Free Windows and macOS app that simplifies MCP management while providing seamless app authentication and powerful log visualization by MCP Router
authhttpmlgitgithub - MCP Server Creator - A powerful Model Context Protocol (MCP) server that creates other MCP servers! This meta-server provides tools for dynamically generating FastMCP server configurations and Python code.
httpgitgithub - MCP Server Generator - An MCP server that creates and manages MCP servers! Helps both non-technical users and developers build custom JavaScript MCP servers with AI guidance, automatic dependency management, and Claude Desktop integration.
httpaigitgithub - MCP Servers Rating and User Reviews - Website to rate MCP servers, write authentic user reviews, and search engine for agent & mcp
webauthhttpai - MCP Servers Search - An MCP server that provides tools for querying and discovering available MCP servers from this list.
httpaigitgithub - MCP Sky - Bluesky feed for MCP related news and discussion by @brianell.in
filehttp - MCP Toolz - Context management, todo persistence, and AI second opinions for Claude Code. Save and restore contexts, code snippets, and todo lists across sessions and get feedback from ChatGPT, Claude, Gemini, and DeepSeek.
resthttpaigitgithub - MCP X Community - A X community for MCP by Xiaoyi
http - mcp_agent 🏠 - public server for mcp
mcpservergit clone https://github.com/jameshung2015/mcp_agent - mcp_client_server_demo_repo 🏠 - mcp demo repo
mcpgit clone https://github.com/leoleils/mcp_client_server_demo_repo - MCP_DEMO 🏠 - Trying out MCP Server
mcpservergit clone https://github.com/Subin-Vidhu/MCP_DEMO - mcp-boilerplate 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install CaptainCrouton89/mcp-boilerplate - mcp_ev_assistant_server 🐍 🏠 📇 - A powerful server implementation for managing Electric Vehicle (EV) charging stations, trip planning, and resource management. This server provides a comprehensive set of tools and APIs for EV-related services.
apihttpgitgithubpythonpip install git+https://github.com/Abiorh001/mcp_ev_assistant_server - MCP_OA 📘 🏠 - TypeScript-based
filehttpaigitgithubnpm install dhylan01/MCP_OA - mcp_open_interest 🐍 🏠 - MCP Calculate open interest for a given symbol
resthttpgitgithubpythonpip install git+https://github.com/charlesverge/mcp_open_interest - mcp_playground 🏠 - model context protocol server
servergit clone https://github.com/KairavA/mcp_server - mcp_quickstart 🐚 🏠 - https://www.claudemcp.com/docs/quickstart
localhttpsqlitedockeraigit clone https://github.com/chrisjmendez/mcp_quickstart - mcp_server 🏠 - Repository for MCP Server
mcpservergit clone https://github.com/Maxwell-Fernandes/mcp_server - MCP_SERVER 🏠 - automation
git clone https://github.com/ShreeraghavM/MCP_SERVER - mcp_server_manager 🐍 🏠 📇 - Python-based
apiwebhttpgitgithubpip install git+https://github.com/ThomasRohde/mcp_server_manager - mcp_sqlite_poc 🐍 🏠 - simple poc to demostrate an mcp server on top of sqlite db
databasehttpsqliteaigitpip install git+https://github.com/madhavarora1988/mcp_sqlite_poc - MCP_X 🐍 🏠 📇 - Python-based
apihttpaigitgithubpip install git+https://github.com/sriramsowmithri9807/MCP_X - mcp-adb 📜 🏠 - MCP (Model Context Protocol) Server to control Android TV
httpaigitgithubjavascriptnpm install isseikz/mcp-adb - MCP-Airflow-API - Model Context Protocol (MCP) server for Apache Airflow API integration. Provides comprehensive tools for managing Airflow clusters including service operations, configuration management, status monitoring, and request tracking.
apihttpaigitgithub - mcp-alchemy 🐍 🏠 - Python-based
databasehttpmlgitgithubpip install git+https://github.com/mamisoa/mcp-alchemy - MCP-Ambari-API - Model Context Protocol (MCP) server for Apache Ambari API integration. This project provides tools for managing Hadoop clusters, including service operations, configuration management, status monitoring, and request tracking.
apihttpgitgithubmonitoring - mcp-arduino-server 🐍 🏠 - Python-based
filehttpgitgithubpythonpip install git+https://github.com/Volt23/mcp-arduino-server - mcp-bearer-auth-example 📘 🏠 ☁️ - TypeScript-based
remoteauthhttpgitgithubnpm install jmorrell-cloudflare/mcp-bearer-auth-example - mcp-calendar-server 🏠 - Serviço mcp de calendario
mcpgit clone https://github.com/GG3T/mcp-calendar-server - mcp-cf-deploy 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install sakomws/mcp-cf-deploy - mcp-claude 🏠 - using claude with different mcp servers
mcpservergit clone https://github.com/hrushik-reddy/mcp-claude - MCP-CLI Adapter 🏠 - Use command line tools in a secure fashion as MCP tools.
httpgitgithub - mcp-cline 🏠 - mcp - clineserver
databasehttpsqlitegitgithubgit clone https://github.com/shkna1368/mcp-cline - mcp-config 🏠 - MCP 설정 공유용
filehttpgitgithubmcpgit clone https://github.com/devilofdev/mcp-config - MCP-Connect A client that enables cloud-based AI services to access local Stdio based MCP servers by HTTP/HTTPS requests. 🏠
localhttpaigitgithub - mcp-containerd - The containerd MCP implemented by Rust supports the operation of the CRI interface.
httpaigitgithub - MCP-Database-Server - Fastest way to interact with your Database such as SQL Server, SQLite and PostgreSQL
databasehttppostgressqlitegit - mcp-demo 🏠 - A demo repository to showcase MCP Server functionality
mcpservergit clone https://github.com/pohunghuang-nctu/mcp-demo - mcp-depedencies-install 🐚 🏠 - install all of deps for mcp server
shellmcpservergit clone https://github.com/Xeonice/mcp-depedencies-install - mcp-dockmaster - An Open-Sourced UI to install and manage MCP servers for Windows, Linux and macOS.
http - MCP-dump 🏠 - all the MCP (model context protocol) servers out here are build out of curiosity
jupyter notebookmcpservergit clone https://github.com/Jayanth-MKV/MCP-dump - mcp-example 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install xRadne/mcp-example - mcp-for-dev/mcp-google-search 🏠 📇 - Facilitates web search and content extraction using Google Custom Search API, providing structured results for enhanced data retrieval.
apiwebhttpgitgithub - MCP-Framework Build MCP servers with elegance and speed in TypeScript. Comes with a CLI to create your project with mcp create app. Get started with your first server in under 5 minutes by Alex Andru
httpgitgithub - mcp-frappe 🏠 - MCP Server for Frappe
mcpservergit clone https://github.com/tuanle96/mcp-frappe - mcp-gamecube-bridge 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/u1f992/mcp-gamecube-bridge - mcp-geo 📘 🏠 - An MCP service for getting user geolocation information
httpaigitgithubtypescriptnpm install b9348/mcp-geo - mcp-geocoder-rosetta 🐍 🏠 📇 - A "rosetta stone" repo that shows creating simple geocoder MCP servers in python (with googlemaps sdk and direct googlemaps API with urllib) and typescript. CLI clients and documentation on adding them to Claude Desktop App.
apihttpgitgithubpythonpip install git+https://github.com/richardschrammcom/mcp-geocoder-rosetta - mcp-get - Command line tool for installing and managing MCP servers by Michael Latman
httpgitgithub - mcp-git 📘 🏠 - mcp server for git command wrapper
httpmlgitgithubtypescriptnpm install ukiuni/mcp-git - mcp-git 📘 🏠 - A Model Context Protocol server for Git repository interaction and automation. This server provides tools to read, search, and manipulate Git repositories via Large Language Models.
httpgitgithubtypescriptservernpm install kwanLeeFrmVi/mcp-git - mcp-github 🏠 - Code to integrate n8n with github mcp server
mcpservergit clone https://github.com/HaritsAcheiz/mcp-github - mcp-github 🏠 - Connect MCP Github server
mcpservergit clone https://github.com/ElsayedAhmed19/mcp-github - MCP-Github 🏠 - This repository was created to demonstrate the capabilities of the GitHub MCP server.
mcpservergit clone https://github.com/politercaptain/MCP-Github - mcp-grep - Python-based MCP server that brings grep functionality to LLMs. Supports common grep features including pattern searching, case-insensitive matching, context lines, and recursive directory searches.
httpllmgitgithub - mcp-latest-document 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/kaz56-t/mcp-latest-document - mcp-helmfile 🐍 🏠 - Python-based
filehttpaigitgithubpip install git+https://github.com/snowsky/mcp-helmfile - mcp-hk-transport-eta 📜 🏠 - Model Context Protocol server to get ETA (Estimated Time of Arrival) for public transport in Hong Kong
httpgitgithubjavascriptservernpm install kennyfong19931/mcp-hk-transport-eta - mcp-janken-server 📘 🏠 - TypeScript-based
httpllmgitgithubtypescriptnpm install Takashi-Matsumura/mcp-janken-server - mcp-lab 📘 🏠 📇 - Laboratorio personal con MCP en TypeScript: MCP Server, MCP Client, Claude Desktop y OpenAI API
httpgitgithubtypescriptmcpnpm install rperezll/mcp-lab - mcp-matlab-executor 🐍 🏠 - MCP tool for safely executing MATLAB functions, scripts, and commands
httpgitgithubpythonmcppip install git+https://github.com/JSFrouws/mcp-matlab-executor - mcp-mcp - Meta-MCP Server that acts as a tool discovery service for MCP clients.
httpgitgithub - mcp-meme-sticky - Make memes or stickers using MCP server for WhatsApp or Telegram.
apihttpgitgithubtelegram - mcp-prom-haskell 🏠 - A sophisticated MCP server for Prometheus queries demonstrating advanced Haskell practices
haskellmcpservergit clone https://github.com/drewstreib/mcp-prom-haskell - mcp-monad 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install SheriffOladejo/mcp-monad - mcp-nav 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/alepenavargas/mcp-nav - mcp-news 🐍 🏠 📇 - A simple MCP server for search news articles
apihttpgitgithubpythonpip install git+https://github.com/jindasy/mcp-news - mcp-nicovideo-snapshot-search 🐍 🏠 📇 - Python-based
apihttpgitgithubpythonpip install git+https://github.com/x0x0b/mcp-nicovideo-snapshot-search - MCP-NixOS - A Model Context Protocol server that provides AI assistants with accurate, real-time information about NixOS packages, system options, Home Manager settings, and nix-darwin macOS configurations.
httpaigitgithub - MCP-Notion 🏠 - MCP server for Notion
mcpservergit clone https://github.com/Verandert-Gewoon/MCP-Notion - mcp-on-fire 🏠 - A repository for MCP on Fire with a beautiful README about GitHub MCP server.
mcpservergit clone https://github.com/abdelhak-devops/mcp-on-fire - MCP-OpenStack-Ops - Professional OpenStack operations automation via MCP server. Specialized tools for cluster monitoring, instance management, volume control & network analysis. FastMCP + OpenStack SDK + Bearer auth. Claude Desktop ready. Perfect for DevOps & cloud automation.
authhttpgitgithubmonitoring - mcp-playground 🐍 🏠 - Python-based
httpmlgitgithubpythonpip install git+https://github.com/Yordi23/mcp-playground - MCP-PostgreSQL-Ops - Model Context Protocol (MCP) server for Apache Ambari API integration. This project provides tools for managing Hadoop clusters, including service operations, configuration management, status monitoring, and request tracking.
apihttppostgresgitgithub - mcp-read-json 📜 🏠 - MCP server for reading JSON knowledge bases without modifications
httpjsonmlllmgitnpm install fmicalizzi/mcp-read-json - mcp-reddit-companion 🐍 🏠 - Python-based
httpllmgitgithubpythonpip install git+https://github.com/saginawj/mcp-reddit-companion - mcp-s3-server 🐍 🏠 - MCP server for object storage, supporting a range of operations for object storage
httpgitgithubpythonmcppip install git+https://github.com/FunnyPuppet/mcp-s3-server - mcp-sample 🐍 🏠 - Python-based
httpaigitgithubpythonpip install git+https://github.com/KerolIA98/mcp-sample - mcp-sanctions - Screen individuals and organizations against global sanctions lists (OFAC, SDN, UN, etc). Query by prompt or document upload.
httpaigitgithub - mcp-search-engine 📘 🏠 - TypeScript-based
httpmlgitgithubtypescriptnpm install harshini-ns/mcp-search-engine - mcp-search-console-ts 📘 🏠 📇 - Google Search Console API tools via Model Context Protocol
httpgitgithubanalyticstypescriptnpm install jmchat/mcp-search-console-ts - mcp-server 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install Collaborne/mcp-server - mcp-server 📜 🏠 📇 - Node.js-based
apihttpaigitgithubnpm install aixbt/mcp-server - mcp-scope 🐚 🏠 - An mcp server for my scopecam project.
shellmcpservergit clone https://github.com/verlyn13/mcp-scope - mcp-search-mojeek 🐍 🏠 - MCP Search mojeek (Python-based)
httpgitgithubpythonmcppip install git+https://github.com/marioalexandreantunes/mcp-search-mojeek - mcp-server 🏠 - 测试 mcp server的代码库
mcpservergit clone https://github.com/Yangbin-v/mcp-server - mcp-server 🏠 - Minecraft Server setup and configuration (MCP)
mcpservergit clone https://github.com/nkmrrrr/mcp-server - mcp-server 🏠 - MCP Server repository for managing and coordinating services
mcpservergit clone https://github.com/mahenderkunchala22/mcp-server - MCP-server 🏠 - Server implementation for MCP
mcpservergit clone https://github.com/xinyi-hou/MCP-server - MCP-server 🏠 - MCP-server
mcpservergit clone https://github.com/HyeokJoon/MCP-server - MCP-Server 🏠 - Projects on MCP server
mcpservergit clone https://github.com/P-RajaRamesh/MCP-Server - mcp-server-and-client 🎯 🏠 - Server and client implementation for MCP (Master Control Program)
kotlinmcpservergit clone https://github.com/SeolYoungKim/mcp-server-and-client - mcp-server-creem 🏠 - Model Context Protocol (MCP) Server for Creem.io – Enhancing Merchant of Record services with transparent billing and improved fees.
mcpservergit clone https://github.com/ffhr/mcp-server-creem - mcp-server-fetch 🏠 - MCP server fetch installation
mcpservergit clone https://github.com/Terrib1e/mcp-server-fetch - mcp-server-flomo MCP Server - Write notes to Flomo
flomonoteswriting - mcp-server-hand ☕ 🏠 - Java-based
httpaigitgithubjavagit clone https://github.com/koudaiDemon/mcp-server-hand - MCP-Server-Ideas 🏠 - Plans/WIP for MCP servers
mcpservergit clone https://github.com/danielrosehill/MCP-Server-Ideas - mcp-server-malaysia-prayer-time 🐍 🏠 - A Model Context Protocol (MCP) server for Malaysia Prayer Time data
httpmlgitgithubpythonpip install git+https://github.com/amanasmuei/mcp-server-malaysia-prayer-time - mcp-server-k8s 🐍 🏠 - A simple MCP server for Kubernetes
httpkubernetesgitgithubpythonpip install git+https://github.com/chris-sun-star/mcp-server-k8s - mcp-server-naa 🐍 🏠 - MCP Server for Netwrix Access Analyzer
httpmlgitgithubpythonpip install git+https://github.com/netwrix/mcp-server-naa - MCP-Server-JSON-Sync 🐚 🏠 - Sync script for syncing VS Code MCP server JSON to Roo Code's store
shellmcproo-codevscodeservergit clone https://github.com/danielrosehill/MCP-Server-JSON-Sync - mcp-server-memory 📘 🏠 - TypeScript-based
localhttpaigitgithubnpm install mkusaka/mcp-server-memory - mcp-server-jvm-build-tools ☕ 🏠 - An Model Context Protocol based Server for build tools for the JVM.
httpmlgitgithubjavagit clone https://github.com/thepragmatik/mcp-server-jvm-build-tools - mcp-server-kindred-offers 🏠 - MCP server for accessing exclusive global deals and merchant offers in seconds!
mcpserverhttpgitgithubgit clone https://github.com/kindred-app/mcp-server-kindred-offers - mcp-server-playwright 🏠 - MCP Server Playwright - A browser automation service for Claude Desktop
mcpservergit clone https://github.com/aptcats/mcp-server-playwright - mcp-server-research 🏠 - MCP (Model Context Protocol) Server 研究文档和实用指南
mcpservergit clone https://github.com/Joseph19820124/mcp-server-research - mcp-server-todoist 🏠 - An MCP Server implementation with Todoist
mcpservergit clone https://github.com/mariopavlov/mcp-server-todoist - mcp-servers 🏠 - MCP Server configurations
mcpservergit clone https://github.com/diml-dev/mcp-servers - mcp-servers 🏠 - Collection of MCP (Model Composition Platform) servers and services
mcpservergit clone https://github.com/piseajay559/mcp-servers - mcp-servers-playground 🐚 🏠 - Just another playground to explore MCP Servers.
shellmcpservergit clone https://github.com/pandego/mcp-servers-playground - mcp-server-indexnow 🐍 🏠 - A Model Context Protocol (MCP) server allowing URL indexing requests via the IndexNow protocol. This server acts as a bridge, enabling MCP-compatible clients (like IDEs or AI assistants) to submit URLs to search engines using the IndexNow protocol for potentially faster content discovery and indexing.
httpgitgithubpythonindexnowpip install git+https://github.com/zizzfizzix/mcp-server-indexnow - mcp-server-ipfs-context 📜 🏠 - Node.js-based
httpmlgitgithubjavascriptnpm install johnhenry/mcp-server-ipfs-context - mcp-server-java ☕ 🏠 - Java-based
httpmlgitgithubjavagit clone https://github.com/kenken64/mcp-server-java - MCP-Servers 🐚 🏠 - these are my MCP servers, and their support structure
shellmcpservergit clone https://github.com/ajoslin103/MCP-Servers - mcp-servers-scratch 🏠 - mcp server
mcpservergit clone https://github.com/i-k-suke/mcp-servers-scratch - mcp-shell-server 🏠 - A simple MCP (Model Context Protocol) server that exposes terminal commands and access to pictures.
mcpservergit clone https://github.com/akaiserg/mcp-shell-server - MCP-study 📘 🏠 - 使用typescript学习MCP架构的仓库
httpgitgithubtypescriptmcpnpm install ArisaTaki/MCP-study - Mcp-Swagger-Server (by zaizaizhao) - This MCP server transforms OpenAPI specifications into MCP tools, enabling AI assistants to interact with REST APIs through standardized protocol
apiresthttpaigit - mcp-terminal-client 🐍 🏠 - A Python MCP terminal client
httpanthropicgitgithubpythonpip install git+https://github.com/dolwinf/mcp-terminal-client - mcp-time-server 🏠 - Model Context Protocol Time Server - A robust timezone-aware time server implementation
servergit clone https://github.com/txbm/mcp-time-server - mcp-tutorial 🏠 - Tutorial repository for GitHub MCP Server
mcpservergit clone https://github.com/stillnotitle/mcp-tutorial - mcp-tutorials 🏠 - A comprehensive guide to Model Context Protocol (MCP) servers, installation, and usage with Cursor and Smithery.
mcpservergit clone https://github.com/rams1987/mcp-tutorials - mcp-wdpcameracontrol-server 📜 🏠 - Node.js-based
httpgitgithubjavascriptnpm install radial-hks/mcp-wdpcameracontrol-server - mcp-unix-shell 🐹 🏠 - Go-based
httpgitgithubgogo install gamunu/mcp-unix-shell@latest - mcp-vision - An MCP server exposing HuggingFace computer vision models such as zero-shot object detection as tools, enhancing the vision capabilities of large language or vision-language models.
httpgitgithub - mcp-weather - Accurate weather forecasts via the AccuWeather API (free tier available).
apihttpaimlgit - mcp-weather-server 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/HZreal/mcp-weather-server - mcp-woocommerce-thoy 📜 🏠 📇 - Node.js-based
apiresthttpjsonmlnpm install thoy-le-duc/mcp-woocommerce-thoy - mcp-youtube-extract - A Model Context Protocol server for YouTube operations, extracting video information and transcripts with intelligent fallback logic. Features comprehensive logging, error handling, and support for both auto-generated and manual transcripts.
httpgitgithublogging - MCP.ing - A list of MCP services for discovering MCP servers in the community and providing a convenient search function for MCP services by iiiusky
httpgitgithub - mcp.natoma.ai - A Hosted MCP Platform to discover, install, manage and deploy MCP servers by Natoma Labs
httpai - mcp.run - A hosted registry and control plane to install & run secure + portable MCP Servers.
http - mcpcap - A modular Python MCP (Model Context Protocol) Server for analyzing PCAP files.
filehttpgitgithub - mcpcli 🐹 🏠 - cli tool for inspect mcp server
httpgitgithubgomcpgo install winterfx/mcpcli@latest - MCPE-Alpha-Server-for-Pterodactyl 🏠 - Cores for MCPE Alpha servers using the Pterodactyl panel
falixnodesmcpepterodactylpterodactyl-panelservergit clone https://github.com/eqozqq/MCPE-Alpha-Server-for-Pterodactyl - MCpi5Server 🐚 🏠 - My papermc configuration and script for my RaspberryPi 5.
shellgit clone https://github.com/M3kk0M3d3sm0/MCpi5Server - MCPGithub 🐍 🏠 - Python-based
httpaigitgithubpythonpip install git+https://github.com/alvnavraii/MCPGithub - MCPHub - Website to list high quality MCP servers and reviews by real users. Also provide online chatbot for popular LLM models with MCP server support.
webhttpllm - mcphub.nvim A Neovim plugin that provides a UI and api to interact with MCP servers. 🏠 📇
apihttpgitgithub - MCPIgnore Filesytem - A Data Security First filesystem MCP server that implements .mcpignore to prevent MCP clients from accessing sensitive data.
filehttpgitgithub - mcpjungle/MCPJungle 🏠 - Self-hosted MCP Registry and Gateway for AI Agents
httpaigitgithub - mcpm (website) - MCP Manager (MCPM) is a Homebrew-like service for managing Model Context Protocol (MCP) servers across clients by Pathintegral
webhttpgitgithub - MCPProxyServer 🏠 - Intermediate proxy server for the minecraft protocol
servergit clone https://github.com/CoffeeCoder1015/MCPProxyServer - McpQuickstartWeatherServer 🎯 🏠 - Quickstart of MCP server
kotlinmcpservergit clone https://github.com/yu-ko-ba/McpQuickstartWeatherServer - MCPRepository.com - A repository that indexes and organizes all MCP servers for easy discovery.
http - mcps-playground a playground for Remote MCP servers
remotehttp - mcpserver 📘 🏠 - MCP Server repository for managing GitHub operations
httpmlllmgitgithubnpm install ravi-accolite/mcpserver - MCPServer 🏠 - A repository for practicing MCP Server develop
mcpservergit clone https://github.com/z-waterking/MCPServer - MCPServers.com - A growing directory of high-quality MCP servers with clear setup guides for a variety of MCP clients. Built by the team behind the Highlight MCP client
httpai - MCPShell - Tool that allows LLMs to safely execute command-line tools, providing a secure bridge between LLMs and operating system commands.
httpllmgitgithub - MCPVerse - A portal for creating & hosting authenticated MCP servers and connecting to them securely.
authhttp - mcpweather - Get weather information from https://api.open-meteo.com API.
apihttpgitgithub - MCPxLabs/mcpsol 🏠 - Facilitates AI-driven interactions with the Solana blockchain, enabling seamless execution of transactions and management of wallets through a standardized interface.
httpaimlgitgithub - Md2doc - Convert Markdown text to DOCX format using an external conversion service
httpgitgithub - MeasureSpace MCP - A free Model Context Protocol (MCP) Server that provides global weather, climate, air quality forecast and geocoding services by measurespace.io.
httpaigitgithub - mediar-ai/screenpipe 🏠 - 🎖️ 🦀 🏠 🍎 Local-first system capturing screen/audio with timestamped indexing, SQL/embedding storage, semantic search, LLM-powered history analysis, and event-triggered actions - enables building context-aware AI agents through a NextJS plugin ecosystem.
localhttpaillmgit - MediaWiki - A Model Context Protocol (MCP) Server that interacts with any MediaWiki wiki
httpgitgithub - MediaWiki MCP adapter - A custom Model Context Protocol adapter for MediaWiki and WikiBase APIs
apihttpgitgithub - meiliseachmcp 🐍 🏠 - Python-based
httpmlllmgitgithubpip install git+https://github.com/dealwallet1/meiliseachmcp - medifinder-mcp 🐍 🏠 - Message Communication Protocol (MCP) server that facilitates secure, standardized communication between system components and the medicine inventory database. Provides RESTful endpoints for location-based medicine searches, availability queries, and optimized messaging for WhatsApp integration.
httpaigitgithubpythonpip install git+https://github.com/MediFinderBot/medifinder-mcp - meetdhanani17/xgmem 🏠 - A TypeScript-based MCP server for managing project-specific and cross-project knowledge graph memory for LLM agents and tools.
httpllmgitgithub - Meme MCP - Generate memes via AI using the Imgflip API through the Model Context Protocol.
apihttpaigitgithub - memento-mcp - Knowledge graph memory system built on Neo4j with semantic search, temporal awareness.
httpgitgithub - Memory - Knowledge graph-based persistent memory system.
- Memory-Plus a lightweight, local RAG memory store to record, retrieve, update, delete, and visualize persistent "memories" across sessions—perfect for developers working with multiple AI coders (like Windsurf, Cursor, or Copilot) or anyone who wants their AI to actually remember them. 🏠
localhttpaigitgithub - Mercado Libre - Mercado Libre's official MCP server, offering tools to interact with our marketplace, simplifying tasks and product integration.
http - Mercado Pago - Mercado Pago's official MCP server, offering tools to interact with our API, simplifying tasks and product integration.
apihttp - metatool-ai/metatool-app 📇 ☁️ 🏠 🍎 🪟 🐧 🏠 - MetaMCP is the one unified middleware MCP server that manages your MCP connections with GUI.
httpaigitgithub - MetaTrader MCP - Enable AI LLMs to execute trades using MetaTrader 5 platform.
httpaillmgitgithub - mg-mcp-server 🏠 - MCP Server for OpenShift Must-gather
mcpservergit clone https://github.com/mJace/mg-mcp-server - mgd1984/cursor-rules 🏠 - Facilitates the integration of Cursor Rules MCP server for consistent development guidance in Next.js applications with TypeScript.
httpgitgithub - MGDS01/docusign-test-js-sdk-public 🏠 📇 - A TypeScript SDK that serves as an installable MCP server, exposing Docusign API methods for AI applications.
apihttpaigitgithub - Michael98671/agentbay 🏠 📇 - AgentBay MCP Server offers a serverless cloud infrastructure for AI Agents, enabling rapid integration and execution of AI tasks with Alibaba Cloud's Wuying platform.
apihttpaigitgithub - micl2e2/code-to-tree 🌊 🏠 📟 🐧 🪟 🍎 🏠 - A single-binary MCP server that converts source code into AST, regardless of language.
httpgitgithub - microcms-api-mcp-server 📘 🏠 📇 - MCPサーバでmicroCMS APIを利用可能にする
apihttpgitgithubtypescriptnpm install burnworks/microcms-api-mcp-server - Microsoft 365 - (by Merill) A Model Context Protocol (MCP) server for Microsoft 365. Includes support for all services including Teams, SharePoint, Exchange, OneDrive, Entra, Intune and more. See Lokka for more details.
httpaigitgithub - Microsoft 365 Files (SharePoint/OneDrive) (by godwin3737) - MCP server with tools to search and get file content from Microsoft 365 including Onedrive and SharePoint. Works with Documents (pdf/docx), Presentations, Spreadsheets and Images.
filehttpgitgithub - mikechao/brave-search-mcp 📇 ☁️ 🏠 📇 - Web, Image, News, Video, and Local Point of Interest search capabilities using Brave's Search API
apiweblocalresthttp - mikechao/metmuseum-mcp 📇 ☁️ 🏠 📇 - Metropolitan Museum of Art Collection API integration to search and display artworks in the collection.
apihttpgitgithub - mila-iqia/paperpal 🏠 - Enhance your literature review process by integrating LLMs with arXiv and Hugging Face papers for seamless paper discussions and organization.
httpmlllmgitgithub - milatechtransfer/paperpal 🏠 - Enhance your literature review process by integrating LLMs with access to arXiv, Hugging Face papers, and Semantic Scholar.
httpllmgitgithub - mindsdb/mindsdb 🏠 - Connect and unify data across various platforms and databases with MindsDB as a single MCP server.
databasehttpgitgithub - Minima - MCP server for RAG on local files
filelocalhttpgitgithub - MiniMax MCP - Official MiniMax Model Context Protocol (MCP) server that enables interaction with powerful Text to Speech, image generation and video generation APIs.
minimaxttsimage-generationvideo-generation - MintMCP 🏠 - MCP servers for Google Calendar, Gmail, Outlook Calendar, and Outlook.
httpaigitgithub - misskey-mcp-server 🐹 🏠 - unofficial misskey mcp server
httpgitgithubgomcpgo install ganyariya/misskey-mcp-server@latest - miro-mcp-server 🎯 🏠 - Miro MCP Server (Kotlin-based)
kotlinmcpservergit clone https://github.com/MaratMingazov/miro-mcp-server - MLflow - MLflow MCP server for ML experiment tracking with advanced querying, run comparison, artifact access, and model registry.
httpmlgitgithub - mmntm/weblate-mcp 📇 ☁️ 🏠 - Comprehensive Model Context Protocol server for Weblate translation management, enabling AI assistants to perform translation tasks, project management, and content discovery with smart format transformations.
webhttpaigitgithub - mns-mcp-server 🐍 🏠 - mns-mcp-server (Python-based)
filehttpgitgithubpythonpip install git+https://github.com/Houlong66/mns-mcp-server - mo-note-mcp-server 🏠
git clone https://github.com/we-mowen/mo-note-mcp-server - Modao Proto MCP - AI-powered HTML prototype generation server that converts natural language descriptions into complete HTML code with modern design and responsive layouts. Supports design description expansion and seamless integration with Modao workspace.
httpaimlgitgithub - Model Context Protocol (MCP) Quickstart
httpai - modelcontextprotocol/server-everything 📇 🏠 🏠 - MCP server that exercises all the features of the MCP protocol
httpaigitgithub - modelcontextprotocol/server-git 🐍 🏠 🏠 - Direct Git repository operations including reading, searching, and analyzing local repositories
localhttpaigitgithub - modelcontextprotocol/server-gitlab 📇 ☁️ 🏠 🏠 - GitLab platform integration for project management and CI/CD operations
httpaigitgithubgitlab - modelcontextprotocol/server-memory 📇 🏠 🏠 - Knowledge graph-based persistent memory system for maintaining context
httpaigitgithub - modelcontextprotocol/server-puppeteer 📇 🏠 🏠 📇 - Browser automation for web scraping and interaction
apiwebhttpaigit - ModelFetch (TypeScript) - Runtime-agnostic SDK to create and deploy MCP servers anywhere TypeScript/JavaScript runs
httpgitgithub - monad-mcp-server 📜 🏠 - A MCP (Model Context Protocol) server for interacting with the Monad blockchain, offering a comprehensive suite of DeFi tools and blockchain functionalities.
httpaigitgithubjavascriptnpm install Veenoway/monad-mcp-server - MonadsAG/capsulecrm-mcp 🏠 - 📇 ☁️ Allows AI clients to manage contacts, opportunities and tasks in Capsule CRM including Claude Desktop ready DTX-file
filehttpaigitgithub - monday-mcp-server 🏠 - monday.com mcp server
mcpservergit clone https://github.com/RomKadria/monday-mcp-server - monday-mcp-server 🏠 - monday-mcp-server
mcpservergit clone https://github.com/xlyxlyxlyxly/monday-mcp-server - MongoDB & Mongoose - MongoDB MCP Server with Mongoose Schema and Validation.
httpmongodbgitgithub - Monzo - Access and manage your Monzo bank accounts through natural language, including balance checking, pot management, transaction listing, and transaction annotation across multiple account types (personal, joint, flex).
httpgitgithub - Morningstar - MCP Server to interact with Morningstar Research, Editorial and Datapoints
httpgitgithub - Moss-G/Gantt-server 🏠 - Facilitates AI-driven Gantt chart project and task management with interactive visualization capabilities.
httpaigitgithub - mqtt-mcp-server 🏠 - MQTT MCP Server
mcpservergit clone https://github.com/douglaszuqueto/mqtt-mcp-server - MSSQL - MSSQL database integration with configurable access controls and schema inspection
databasehttpgitgithub - MSSQL-MCP-Node (by mihai - dulgheru) – Node.js MCP server for Microsoft SQL Server featuring auto-detected single / multi-database configs, execute-SQL and schema tools, robust Zod validation, and optional Express endpoints for local testing
databaselocalhttpaigit - Mtehabsim/ScreenPilot 🐍 🏠 🏠 - enables AI to fully control and access GUI interactions by providing tools for mouse and keyboard, ideal for general automation, education, and experimentation.
httpaigitgithub - mumez/pharo-smalltalk-interop-mcp-server 🐍 🏠 🏠 - Pharo Smalltalk integration enabling code evaluation, class/method introspection, package management, test execution, and project installation for interactive development with Pharo images.
httpgitgithub - musthafa-mohammed/mvn-repo-mcp 🏠 - Facilitates AI-driven IDEs to interact with Maven Central for package search, version listings, and vulnerability checks.
httpaigitgithub - Mux 🏠 📇 - Mux is a video API for developers. With Mux's official MCP you can upload videos, create live streams, generate thumbnails, add captions, manage playback policies, dig through engagement data, monitor video performance, and more.
apihttpaigitgithub - mvk24199/zerodha-trade 📘 🏠 - Facilitates automated stock trading on the Zerodha platform using Bun.js and Claude MCP integration.
httpgitgithub - MWGMorningwood/Central-Memory-MCP 📇 ☁️ 🏠 - An Azure PaaS-hostable MCP server that provides a workspace-grounded knowledge graph for multiple developers using Azure Functions MCP triggers and Table storage.
httpazuregitgithub - mxcp 🏠 - Open-source framework for building secure, testable, enterprise-grade MCP tools from SQL or Python on top of dbt + DuckDB.
httpgitgithub - mxcp (Python) - Open-source framework for building enterprise-grade MCP servers using just YAML, SQL, and Python, with built-in auth, monitoring, ETL and policy enforcement.
authhttpmlgitgithub - my-crypto-mcp 📘 🏠 📇 - This Model Context Protocol (MCP) server provides cryptocurrency information through Claude Desktop. It connects to the CoinMarketCap API to fetch real-time cryptocurrency data.
apihttpgitgithubtypescriptnpm install 0xanpham/my-crypto-mcp - MySQL-Server (by TonyCai) - MySQL Database Integration using Python script with configurable access controls and schema inspection, usng stdio mode to suitable local deployment, you can run it in docker container.
databaselocalhttpmysqldocker - mytechnotalent/RAGMCP 🏠 - A semantic PDF search server utilizing OCR, FAISS, and transformers for intelligent query responses.
httpaigitgithub - myweight-mcp-server 📘 🏠 📇 - TypeScript-based
apihttpgitgithubtypescriptnpm install shinichi-takayanagi/myweight-mcp-server - mzxrai/mcp-webresearch 🔍 📚 🏠 - Search Google and do deep web research on any topic
webhttpaigitgithub - Nacos MCP Router - This MCP(Model Context Protocol) Server provides tools to search, install, proxy other MCP servers.
httpgitgithub - NakaokaRei/swift-mcp-gui 🏠 🍎 🏠 - MCP server that can execute commands such as keyboard input and mouse movement
httpgitgithub - namanyayg/giga-mcp 🏠 - Enhance AI project management by automating memory and task tracking with seamless integration into MCP clients.
httpaimlgitgithub - Nanana - This MCP provides AI text-to-image generator and AI image-to-image editor powered by Google Gemini Nano Banana.
httpaigitgithub - Nanoleaf 🏠 - Control Nanoleaf smart lights through MCP - turn on/off, adjust brightness, change colors, set effects, and discover devices
httpgitgithub - narumiruna/gitingest-mcp 🐍 🏠 🏠 - A MCP server that uses gitingest to convert any Git repository into a simple text digest of its codebase.
httpgitgithub - NASA Image MCP Server - MCP server providing access to NASA's visual data APIs including Mars Rover photos, Earth satellite imagery (EPIC/GIBS), and Astronomy picture of the day. Features built-in image analysis tools with automatic format detection, compression, and base64 conversion for LLM integration.
apihttpaillmgit - NASA Planetary Data System (PDS) MCP Server - MCP server for connecting to NASA's Planetary Data System (PDS) enabling intelligent data discovery of all of NASA's data products from the 1960s to present day.
httpgitgithub - Nasdaq Data Link (by stefanoamorelli) - An MCP server to access, explore, and interact with Nasdaq Data Link's extensive and valuable financial and economic datasets.
httpgitgithub - naver-map-mcp 📘 🏠 📇 - Development of MCP servers using Naver Map API (Geocoding, Reverse Geocoding, Direction5, Direction15, Static Map, and Dynamic Map)
apihttpgitgithubtypescriptnpm install num2k/naver-map-mcp - NBA - This MCP server provides tools to fetch recent and historical NBA games including basic and advanced statistics.
httpaigitgithub - NCBI-MCP 🏠 📇
apihttpgitgithubgit clone https://github.com/GooTec/NCBI-MCP - NCI GDC - Unofficial MCP server for the National Cancer Institute's Genomic Data Commons (GDC), providing access to harmonized cancer genomic and clinical data for oncology research.
httpgitgithub - NCP (Natural Context Provider by portel.dev) - NCP lets your AI dream of a tool and articulate its need as a user story. NCP then intelligently discovers and makes that tool instantly available, streamlining thought processes, eliminating cognitive overload, and slashing token costs by up to 87% (47ms discovery). Experience true on-demand tool access, smart health monitoring, and energy efficiency for your AI agents.
httpaimlgitgithub - Nebula-Block-Data/nebulablock-mcp-server 📇 🏠 🏠 📇 - integrates with the fastmcp library to expose the full range of NebulaBlock API functionalities as accessible tools
apihttpgitgithub - neilberkman/editorconfigmcp 📇 🏠 🏠 - Formats files using .editorconfig rules, acting as a proactive formatting gatekeeper to ensure AI-generated code adheres to project-specific formatting standards from the start.
filehttpaigitgithub - Nerve is an open source command line tool designed to be a simple yet powerful platform for creating and executing MCP integrated LLM-based agents. 🏠
httpllmgitgithub - nesquikm/mcp-rubber-duck 📇 🏠 ☁️ 🏠 - An MCP server that bridges to multiple OpenAI-compatible LLMs - your AI rubber duck debugging panel for explaining problems to various AI "ducks" and getting different perspectives
httpaillmopenaigit - netbox-mcp-server 🐍 🏠 - A MCP server for NetBox
httpllmgitgithubpythonpip install git+https://github.com/ardecode/netbox-mcp-server - NetMind - Access powerful AI services via simple APIs or MCP servers to supercharge your productivity.
apihttpai - NetSuite - MCP server for NetSuite ERP integration with OAuth 2.0 authentication, enabling natural language access to NetSuite data through SuiteQL queries, reports, saved searches, and REST API operations.
apiauthoauthresthttp - news_mcp 🐍 🏠 - Python-based
httpaigitgithubpythonpip install git+https://github.com/Zmingfeng/news_mcp - Next.js MCP Server Template (Typescript) - A starter Next.js project that uses the MCP Adapter to allow MCP clients to connect and access resources.
httpgitgithub - Nextcloud Calendar 🏠 - CalDAV Nectcloud calendar integration. Manage calendars, events, attendees, etc.
httpgitgithub - Nicolassaint/mathsIAAPI 🏠 📇 - MathsIA API integrates FastAPI-MCP to enable AI models to manage a flashcard system for math learning, offering features for user management and progress tracking.
apihttpaigitgithub - Nikto MCP (by weldpua2008) - A secure MCP server that enables AI agents to interact with Nikto web server scanner](- use with npx or docker).
webhttpdockeraigit - NodeCodeStudio - Activate MCP services (Gmail, Calendar, WordPress, etc.) and run browser automation workflows via a Chrome extension with importable sequences
httpai - ntnx-mcp 🐍 🏠 - Python-based
httpaillmgitgithubpip install git+https://github.com/atalhens/ntnx-mcp - Noeli14_MCppServer 🏠 - Mirror of https://github.com/Noeli14/MCppServer
c++mcpserverhttpgit clone https://github.com/MCP-Mirror/Noeli14_MCppServer - Notion (by v-3) - Notion MCP integration. Search, Read, Update, and Create pages through Claude chat.
httpgitgithub - Notte 🏠 📇 - Leverage Notte Web AI agents & cloud browser sessions for scalable browser automation & scraping workflows
apiwebhttpaigit - NPM Plus - AI-powered JavaScript package management with security scanning, bundle analysis, and intelligent dependency management for MCP-compatible editors.
httpaigitgithub - ntropy-mcp 🏠 - Ntropy MCP server
mcpservergit clone https://github.com/smithery-ai/ntropy-mcp - nuri-mcp-server 🏠 - 자작 MCP server 도구들
mcpservergit clone https://github.com/nuri428/nuri-mcp-server - nyxn-ai/NyxDocs 🐍 ☁️ 🏠 🏠 - Specialized MCP server for cryptocurrency project documentation management with multi-blockchain support (Ethereum, BSC, Polygon, Solana).
httpaigitgithub - Obsidian Notes - Direct file system access to Obsidian vaults with security-first design, advanced search capabilities including MOC (Maps of Content) discovery, and support for obsidian.nvim - no Obsidian app required.
filehttpgitgithub - OctoEverywhere For 3D Printing - A 3D Printing MCP server that allows for querying for live state, webcam snapshots, and 3D printer control.
webhttp - Odoo - Connect AI assistants to Odoo ERP systems for business data access and workflow automation.
httpaigitgithub - OEvortex/ddgsearch 🏠 - A privacy-focused MCP server that leverages DuckDuckGo for efficient web search and URL content extraction.
webhttpgitgithub - Office-Visio-MCP-Server - A Model Context Protocol (MCP) server for creating, reading, and manipulating Microsoft Visio documents.
httpgitgithub - OKX-MCP-Server - An MCP server provides various blockchain data and market price data via the OKX API. The server enables Claude to perform operations like retrieve assets prices, transaction data, account history data and trade instruction data.
apihttpaigitgithub - omcp_a2a 🐍 🏠 - current A2A-omcp implementation
httpllmgitgithubpythonpip install git+https://github.com/fastomop/omcp_a2a - OMOP MCP - Map clinical terminology to OMOP concepts using LLMs for healthcare data standardization.
httpllmgitgithub - OneCite - Universal citation management and academic reference toolkit. Generate citations from DOI, arXiv, titles, or URLs in multiple formats (BibTeX, APA, MLA). Supports 7+ literature types and 10+ academic databases with intelligent metadata completion.
databasehttpmlgitgithub - OneNote - (by Rajesh Vijay) An MCP server that connects to Microsoft OneNote using the Microsoft Graph API. Reading notebooks, sections, and pages from OneNote,Creating new notebooks, sections, and pages in OneNote.
apihttpgitgithub - Onfinance-MCP-Polymarket 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/AyushRatan1/Onfinance-MCP-Polymarket - Onyx MCP Sandbox - (by Aravind) A secure MCP server that executes code in isolated Docker sandboxes. Supports Python, Java, C, C++, JavaScript, and Rust. Provides the runcode tool, enforces CPU/memory limits, includes comprehensive tests, and detailed setup instructions.
httpdockeraigitgithub - ooples/token-optimizer-mcp 📇 🏠 ☁️ 🍎 🪟 🐧 🏠 📇 - Intelligent token optimization achieving 95%+ reduction through caching, compression, and 80+ smart tools for API optimization, code analysis, and real-time monitoring.
apihttpgitgithubmonitoring - Open Targets - Unofficial MCP server for the Open Targets Platform, providing access to target-disease associations, drug discovery data, and therapeutic hypothesis generation for biomedical research.
httpgitgithub - open-dental-mcp 📘 🏠 - TypeScript-based
databasehttpgitgithubtypescriptnpm install AojdevStudio/open-dental-mcp - OpenAI GPT Image - OpenAI GPT image generation/editing MCP server.
httpaiopenaigitgithub - OpenLink Generic Python Open Database Connectivity - Generic Database Management System (DBMS) access via Open Database Connectivity (ODBC) Connectors (Drivers) for PyODBC
databasehttpgitgithub - OpenMCP Client - An all-in-one vscode/trae/cursor plugin for MCP server debugging. Document & OpenMCP SDK.
httpgitgithub - OpenMCPSever 🏠 - Open source for MCP server
mcpservergit clone https://github.com/chgaowei/OpenMCPSever - OpenMetadata - MCP Server for OpenMetadata, an open-source metadata management platform.
httpgitgithub - OpenMF-mifosx-self-service 🏠 📇 - Access Apache Fineract self-service APIs for registration, authentication, account management, and transactions via MCP.
apiauthhttpgitgithub - OpenNeuro - Unofficial MCP server for OpenNeuro, providing access to open neuroimaging datasets, study metadata, and brain imaging data for neuroscience research and analysis.
httpaigitgithub - OpenReview - An MCP server for OpenReview to fetch, read and save manuscripts from AI/ML conferences.
httpaimlgitgithub - openshift-mcp 🏠 - MCP server for OpenShift.
mcpservergit clone https://github.com/24sama/openshift-mcp - OpenStack - MCP server implementation that provides OpenStack interaction.
httpgitgithub - openstack-kr/python-openstackmcp-server 🐍 ☁️ 🏠 - OpenStack MCP server for cloud infrastructure management based on openstacksdk.
httpgitgithub - OpenWeather - Interact with the free openweathermap API to get the current and forecast weather for a location.
apihttpgitgithub - OpenZeppelin/contracts-wizard 🏠 - A Model Context Protocol (MCP) server that allows AI agents to generate secure smart contracts in multiples languages based on OpenZeppelin Wizard templates.
httpaigitgithub - OpenZIM MCP - Modern, secure, and high-performance MCP server that enables AI models to access and search ZIM format knowledge bases offline, including Wikipedia and educational content archives.
httpaigitgithubapi - Operative WebEvalAgent (by Operative.sh) - An MCP server to test, debug, and fix web applications autonomously.
webhttpgitgithub - OPNSense MCP - MCP Server for OPNSense Firewall Management and API access
apihttpgitgithub - Optimade MCP - An MCP server conducts real-time material science data queries with the Optimade database (for example, elemental composition, crystal structure).
databasehttpgitgithub - Oracle (by marcelo-ochoa) - Oracle Database integration in NodeJS with configurable access controls, query explain, stats and schema inspection
databasehttpaigitgithub - Oracle Cloud Infrastructure (OCI) (by karthiksukumar) - Python MCP server for OCI infrastructure (Compute, Autonomous Database, Object Storage). Read-heavy by default with safe instance actions (start/stop/reset). Includes Claude Desktop config and .env compartment scoping.
databasehttpgitgithub - oraios/serena 🐍 🏠 🏠 - A fully-featured coding agent that relies on symbolic code operations by using language servers.
httpaigitgithub - oschina/mcp-gitee 🏎️ ☁️ 🏠 🏠 📇 - Gitee API integration, repository, issue, and pull request management, and more.
apihttpgitgithub - osinmv/funciton-lookup-mcp 🐍 🏠 🍎 🐧 🏠 - MCP server for function signature lookups.
httpgitgithub - oslook_mcp-servers-schemas 🏠 - Mirror of https://github.com/oslook/mcp-servers-schemas
mcpserverhttpgit clone https://github.com/MCP-Mirror/oslook_mcp-servers-schemas - Oura Ring (by Rajesh Vijay) - MCP Server to access and analyze your Oura Ring data. It provides a structured way to fetch and understand your health metrics.
httpgitgithubmetrics - Pacman - An MCP server that provides package index querying capabilities. This server is able to search and retrieve information from package repositories like PyPI, npm, crates.io, Docker Hub, and Terraform Registry.
httpdockergitgithub - PaddleOCR - An MCP server that brings enterprise-grade OCR and document parsing capabilities to AI applications.
httpaimlgitgithub - page_control_mcp 📜 🏠 - Node.js-based
webhttpaimlgitnpm install thezuck/page_control_mcp - Paperless-MCP 🏠 📇 - An MCP server for interacting with a Paperless-NGX API server. This server provides tools for managing documents, tags, correspondents, and document types in your Paperless-NGX instance.
apihttpgitgithub - Paradex MCP - MCP native server for interacting with Paradex platform, including fully features trading.
httpgitgithub - parallel-web/search-mcp ☁️ 🔎 🏠 - Highest Accuracy Web Search for AI
webhttpaigitgithub - [Parliament MCP)](https://github.com/sv/mcp-paradex-py - MCP server for querying UK parliamentary data.
httpaigitgithub - particle-mcp-server 🐍 🏠 📇 - An MCP server that connects to Particle IOT API and allows LLMs to use it to do fleet management
httpaigitgithubpythonpip install git+https://github.com/zradlicz/particle-mcp-server - particlefuture/MCPDiscovery 🏠 ☁️ - MCP of MCPs. A central hub for MCP servers. Helps you discover available MCP servers and learn how to install and use them.
httpaigitgithubremote - passontw/slotdemo 📜 🏠 - A modern slot machine game built with native JavaScript, CSS animations, and Tailwind CSS, offering a smooth and interactive gaming experience.
httpaigitgithub - patentsafe-mcp 🐍 🏠 - PatentSafe MCP server
httpgitgithubpythonmcppip install git+https://github.com/amphora/patentsafe-mcp - PatrickPalmer/MayaMCP 🐍 🏠 🏠 - MCP server for Autodesk Maya
httpgitgithub - Patronus AI - Test, evaluate, and optimize AI agents and RAG apps
httpaigitgithub - PayMCP (Python & TypeScript) - Lightweight payments layer for MCP servers: turn tools into paid endpoints with a two-line decorator. PyPI · npm · TS repo
httpaigitgithub - PayPal 🏠 📇 - The PayPal Model Context Protocol server allows you to integrate with PayPal APIs through function calling. This protocol supports various tools to interact with different PayPal services.
apihttpgitgithub - pdavis68/RepoMapper 🐧 🪟 🍎 - An MCP server (and command-line tool) to provide a dynamic map of chat-related files from the repository with their function prototypes and related files in order of relevance. Based on the "Repo Map" functionality in Aider.chat
filehttpaigitgithub - PDF reader MCP - MCP server to read and search text in a local PDF file.
filelocalhttpgitgithub - PDF Tools MCP - Comprehensive PDF manipulation toolkit (merge, split, encrypt, optimize and much more)
httpaigitgithub - PDMT - Pragmatic Deterministic MCP Templating - High-performance deterministic templating library with comprehensive todo validation, quality enforcement, and 0.0 temperature generation for reproducible outputs.
httpaimlgitgithub - Peacock for VS Code - MCP Server for the Peacock extension for VS Code, coloring your world, one Code editor at a time. The main goal of the project is to show how an MCP server can be used to interact with APIs.
apihttpaigitgithub - Pearch-ai/mcppearch 🎖️ 🐍 ☁️ 🏠 - Best people search engine that reduces the time spent on talent discovery
httpaigitgithub - Pearl - Official MCP Server to interact with Pearl API. Connect your AI Agents with 12,000+ certified experts instantly.
apihttpai - peek-travel/mcp-intro ☁️ 🍎 🪟 🐧 🏠 ☁️ - Remote MCP Server for discovering and planning experiences, at home and on vacation
remotehttpgitgithub - Peekaboo 🏠 - a macOS-only MCP server that enables AI agents to capture screenshots of applications, or the entire system.
httpaigitgithub - Peliqan 🏠 - Data platform with ETL and built-in data warehouse, access all business applications (ERP, CRM, Accounting etc.) via MCP and run queries on your business data.
httpgitgithub - Perl SDK - An SDK for building MCP servers and clients with the Perl programming language.
httpgitgithub - perplexity-mcp 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install gabelul/perplexity-mcp - perplexity-mcp-rb 💎 🏠 - Ruby-based
webhttpgitgithubrubygit clone https://github.com/funwarioisii/perplexity-mcp-rb - persistproc - MCP server + command line tool that allows agents to see & control long-running processes like web servers.
webhttpgitgithub - petel-mcp 🏠 - MCP server for teachers accessing PETEL
mcpservergit clone https://github.com/nadavkav/petel-mcp - peterparker57_clarion-builder-mcp-server 🏠 - Mirror of https://github.com/peterparker57/clarion-builder-mcp-server
mcpserverhttpgit clone https://github.com/MCP-Mirror/peterparker57_clarion-builder-mcp-server - Pexels - A MCP server providing access to Pexels Free Image API, enabling seamless search, retrieval, and download of high-quality royalty-free images.
apihttpmlgitgithub - Pharos - Unofficial MCP server for the Pharos database by the National Center for Advancing Translational Sciences (NCATS), providing access to target, drug, and disease information for drug discovery research.
databasehttpgitgithub - phisanti/MCPR 🏠 🍎 🪟 🐧 🏠 - Model Context Protocol for R: enables AI agents to participate in interactive live R sessions.
httpaigitgithub - PHP MCP Client - Core PHP implementation for the Model Context Protocol (MCP) Client
httpgitgithub - PHP MCP SDK
httpgitgithub - PhungXuanAnh/selenium-mcp-server 🐍 🏠 🍎 🪟 🐧 🏠 - A Model Context Protocol server providing web automation capabilities through Selenium WebDriver
webhttpgitgithub - pi22by7/In-Memoria 📇 🦀 🏠 🍎 🐧 🪟 🏠 - Persistent intelligence infrastructure for agentic development that gives AI coding assistants cumulative memory and pattern learning. Hybrid TypeScript/Rust implementation with local-first storage using SQLite + SurrealDB for semantic analysis and incremental codebase understanding.
localhttpsqliteaigit - pibblokto/cert-manager-mcp-server 🐍 🍎/🐧 ☁️ 🏠 - mcp server for cert-manager management and troubleshooting
httpgitgithub - picahq/mcp 🎖️ 🦀 📇 ☁️ 🏠 - One MCP for all your integrations — powered by Pica, the infrastructure for intelligent, collaborative agents.
httpgitgithub - PipedreamHQ/pipedream ☁️ 🏠 🏠 📇 - Connect with 2,500 APIs with 8,000+ prebuilt tools, and manage servers for your users, in your own app.
apihttpgitgithub - pj8/backlog-mcp-server 🏠 - Facilitates seamless integration with Backlog for task management through MCP server capabilities.
httpmlgitgithub - Plane 🏠 📇 - The official Plane MCP server provides integration with Plane APIs, enabling full AI automation of Plane projects, work items, cycles and more.
apihttpaigitgithub - Playwright Wizard - Step-by-step wizard for generating Playwright E2E tests with best practices.
httpgitgithub - playwright-mcp-demo 🏠 - mcp server demo project
mcpservergit clone https://github.com/bmanjunath/playwright-mcp-demo - pnz-mcp-server 📘 🏠 📇 - TypeScript-based
apihttpmlgitgithubnpm install apimatic/pnz-mcp-server - poem_mcp 🏠 - A MCP server provide knowlarge about ancient Chinese
mcpservergit clone https://github.com/charlesix59/poem_mcp - Pollinations 🏠 - Multimodal MCP server for generating images, audio, and text with no authentication required
authhttpgitgithub - portfolio-mcp-server 📜 🏠 📇 - Node.js-based
apiweblocalhttpgitnpm install jarondonp/portfolio-mcp-server - PostgreSQL - Read-only database access with schema inspection.
databasehttppostgresaigit - PostgreSQL - A PostgreSQL MCP server offering dual HTTP/Stdio transports for database schema inspection and read-only query execution with session management and Podman(or Docker) support.
databasehttppostgresdockergit - Postman 🏠 ☁️ 📇 - Postman’s remote MCP server connects AI agents, assistants, and chatbots directly to your APIs on Postman.
apiremotehttpaigit - Postman API - Manage your Postman resources using the Postman API.
apihttpgitgithub - postman-mcp-server 🏠 - PostMan MCP Server
mcpservergit clone https://github.com/sawantudayan/postman-mcp-server - Pradumnasaraf/aviationstack-mcp 🐍 ☁️ 🍎 🪟 🐧 🏠 📇 - An MCP server using the AviationStack API to fetch real-time flight data including airline flights, airport schedules, future flights and aircraft types.
apihttpaigitgithub - Pratyay/mac-monitor-mcp 🐍 🏠 🍎 🏠 - Identifies resource-intensive processes on macOS and provides performance improvement suggestions.
httpgitgithub - Prefect - MCP Server for workflow orchestration and ELT/ETL with Prefect Server, and Prefect Cloud [https://www.prefect.io/] using the prefect python client.
httpgitgithub - ProdEAI 🏠 - Your 24/7 production engineer that preserves context across multiple codebases Prode.ai.
httpaigitgithub - Project Manager 🏠 - Hierarchical task management (ideas → epics → tasks) with CLI dashboard
httpgitgithub - Prometheus (Golang) - A Prometheus MCP server with full API support for comprehensive management and deep interaction with Prometheus beyond basic query support. Written in go, it is a single binary install that is capable of STDIO, SSE, and HTTP transports for complex deployments.
apihttpgitgithub - Prometheus (TypeScript) - Enable AI assistants to query Prometheus using natural language with TypeScript implementation.
httpaigitgithub - PromptExecution/cratedocs-mcp 🦀 🏠 🏠 📇 - Outputs short-form Rust crate derived traits,interfaces, etc. from AST (uses same api as rust-analyzer), output limits (token estimation) & crate docs w/regex stripping.
apihttpaigitgithub - promptexecution/just-mcp 🦀 🏠 🏠 - Justfile integration that enables LLMs to execute any CLI or script commands with parameters safely and easily, with environment variable support and comprehensive testing.
filehttpllmgitgithub - prospeo-mcp-server 📜 🏠 📇 - prospeo-mcp-server (Node.js-based)
apifilehttpaigitnpm install Meerkats-Ai/prospeo-mcp-server - pskill9/web-search 📇 🏠 🏠 📇 - An MCP server that enables free web searching using Google search results, with no API keys required.
apiwebhttpgitgithub - pskill9/website-downloader 🗄️ 🚀 🏠 - This MCP server provides a tool to download entire websites using wget. It preserves the website structure and converts links to work locally.
weblocalhttpgitgithub - PubChem - extract drug information from pubchem API.
apihttpgitgithub - PubChem-MCP 🐍 🏠 - Python-based
httpgitgithubpythonpip install git+https://github.com/BioContext/PubChem-MCP - Public APIs MCP 🏠 📇 - Search for free APIs using MCP.
apihttpgitgithub - PubMed - Enable AI assistants to search, access, and analyze PubMed articles through a simple MCP interface.
httpaigitgithub - PulseMCP (API) - Community hub & weekly newsletter for discovering MCP servers, clients, articles, and news by Tadas Antanavicius, Mike Coughlin, and Ravina Patel
apihttpgitgithub - Puppeteer - Browser automation and web scraping
browserautomationscraping - Puppeteer - Browser automation and web scraping.
apiwebhttpaigit - Puppeteer vision - Use Puppeteer to browse a webpage and return a high quality Markdown. Use AI vision capabilities to handle cookies, captchas, and other interactive elements automatically.
webhttpaigitgithub - py-mcp-qdrant-rag (by amornpan) - A Model Context Protocol server implementation that provides RAG capabilities through Qdrant vector database integration, enabling AI agents to perform semantic search and document retrieval with local or cloud-based embedding generation support across Mac, Linux, and Windows platforms.
databaselocalhttpaigit - pydantic/pydantic-ai/mcp-run-python - Run Python code in a secure sandbox via MCP tool calls, powered by Deno and Pyodide
httpaigitgithub - pydantic/pydantic-ai/mcp-run-python 🐍 🏠- Run Python code in a secure sandbox via MCP tool calls 🏠
httpaigitgithub - Python CLI MCP - Interact with local Python command line applications.
localhttpgitgithub - Python MCP SDK
httpgitgithub - pythonanywhere/pythonanywhere-mcp-server 🐍 🏠 🏠 - MCP server implementation for PythonAnywhere cloud platform.
httpgitgithub - qa-use - Browser automation and QA testing capabilities. This server integrates with desplega.ai to offer automated testing, session monitoring, batch test execution, and intelligent test guidance using the AAA framework.
httpaigitgithubmonitoring - qrcode-mcp 🏠 - A Model Context Protocol (MCP) server for generating customizable QR codes - satware AG implementation
mcpservergit clone https://github.com/jane-alesi/qrcode-mcp - QuantConnect - QuantConnect Algorithmic Trading Platform Orchestration MCP - Agentic LLM Driven Trading Strategy Design, Research & Implementation.
httpllmgitgithub - quickbooks-mcp-server 🏠
git clone https://github.com/ravi-bytes/quickbooks-mcp-server - quiz-mcp-server 🏠 - Stand up a MCPserver for quiz app for kids
mcpservergit clone https://github.com/sathana87/quiz-mcp-server - R mcptools - An R SDK for creating R-based MCP servers and retrieving functionality from third-party MCP servers as R functions.
httpgitgithub - r-huijts/ethics-check-mcp 🐍 🏠 🏠 - MCP server for comprehensive ethical analysis of AI conversations, detecting bias, harmful content, and providing critical thinking assessments with automated pattern learning
httpaigitgithub - r/mcp - A Reddit community dedicated to MCP by Frank Fiegel
httpgitgithub - r/mcp Reddit
http - r/modelcontextprotocol – A Model Context Protocol community Reddit page - discuss ideas, get answers to your questions, network with like-minded people, and showcase your projects! by Alex Andru
httpgitgithub - RAE - MPC Server to connect your preferred model with rae-api.com, Roya Academy of Spanish Dictionary
apihttpgitgithub - raftt-mcp-server 🏠 - MCP server for raftt claude integration
mcpservergit clone https://github.com/vrvaderom/raftt-mcp-server - RAG Local - This MCP server for storing and retrieving text passages locally based on their semantic meaning.
localhttpgitgithub - RagaviManohar/Ragavi-ImmoBricks 🏠 - Facilitates communication between AI coding tools and Figma design files for efficient code generation based on design specifications.
filehttpaigitgithub - Rakibulislamsarkar/twitter-mcp 🏠 - Facilitates interaction with Twitter for posting and searching tweets via a Model Context Protocol server.
httpgitgithub - rakuten-hotel-search-mcp 📘 🏠 📇 - TypeScript-based
apihttpaigitgithubnpm install achel-b8/rakuten-hotel-search-mcp - RCSB PDB - Unofficial MCP server for the Research Collaboratory for Structural Bioinformatics Protein Data Bank (RCSB PDB), providing access to 3D protein structures, experimental data, and structural bioinformatics information.
httpgitgithub - Redbee - Redbee MCP server that provides support for interacting with Redbee API.
apihttpgitgithub - Reddit Community
http - Redfish - Redfish MCP server that provides support for interacting with DMTF Redfish API.
apihttpgitgithub - Redis - Interact with Redis key-value stores.
httpredisaigitgithub - Reed Jobs - Search and retrieve job listings from Reed.co.uk.
httpgitgithub - reference-mcp-config 🏠 - This is a reference implementation of the mcp config to show different use cases for how to configure MCP servers with an app that hosts an MCP Client (like Claude Desktop)
mcpservergit clone https://github.com/bcdennis/reference-mcp-config - Regenerating-World/pix-mcp 📇 ☁️ 🏠 - Generate Pix QR codes and copy-paste strings with fallback across multiple providers (Efí, Cielo, etc.) for Brazilian instant payments.
httpgitgithub - Reloaderoo 🏠 - A local MCP server for developers that mirrors your in-development MCP server, allowing seamless restarts and tool updates so you can build, test, and iterate on your MCP server within the same AI session without interruption.
localresthttpaiml - Reminder 🏠 - MCP server for scheduling and triggering reminders via Slack or Telegram.
httpgitgithubslacktelegram - remote-mcp-github-oauth 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpgitnpm install rose201107059/remote-mcp-github-oauth - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install aYenx/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpgitnpm install kaeosdesign/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpgitnpm install Ropz3/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpgitnpm install roboulos/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install anandkumarpatel/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpgitnpm install ayushps1/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install G1L1-Tech/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install Humboldtian/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install bfollington/remote-mcp-server - remote-mcp-server 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpmlnpm install LiTschii/remote-mcp-server - Renamify - Smart, case-aware search & replace for codebases. Provides atomic renaming of symbols, files, and directories with full undo/redo. The MCP server lets AI assistants plan, preview, and apply rename operations safely, handling all naming conventions (snakecase, camelCase, PascalCase, etc.) automatically.
filehttpaigitgithub - Render - The official Render MCP server: spin up new services, run queries against your databases, and debug rapidly with direct access to service metrics and logs.
apidatabasehttpaimetrics - repro-root-mcp-issue 📘 🏠 ☁️ - TypeScript-based
remoteauthoauthhttpgitnpm install irvinebroque/repro-root-mcp-issue - Resend - Send email using Resend services
httpaigitgithubemail - RevenueCat - Manage your In-app-purchases in RevenueCat without leaving your AI coding environment.
httpai - Revit - Connect and interact with your Revit models live
httpaigitgithubrevit - Revit MCP - A service implementing the MCP protocol for Autodesk Revit.
httpgitgithub - reza-gholizade/k8s-mcp-server 🏎️ ☁️/🏠 🏠 📇 - A Kubernetes Model Context Protocol (MCP) server that provides tools for interacting with Kubernetes clusters through a standardized interface, including API resource discovery, resource management, pod logs, metrics, and events.
apihttpkubernetesgitgithub - rianvdm/remote-mcp-server 🏠 ☁️ - Deploy a remote MCP server on Cloudflare Workers with OAuth login and connect it to Claude Desktop for seamless tool integration.
remoteauthoauthhttpml - rinadelph/Agent-MCP 🐍 🏠 🏠 - A framework for creating multi-agent systems using MCP for coordinated AI collaboration, featuring task management, shared context, and RAG capabilities.
httpaigitgithub - rishijatia/fantasy-pl-mcp 🐍 ☁️ 🏠 - An MCP server for real-time Fantasy Premier League data and analysis tools.
httpgitgithub - roastedculti/metoro-mcp-server 🏠 - Facilitates interaction with Kubernetes clusters through the Claude Desktop App by leveraging the Model Context Protocol.
httpkubernetesgitgithub - RobSpectre/mvf1 🐍 ☁️ 🏠 - MCP server that controls MultiViewer, an app for watching motorsports like Formula 1, World Endurance Championship, IndyCar and others.
httpgitgithub - rocketreach-mcp-server 📜 🏠 📇 - rocketreach-mcp-server
apihttpaigitgithubnpm install Meerkats-Ai/rocketreach-mcp-server - Rohlik - Shop groceries across the Rohlik Group platforms (Rohlik.cz, Knuspr.de, Gurkerl.at, Kifli.hu, Sezamo.ro)
httpgitgithub - Rootdata-MCP 📜 🏠 - Node.js-based
httpaigitgithubjavascriptnpm install nvmmonkey/Rootdata-MCP - rossshannon/Weekly-Weather-mcp 🐍 ☁️ 🏠 - Weekly Weather MCP server which returns 7 full days of detailed weather forecasts anywhere in the world.
httpaigitgithub - rotatingshov/go-mcp-mysql 🏠 - Effortlessly manage MySQL databases with a Go-based MCP server, offering CRUD operations and automation without the need for Node.js or Python.
databasehttpmysqlgitgithub - Routine - MCP server to interact with Routine: calendars, tasks, notes, etc.
httpgitgithub - rrmistry/tilt-mcp 🐍 🏠 🍎 🪟 🐧 🏠 - A Model Context Protocol server that integrates with Tilt to provide programmatic access to Tilt resources, logs, and management operations for Kubernetes development environments.
httpkubernetesgitgithub - Rube - Rube is a Model Context Protocol (MCP) server that connects your AI tools to 500+ apps like Gmail, Slack, GitHub, and Notion. Simply install it in your AI client, authenticate once with your apps, and start asking your AI to perform real actions like "Send an email" or "Create a task."
authhttpaigitgithub - Ruby MCP SDK
httpgitgithub - run-sql-connectorx 🏠 - Execute SQL (PostgreSQL, MariaDB, BigQuery, MS SQL Server, RedShift, etc.) via ConnectorX and stream results to CSV/Parquet. MCP tool: runsql.
httpcsvpostgresgitgithub - rundeck-mcp-server 📜 🏠 - Node.js-based
httpaimlgitgithubnpm install vanisoul/rundeck-mcp-server - rusiaaman/wcgw 🐍 🏠 🏠 - Autonomous shell execution, computer control and coding agent. (Mac)
httpaigitgithub - Rust MCP SDK
httpgitgithub - Ryuhei-So/mermaid-cli-server 🏠 - Generates PNG images from Mermaid markdown using the official mermaid-cli.
httpaigitgithub - SafetySearch - Real-time FDA food safety data: recalls, adverse events, analysis.
httpgitgithub - SaintDoresh/Crypto-Trader-MCP-ClaudeDesktop 🐍 ☁️ 🏠 📇 - An MCP tool that provides cryptocurrency market data using the CoinGecko API.
apihttpaigitgithub - SaintDoresh/Weather-MCP-ClaudeDesktop 🐍 ☁️ 🏠 📇 - An MCP tool that provides real-time weather data, forecasts, and historical weather information using the OpenWeatherMap API.
apihttpaigitgithub - SaintDoresh/YFinance-Trader-MCP-ClaudeDesktop 🐍 ☁️ 🏠 📇 - An MCP tool that provides stock market data and analysis using the Yahoo Finance API.
apihttpaigitgithub - Salaah MCP 🏠 📇 - FastAPI and MCP service providing Islamic prayer times and other useful calculations.
apihttpgitgithub - salesforce-mcp 🏠 - Server which will let mcp client interact with Salesforce.
mcpservergit clone https://github.com/kiran-machhewar/salesforce-mcp - sample_mcp_pokemon 📘 🏠 📇 - TypeScript-based
apihttpgitgithubtypescriptnpm install 8tako8tako8/sample_mcp_pokemon - sample-kt-mcp-server 🎯 🏠 - A plactice of MCP (Model Context Protocol) Server by kotlin.
kotlinmcpservergit clone https://github.com/nekorush14/sample-kt-mcp-server - sankhodeep/android-adb-controller 🏠 - Facilitates AI-driven control of Android devices through ADB commands, enabling functionalities like device listing and screen tapping.
httpaigitgithub - SAP ABAP MCP Server SDK - Build SAP ABAP based MCP servers. ABAP 7.52 based with 7.02 downport; runs on R/3 & S/4HANA on-premises, currently not cloud-ready.
httpaigitgithub - sascharo/gxtract 🐍 ☁️ 🪟 🐧 🍎 🏠 - GXtract is a MCP server designed to integrate with VS Code and other compatible editors (documentation: sascharo.github.io/gxtract). It provides a suite of tools for interacting with the GroundX platform, enabling you to leverage its powerful document understanding capabilities directly within your development environment.
httpgitgithub - Scaffold 🏠 - Scaffold is a Retrieval-Augmented Generation (RAG) system designed to structural understanding of large codebases. It transforms your source code into a living knowledge graph, allowing for precise, context-aware interactions that go far beyond simple file retrieval.
filehttpgitgithub - scan-mcp 🏠 - Minimal MCP server for scanner capture (ADF/duplex/page-size); typed tools; JSON Schema–validated I/O; multipage assembly; Node 22 + SANE.
httpjsongitgithub - Scanova MCP Server - MCP server for creating and managing QR codes using the Scanova API. Provides tools for generating, managing, and downloading QR codes.
apihttpgitgithub - SchemaCrawler - Connect to any relational database, and be able to get valid SQL, and ask questions like what does a certain column prefix mean.
databasehttpaigitgithub - ScrapeGraphAI 🏠 📇 - AI-powered web scraping library that creates scraping pipelines using natural language.- ScrapeGraphAI
apiwebhttpaigit - Scrapezy 🏠 - Turn websites into datasets with Scrapezy
webhttpgitgithub - Screeny - Privacy-first macOS MCP server that provides visual context for AI agents through window screenshots
httpaigitgithub - ScriptFlow - Transform complex, repetitive AI interactions into persistent, executable scripts with comprehensive script management (add, edit, remove, list, search, execute) and multi-language support (Bash, Python, Node.js, TypeScript).
httpaigitgithub - scryfall-mcp 🐍 🏠 📇 - MCP server for the Scryfall API
apihttpaigitgithubpip install git+https://github.com/dbeltra/scryfall-mcp - Search MCP Server - Recommends the most relevant MCP servers based on the client's query by searching this README file.
filehttpgitgithub - search-mcp 🏠 - This MCP server is used to search for other MCPs.
mcpservergit clone https://github.com/wsszh01111/search-mcp - searchcraft-inc/searchcraft-mcp-server 🎖️ 📇 ☁️ 🏠 - Official MCP server for managing Searchcraft clusters, creating a search index, generating an index dynamically given a data file and for easily importing data into a search index given a feed or local json file.
filelocalhttpjsongit - sebastien-le-paris/project-rules 🏠 - Facilitates the integration of external tools and data sources with Cursor through the Model Context Protocol, enhancing AI project rule management and tool execution.
httpaigitgithub - SEC EDGAR - (by Stefano Amorelli) A community Model Context Protocol Server to access financial filings and data through the U.S. Securities and Exchange Commission (SEC) Electronic Data Gathering, Analysis, and Retrieval (EDGAR) database
databasehttpgitgithub - Secure Fetch 🏠 - Secure fetch to prevent access to local resources
localhttpgitgithub - SendGrid - An MCP server to integrate with SendGrid's API, enabling AI assistants (like Claude, ChatGPT, etc.) to send emails, manage templates, and track email statistics.
apihttpaigitgithub - Sentry - Retrieving and analyzing issues from Sentry.io
sentrymonitoringerror-tracking - Sentry - Retrieving and analyzing issues from Sentry.io.
httpaigitgithub - Sequential Thinking - Dynamic and reflective problem-solving through thought sequences.
- Sequential Thinking 🏠 - Dynamic and reflective problem-solving through thought sequences
httpaigitgithub - Sergiolm17/genius-mcp-server 🏠 📇 - Facilitates interaction with the Genius API for searching lyrics, artists, and song details via MCP client applications.
apihttpaigitgithub - serkan-ozal/driflyte-mcp-server 🎖️ 📇 ☁️ 🏠 🏠 - The Driflyte MCP Server exposes tools that allow AI assistants to query and retrieve topic-specific knowledge from recursively crawled and indexed web pages.
webhttpaigitgithub - Serper - An MCP server that performs Google searches using Serper.
httpgitgithub - Server install guide Install This MCP 🏠
httpgitgithub - server-mcp 🏠 - Server MCP Info Crociere - Taoticket
mcpservergit clone https://github.com/fpucci-git/server-mcp - service-hero/housecallpro-mcp-server 🏠 ☁️ - A remote MCP server deployed on Cloudflare Workers, enabling OAuth login and integration with Claude Desktop for tool invocation.
remoteauthoauthhttpgit - Setup Claude Desktop App to Use a SQLite Database
databasehttpsqlite - Shadcn Registry Manager 🏠 ☁️ - MCP server for Shadcn UI, enabling automated, remote, or containerized project management via local or remote registries.
remotelocalhttpaigit - ShaderToy - This MCP server lets LLMs to interact with the ShaderToy API, allowing LLMs to learn from compute shaders examples and enabling them to create complex GLSL shaders that they are previously not capable of.
apihttpllmgitgithub - shardeum-mcp-server 📜 🏠 - Node.js-based
httpaimlgitgithubnpm install abdulazeem-tk4vr/shardeum-mcp-server - sharepoint-mcp 📘 🏠 📇 - WIP (TypeScript-based)
apihttpgitgithubtypescriptnpm install BCusack/sharepoint-mcp - ShareSeer - MCP to Access SEC filings, financials & insider trading data in real time using ShareSeer
httpgitgithub - shariqriazz/upsplash-mcp-server 🏠 📇 - Facilitates interaction with the Unsplash API for photo searching and downloading through MCP tools.
apihttpgitgithub - shaydo-deriv/go-archer 🐹 🏠 - Go Archer provides a visual representation of package dependencies and can operate as an MCP server for dependency analysis.
httpgitgithub - sheffler/mcp-server-lims 🏠 - Facilitates AI-driven management of laboratory workflows by simulating instrument data processing and integrating with MCP tools.
httpaigitgithub - Shell - Give hands to AI. MCP server to run shell commands securely, auditably, and on demand
httpaigitgithubdocker - Shinkai is a two click install AI manager (Local and Remote) that allows you to create AI agents in 5 minutes or less using a simple UI. Agents and tools are exposed as an MCP Server. 🏠 ☁️
remotelocalhttpaigit - Shodan MCP - MCP server to interact with Shodan
httpgitgithub - Shopify Storefront - Unofficial MCP server that allows AI agents to discover Shopify storefronts and interact with them to fetch products, collections, and other store data through the Storefront API.
apihttpaigitgithub - Shopify/dev-mcp 📇 ☁️ 🏠 - Model Context Protocol (MCP) server that interacts with Shopify Dev.
httpgitgithub - ShreyeshArangath/pay-up 🏠 - PayUp facilitates trip expense management as a MCP server, offering a personalized alternative to Splitwise.
httpgitgithub - SiddheshDongare/GIT-Pilot 🏠 - GIT-Pilot streamlines GitHub management with a FastMCP-based server, offering secure and efficient automation for repository, pull request, and issue operations.
httpmlgitgithub - simple-time-mcp-server 🏠 - Un serveur MCP simple qui fournit un service de l'heure actuelle
mcpgit clone https://github.com/Anragde/simple-time-mcp-server - sinanefeozler/reddit-summarizer-mcp 🐍 🏠 ☁️ 🏠 - MCP server for summarizing users's Reddit homepage or any subreddit based on posts and comments.
httpgitgithub - sinkect/unity-mcp-for-server 📘 🏠 - Facilitates the integration of Unity with MCP through a Node.js server, enabling seamless communication and debugging within the Unity Editor.
httpmlgitgithub - skedgo/tripgo-mcp-server 📇 ☁️ 🏠 📇 - Provides tools from the TripGo API for multi-modal trip planning, transport locations, and public transport departures, including real-time information.
apihttpgitgithub - skeet-build/opensearch 🏠 - Facilitates read-only access to OpenSearch clusters, allowing LLMs to inspect indices and execute queries.
httpllmgitgithub - Slack - Channel management and messaging capabilities. Now maintained by Zencoder
httpaigitgithubslack - Slack - Slack MCP server which supports both stdio and Streamable HTTP transports. Extended from the original Anthropic's implementation which is now archived
httpaianthropicgitgithub - Slidespeak - Create PowerPoint presentations using the Slidespeak API.
apihttpgitgithubai - smartlead-mcp-server 📜 🏠 - smartlead-mcp-server typescript
httpaigitgithubjavascriptnpm install Meerkats-Ai/smartlead-mcp-server - Smithery - A registry of MCP servers to find the right tools for your LLM agents by Henry Mao
httpaillmgitgithub - Snowflake - Open-source MCP server for Snowflake from official Snowflake-Labs supports prompting Cortex Agents, querying structured & unstructured data, object management, SQL execution, semantic view querying, and more. RBAC, fine-grained CRUD controls, and all authentication methods supported.
authhttpaigitgithub - Snowflake Cortex MCP Server -This Snowflake MCP server provides tooling for Snowflake Cortex AI features, bringing these capabilities to the MCP ecosystem. When connected to an MCP Client (e.g. Claude for Desktop, fast-agent, Agentic Orchestration Framework), users can leverage these Cortex AI features.
httpaigitgithub - Solana Agent Kit - This MCP server enables LLMs to interact with the Solana blockchain with help of Solana Agent Kit by SendAI, allowing for 40+ protocol actions and growing
httpaillmgitgithub - Solr MCP - This MCP server offers a basic functionality to perform a search on Solr servers.
httpgitgithub - Sonatype MCP Server 🏠 - MCP for Sonatype Nexus Repository Manager and Sonatype Repository Firewall. Manage your DevSecOps practices through AI-assisted Workflows.
httpaigitgithub - Source to Knowledge Base - Convert source code repositories into searchable knowledge bases with AI-powered search using GPT-5, intelligent chunking, and OpenAI embeddings for semantic code understanding.
httpaiopenaigitgithub - Sourcerer - MCP for semantic code search & navigation that reduces token waste.
httpgitgithub - spacecode-ai/SpaceBridge-MCP 🐍 🏠 🍎 🐧 🏠 - Bring structure and preserve context in vibe coding by automatically tracking issues.
httpaigitgithub - Specbridge - Easily turn your OpenAPI specs into MCP Tools.
apihttpgitgithub - Spotify Player 🏠 - Control Spotify playback, queue, volume and playlists from Claude/Cursor via MCP. (Python)
httpgitgithub - spotify_mcp_server_claude 🏠 - a custom mcp server built using mcp framework
mcpservergit clone https://github.com/himanshuverma8/spotify_mcp_server_claude - Spring AI MCP Client - Provides auto-configuration for MCP client functionality in Spring Boot applications.
apihttpaiml - Spring AI MCP Server - Provides auto-configuration for setting up an MCP server in Spring Boot applications.
apihttpaiml - Spring_MCP_Server ☕ 🏠 - A basic implementation of MCP server using Spring Boot
httpaigitgithubjavagit clone https://github.com/deepanshu-rawat6/Spring_MCP_Server - SQLite - Database interaction and business intelligence capabilities.
databasehttpsqliteaigit - SQLite 🏠 - MCP server for SQLite files. Supports Datasette-compatible metadata!
filehttpsqlitegitgithub - Squad AI - Product‑discovery and strategy platform integration. Create, query and update opportunities, solutions, outcomes, requirements and feedback from any MCP‑aware LLM.
httpaillmgitgithub - Square 🏠 - A Model Context Protocol (MCP) server for square
httpgitgithub - srinath1510/alltrails-mcp-server 🐍 ☁️ 🏠 - A MCP server that provides access to AllTrails data, allowing you to search for hiking trails and get detailed trail information
httpaigitgithub - SSH MCP Server - A production-ready Model Context Protocol server for SSH automation with background execution, file transfers, and comprehensive timeout protection. Features structured output, progress tracking, and enterprise-grade testing (87% coverage).
filehttpgitgithub - stack-chan/stack-chan 📇 📟 🏠 - A JavaScript-driven M5Stack-embedded super-kawaii robot with MCP server functionality for AI-controlled interactions and emotions.
httpaigitgithub - stadiamaps/stadiamaps-mcp-server-ts 📇 ☁️ 🏠 📇 - A MCP server for Stadia Maps' Location APIs - Lookup addresses, places with geocoding, find time zones, create routes and static maps
apihttpgitgithub - stagehand-mcp-report 🏠 - Report on Stagehand and MCP Server
mcpservergit clone https://github.com/operator-bonk-nuggets/stagehand-mcp-report - stakpak/mcp 🦀 🏠 - MCP Server for interacting, editing and generating code for Terraform, Kubernetes, GithubActions and Dockerfile.
filehttpdockerkubernetesgit - Standard Korean Dictionary - Search the dictionary using API
apihttpgitgithub - stape-io/google-tag-manager-mcp-server 📇 ☁️ 🏠 ☁️ 📇 - This server supports remote MCP connections, includes built-in Google OAuth, and provide an interface to the Google Tag Manager API.
apiremoteauthoauthhttp - stape-io/stape-mcp-server 📇 ☁️ 🏠 📇 - This project implements an MCP (Model Context Protocol) server for the Stape platform. It allows interaction with the Stape API using AI assistants like Claude or AI-powered IDEs like Cursor.
apihttpaigitgithub - Star Wars -MCP Server for the SWAPI Star Wars API. The main goal of the project is to show how an MCP server can be used to interact with APIs.
apihttpaigitgithub - Starling Bank - View and manage Starling Bank accounts and transactions through the Starling Bank API, including account balance checking and transaction history.
apihttpgitgithub - Starwind UI - This MCP provides relevant commands, documentation, and other information to allow LLMs to take full advantage of Starwind UI's open source Astro components.
httpllmgitgithub - stass/exif-mcp 📇 🏠 🐧 🍎 🪟 🏠 - A MCP server that allows one to examine image metadata like EXIF, XMP, JFIF and GPS. This provides foundation for LLM-powered search and analysis of photo librares and image collections.
httpllmgitgithub - Stellar - This MCP server enables LLMs to interact with the Stellar blockchain to create accounts, check address balances, analyze transactions, view transaction history, mint new assets, interact with smart contracts and much more.
httpaillmgitgithub - stevengonsalvez/mcp-todoist 🏠 - Integrates Todoist with language models for seamless task management through natural language commands.
httpmlgitgithub - Stitch AI - Knowledge management system for AI agents with memory space creation and retrieval capabilities.
httpaigitgithub - Stockfish - MCP server connecting AI systems to Stockfish chess engine
httpaigitgithub - stolostron/server-foundation-dev-context 🏠 - Facilitates the setup and management of server foundation repositories through an MCP server integration with code agents.
httpgitgithub - Storybook (by Stefano Amorelli) - Interact with Storybook component libraries, enabling component discovery, story management, prop inspection, and visual testing across different viewports.
httpgitgithub - strava-mcp 🏠 - MCP server for strava
mcpservergit clone https://github.com/jeremysilva1098/strava-mcp - subelsky/bundlermcp 💎 🏠 🏠 - Enables agents to query local information about dependencies in a Ruby project's Gemfile.
filelocalhttpgitgithub - Substack/Medium - Connect Claude to your Substack/Medium writing, enabling semantic search and analysis of your published content.
httpgitgithub - supabase-mcp 🐍 🏠 📇 - Supabase MCP Integration
apidatabasehttpmlgitpip install git+https://github.com/leeb003/supabase-mcp - Svelte Documentation 🏠 ☁️ - Remote server (SSE/Streamable) for the latest Svelte and SvelteKit documentation
remotehttpllmgitgithub - Svtter/chatdb 🏠 - ChatDB serves as a memory layer for GPT by recording conversations in SQLite, enhancing conversational context retention.
httpsqlitegitgithub - Swift MCP SDK
httpgitgithub - sxhxliang/mcp-security-scan 🏠 - A Rust application for scanning and verifying the security of Model Context Protocol server configurations, prompts, resources, and tools.
httpgitgithub - synackpwn/enrichment-mcp 🏠 - Enhances security data by enriching observables like IP addresses and domain names using third-party services.
httpaigitgithub - System Health - The MCP (Multi-Channel Protocol) System Health Monitoring is a robust, real-time monitoring solution designed to provide comprehensive health metrics and alerts for remote Linux servers.
remotehttpgitgithubmonitoring - SystemSage - A powerful, cross-platform system management and monitoring tool for Windows, Linux, and macOS.
httpgitgithubmonitoring - takumi0706/google-calendar-mcp 📇 ☁️ 🏠 📇 - An MCP server to interface with the Google Calendar API. Based on TypeScript.
apihttpgitgithub - TalentoHQ - Connect to the TalentoHQ HR software via MCP. Transform your organization with the AI first HR software.
httpai - Talk To Figma via Claude - TMCP server that provides seamless Figma integration specifically for Claude Desktop, enabling design creation, modification, and real-time collaboration through natural language commands.
httpmlgitgithub - TAM MCP Server - Market research and business intelligence with TAM/SAM calculations and integration across 8 economic data sources: Alpha Vantage, BLS, Census Bureau, FRED, IMF, Nasdaq Data Link, OECD, and World Bank.
httpaigitgithub - Task Orchestrator 🏠 - AI-powered task orchestration and workflow automation with specialized agent roles, intelligent task decomposition, and seamless integration across Claude Desktop, Cursor IDE, Windsurf, and VS Code.
httpaimlgitgithub - Tasks - An efficient task manager. Designed to minimize tool confusion and maximize LLM budget efficiency while providing powerful search, filtering, and organization capabilities across multiple file formats (Markdown, JSON, YAML)
filehttpjsonmlllm - tb-mcp-geo 📘 🏠 - An MCP service for getting user geolocation information
httpaigitgithubtypescriptnpm install tb280320889/tb-mcp-geo - TcpSocketMCP - A Model Context Protocol (MCP) server that provides raw TCP socket access, enabling AI models to interact directly with network services using raw TCP Sockets. Supports multiple concurrent connections, buffering of response data and triggering automatic responses.
httpaigitgithub - TeamCity 🏠 - MCP server for TeamCity, integrates with Claude Desktop and Cursor.
httpgitgithub - TechDocsStudio/biel-mcp 📇 ☁️ 🏠 - Let AI tools like Cursor, VS Code, or Claude Desktop answer questions using your product docs. Biel.ai provides the RAG system and MCP server.
httpaigitgithub - tejasPhaveri/custom-instructions 🏠 - Enhances the ultimatememory system with Context7 and Sequential Thinking MCP tools for improved memory management and task execution.
httpgitgithub - Telegram-bot-rcon-for-mcpe-servers 🏠 - Control Minecraft remotely using the RCON Telegram bot
git clone https://github.com/ggg555mc/Telegram-bot-rcon-for-mcpe-servers - Telegram-mcp-server - Access Telegram channels and groups directly in Claude. Features dual-mode operation with API access (100x faster) or web scraping, unlimited post retrieval, and search functionality.
apiwebhttpllmgit - template-mcp-server 🏠 - Template Pattern for Bootstrapping a MCP Server
mcpservergit clone https://github.com/danielscholl/template-mcp-server - tenablemcp 🎯 🏠 - Tenable MCP Server (Kotlin-based)
kotlinmcpservergit clone https://github.com/rajagrawal104/tenablemcp - Text-To-GraphQL 🏠 - MCP server for text-to-graphql, integrates with Claude Desktop and Cursor.
graphqlhttpaigitgithub - the-momentum/apple-health-mcp-server 🐍 🏠 🍎 🪟 🐧 🏠 - An MCP server that provides access to exported data from Apple Health. Data analytics included.
httpgitgithubanalytics - the-momentum/fhir-mcp-server 🐍 🏠 ☁️ 🏠 - MCP Server that connects AI agents to FHIR servers. One example use case is querying patient history in natural language.
httpaigitgithub - the-nine-nation/mini-cursor 🏠 - A lightweight command-line tool enabling Cursor-like programming with AI agents, supporting multi-tool MCP invocation and integration with various LLMs.
httpaillmgitgithub - TheHive MCP Server - An MCP server for TheHive Security Incident Response Platform.
httpgitgithub - TheLunarCompany/lunar#mcpx 📇 🏠 ☁️ 🍎 🪟 🐧 🏠 - MCPX is a production-ready, open-source gateway to manage MCP servers at scale—centralize tool discovery, access controls, call prioritization, and usage tracking to simplify agent workflows.
httpaigitgithub - TheoBrigitte/mcp-time 🏎️ 🏠 🍎 🪟 🐧 🏠 - MCP server which provides utilities to work with time and dates, with natural language, multiple formats and timezone convertion capabilities.
httpgitgithub - theonedev/tod 🏎️ 🏠 🏠 - A MCP server for OneDev for CI/CD pipeline editing, issue workflow automation, and pull request review
httpaigitgithub - Things3 MCP - Things3 task management integration for macOS with comprehensive TODO, project, and tag management.
httpgitgithub - thingsboard-mcp 🏠 - MCP Server for Thingsboard
mcpservergit clone https://github.com/pophalea/thingsboard-mcp-server - Think MCP - Enhances any agent's reasoning capabilities by integrating the think-tools, as described in Anthropic's article.
httpaianthropicgitgithub - Think Node MCP - Enhances any agent's reasoning capabilities by integrating the think-tools, as described in Anthropic's article. (Works with Node)
httpanthropicgitgithub - ThomasMarches/substrate-mcp-rs 🦀 🏠 🏠 - An MCP server implementation to interact with Substrate-based blockchains. Built with Rust and interfacing the subxt crate.
httpaigitgithub - thrash888/terraform-mcp-server 📇 ☁️ 🏠 - Terraform Registry MCP Server for interacting with Terraform registries.
httpgitgithub - tianqitang1/enrichr-mcp-server 📇 ☁️ 🏠 📇 - A MCP server that provides gene set enrichment analysis using the Enrichr API
apihttpgitgithub - Tiberriver256/mcp-server-github-actions 📇 ☁️ 🏠 - MCP server for interacting with GitHub Actions workflows, enabling AI assistants to manage CI/CD pipelines.
httpaigitgithub - Ticket-Generator MCP - A Model Context Protocol (MCP) server implemented in Streamable HTTP transport that allows AI models to interact with the Ticket Generator APIs, enabling fetching active events lists, and generating tickets via 3 different modes.
apihttpaigitgithub - Ticketmaster MCP Server - A Model Context Protocol (MCP) server implemented in Streamable HTTP transport that allows AI models to interact with the Ticketmaster Discovery API, enabling searching events, venues, and attractions.
apihttpaigitgithub - ticktick-mcp 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install TickTeam/ticktick-mcp - Tideways - A Model Context Protocol server that enables AI assistants to query Tideways performance monitoring data and provide conversational performance insights for PHP applications.
httpaigitgithubmonitoring - TigerGraph - A community built MCP server that interacts with TigerGraph Graph Database.
databasehttpgitgithub - tigranbs/mcgravity 📇 🏠 🏠 - A proxy tool for composing multiple MCP servers into one unified endpoint. Scale your AI tools by load balancing requests across multiple MCP servers, similar to how Nginx works for web servers.
webhttpaigitgithub - tiianhk/MaxMSP-MCP-Server 🐍 🏠 🎵 🎥 🏠 - A coding agent for Max (Max/MSP/Jitter), which is a visual programming language for music and multimedia.
httpgitgithub - TikTok Ads - An MCP server for interacting with TikTok advertising platforms for campaign management, performance analytics, audience targeting, creative management, and custom reporting.
httpaigitgithubanalytics - Time - A Model Context Protocol server that provides time and timezone conversion capabilities. This server enables LLMs to get current time information and perform timezone conversions using IANA timezone names, with automatic system timezone detection.
timetimezoneconversion - Time - Time and timezone conversion capabilities.
- Time 🏠 - Time and timezone conversion capabilities
httpaigitgithub - time-mcp-nuget - Get current UTC time in RFC 3339 format (.NET/NuGet implementation).
httpgitgithub - time-mcp-pypi - Get current UTC time in RFC 3339 format (Python/PyPI implementation).
httpgitgithub - tip.md - An MCP server that enables AI assistants to interact with tip.md's crypto tipping functionality, allowing agents or supporters to tip registered developers directly from AI chat interfaces.
httpaigitgithub - tipdotmd/tip-md-x402-mcp-server 📇 ☁️ 🏠 - MCP server for cryptocurrency tipping through AI interfaces using x402 payment protocol and CDP Wallet.
httpaigitgithub - Tldv - Connect your AI agents to Google-Meet, Zoom & Microsoft Teams through tl;dv
httpaigitgitlab - TMD Earthquake - 🌍 Real-time earthquake monitoring from Thai Meteorological Department. Features magnitude filtering, location-based search (Thai/English), today's events tracking, dangerous earthquake alerts, and comprehensive statistics. Covers regional and global seismic activities.
httpaigitgithubmonitoring - Tmux 🏠 - Interact with your Tmux sessions, windows and pane, execute commands in tmux panes and retrieve result.
httpgitgithub - togello-mcp-server 📜 🏠 - Node.js-based
httpgitgithubjavascriptnpm install Toru-Takagi/togello-mcp-server - todoist-mcp-server-ex 🏠 - MCP server implementation for Todoist in Elixir
elixirmcpservergit clone https://github.com/croesnick/todoist-mcp-server-ex - Todos - A practical todo list manager to use with your favourite chatbot.
httpgitgithub - tomholford/mcp-tic-tac-toe 🏎️ 🏠 🏠 - Play Tic Tac Toe against an AI opponent using this MCP server.
httpaigitgithub - Tommertom/awesome-ionic-mcp 📇 🏠 🏠 - Your Ionic coding buddy enabled via MCP – build awesome mobile apps using React/Angular/Vue or even Vanilla JS!
httpgitgithub - Tommertom/plugwise-mcp 📇 🏠 🍎 🪟 🐧 🏠 - TypeScript-based smart home automation server for Plugwise devices with automatic network discovery. Features comprehensive device control for thermostats, switches, smart plugs, energy monitoring, multi-hub management, and real-time climate/power consumption tracking via local network integration.
localhttpgitgithubmonitoring - Tommertom/sonos-ts-mcp 📇 🏠 🍎 🪟 🐧 🏠 - Comprehensive Sonos audio system control through pure TypeScript implementation. Features complete device discovery, multi-room playback management, queue control, music library browsing, alarm management, real-time event subscriptions, and audio EQ settings. Includes 50+ tools for seamless smart home audio automation via UPnP/SOAP protocols.
httpmlgitgithub - Ton Blockchain MCP - An MCP server for interacting with Ton Blockchain.
httpaigitgithub - tonyzorin/youtrack-mcp 🏠 - Facilitates AI-driven interaction with JetBrains YouTrack for comprehensive issue, project, and user management.
httpaigitgithub - Toolbase - Desktop application that manages tools and MCP servers with just a few clicks - no coding required by gching
httpaigitgithub - ToolHive 🏠 - A lightweight utility designed to simplify the deployment and management of MCP servers, ensuring ease of use, consistency, and security through containerization.
httpaigitgithub - ToolHive 🏠 - A lightweight utility designed to simplify the deployment and management of MCP servers, ensuring ease of use, consistency, and security through containerization
httpaigitgithub - Toos00/freepik-mcp-server 🏠 📇 - Facilitates interaction with Freepik.com's API for image and vector searches using the Model Context Protocol.
apihttpgitgithub - tooyipjee/yahoofinance-mcp 📇 ☁️ 🏠 - TS version of yahoo finance mcp.
httpgitgithub - top-mcp-servers 🏠 - A curated collection of top Model Context Protocol (MCP) servers for enhancing development workflows in 2025
mcpservergit clone https://github.com/djpapzin/top-mcp-servers - topoteretes/cognee 📇 🏠 🏠 - Memory manager for AI apps and Agents using various graph and vector stores and allowing ingestion from 30+ data sources
httpaigitgithub - TouchDesigner - An MCP server for TouchDesigner, enabling interaction with TouchDesigner projects, nodes, and parameters.
httpgitgithub - tqiqbal/mcp-confluence-server 🐍 🏠 📇 - A Model Context Protocol (MCP) server for interacting with Confluence Data Center via REST API.
apiresthttpgitgithub - trackmage/trackmage-mcp-server 📇 🏠 📇 - Shipment tracking api and logistics management capabilities through the [TrackMage API] (https://trackmage.com/)
apihttpgitgithub - Trade-Agent/trade-agent-mcp 🎖️ ☁️ 🏠 - Trade stocks and crypto on common brokerages (Robinhood, ETrade, Coinbase, Kraken) via Trade Agent's MCP server.
httpgitgithub - Transcribe - An MCP server provides fast and reliable transcriptions for audio/video files and voice memos. It allows LLMs to interact with the text content of audio/video file.
filehttpllmgitgithub - Trello 🏠 - Trello integration for working with boards, lists in boards and cards in lists.
httpaigitgithub - Trello MCP Server - An MCP server that interact with user Trello boards, modifying them with prompting.
httpgitgithub - trello-report-mcp 📘 🏠 - A Model Context Protocol (MCP) server for generating Trello board reports by quarter or year. This tool allows you to generate detailed reports of your Trello boards' activity for specific time periods.
httpaimlgitgithubnpm install GuilhermeBarroso-sys/trello-report-mcp - trevorwilkerson_Windows-MCP-Server-Installation-Verification-Guide 🏠 - Mirror of https://github.com/trevorwilkerson/Windows-MCP-Server-Installation-Verification-Guide
mcpserverhttpgit clone https://github.com/MCP-Mirror/trevorwilkerson_Windows-MCP-Server-Installation-Verification-Guide - Triplyfy MCP - An MCP server that lets LLMs plan and manage itineraries with interactive maps in Triplyfy; manage itineraries, places and notes, and search/save flights.
httpaillmgitgithub - TrueNAS Core MCP - An MCP server for interacting with TrueNAS Core.
httpgitgithub - tts-mcp-server 🏠 - A TTS server based on MCP
mcpservergit clone https://github.com/CST2309154/tts-mcp-server - tubasasakunn/context-apps-mcp 📇 🏠 🍎 🪟 🐧 🏠 - AI-powered productivity suite connecting Todo, Idea, Journal, and Timer apps with Claude via Model Context Protocol.
httpaigitgithub - tumf/web3-mcp 🐍 ☁️ 🏠 📇 - An MCP server implementation wrapping Ankr Advanced API. Access to NFT, token, and blockchain data across multiple chains including Ethereum, BSC, Polygon, Avalanche, and more.
apiwebhttpaigit - TuriX Computer Automation MCP - MCP server for helping automation control your computer complete your pre-setting task.
httpaigitgithub - Tyk API Management - Chat with all of your organization's managed APIs and perform other API lifecycle operations, managing tokens, users, analytics, and more.
apihttpgitgithubanalytics - TypeScript MCP SDK
httpgitgithub - uh-joan/cortellis-mcp-server 🏠 - Facilitates drug search and ontology exploration within the Cortellis database, offering comprehensive drug development insights and financial data.
databasehttpgitgithub - ujisati/anki-mcp 🐍 🏠 🏠 - Manage your Anki collection with AnkiConnect & MCP
httpgitgithub - uk-science-museum-group-mcp 🐍 🏠 📇 - MCP Server for the UK Science Museum Group
apihttpllmgitgithubpip install git+https://github.com/opensourcedev90s/uk-science-museum-group-mcp - ukkit/memcord 🐍 🏠 🐧 🍎 🏠 - A MCP server that keeps your chat history organized and searchable—with AI-powered summaries, secure memory, and full control.
httpaigitgithub - UniFi Dream Machine An MCP server that gets your network telemetry from the UniFi Site Manager and your local UniFi router.
localhttpgitgithub - UniProt - Unofficial MCP server for UniProt, providing access to protein sequence data, functional annotations, taxonomic information, and cross-references for proteomics and bioinformatics research.
httpgitgithub - unit-test-generator-mcp-server 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install hanqizheng/unit-test-generator-mcp-server - UnitVectorY-Labs/mcp-graphql-forge 🏎️ ☁️ 🍎 🪟 🐧 🏠 📇 - A lightweight, configuration-driven MCP server that exposes curated GraphQL queries as modular tools, enabling intentional API interactions from your agents.
apigraphqlhttpgitgithub - unity-mcp-for-editor 🔷 🏠 - .NET-based
httpgitgithubc#git clone https://github.com/sinkect/unity-mcp-for-editor - upamune/duckdb-hybrid-doc-search 🏠 - Facilitates hybrid indexing and search of Markdown documents using DuckDB, integrating full-text and vector search capabilities with AI coding agents via an MCP stdio server.
httpaigitgithub - urlbox/urlbox-mcp-server 🏠 📇 - 📇 🏠 A reliable MCP server for generating and managing screenshots, PDFs, and videos, performing AI-powered screenshot analysis, and extracting web content (Markdown, metadata, and HTML) via the Urlbox API.
apiwebhttpaiml - urlDNA 🏠 - Dynamically scan and analyze potentially malicious URLs using the urlDNA
httpgitgithub - us-weather-mcp 🎯 🏠 - I created an MCP server based on the tutorial with Kotlin.
kotlinmcpservergit clone https://github.com/yukinissie/us-weather-mcp - useawsmcp - amazon-q-cli's useaws tool extracted into independent mcp, for general aws api usage.
apihttpawsgitgithub - USPTO - MCP server for accessing United States Patent & Trademark Office data through its Open Data Protocol (ODP) API.
apihttpgitgithub - vakharwalad23/google-mcp 📇 ☁️ 🏠 - Collection of Google-native tools (Gmail, Calendar, Drive, Tasks) for MCP with OAuth management, automated token refresh, and auto re-authentication capabilities.
authoauthhttpaigit - variablenigh/excel-mcp-server 🏠 - Facilitates reading and writing spreadsheet data to MS Excel files using the Model Context Protocol.
filehttpgitgithub - vasayxtx/mcp-prompt-engine 🏎️ 🏠 🪟️ 🐧 🍎 🏠 - MCP server for managing and serving dynamic prompt templates using elegant and powerful text template engine.
httpgitgithub - vc-mcp 🏠 - MCP Server for VidiCore
mcpservergit clone https://github.com/prithviraj/vc-mcp - Vectara - Query Vectara's trusted RAG-as-a-service platform.
httpgitgithub - Vectorize - Vectorize MCP server for advanced retrieval, Private Deep Research, Anything-to-Markdown file extraction and text chunking.
filehttpgitgithub - VertexStudio/developer 🦀 🏠 🍎 🪟 🐧 🏠 - Comprehensive developer tools for file editing, shell command execution, and screen capture capabilities
filehttpgitgithub - Vertica - Vertica database integration in Python with configurable access controls and schema inspection
databasehttpgitgithub - Video Still Capture - 📷 Capture video stills from an OpenCV-compatible webcam or other video source.
webhttpgitgithub - video-creator/ffmpeg-mcp 🎥 🔊 🏠 - Using ffmpeg command line to achieve an mcp server, can be very convenient, through the dialogue to achieve the local video search, tailoring, stitching, playback and other functions
localhttpaigitgithub - vimble-mcp 📜 🏠 - A Model Context Protocol (MCP) server for executing JavaScript code using Vimble.
httpgitgithubjavascriptmcpnpm install johnhenry/vimble-mcp - VISO TRUST 🏠 - Access and manage your VISO TRUST third-party risk program directly through your AI assistant.
httpaigitgithub - vitorpavinato/ncbi-mcp-server 🐍 ☁️ 🏠 🏠 - Comprehensive NCBI/PubMed literature search server with advanced analytics, caching, MeSH integration, related articles discovery, and batch processing for all life sciences and biomedical research.
httpgitgithubanalytics - VmLia/books-mcp-server 📇 ☁️ 🏠 - This is an MCP server used for querying books, and it can be applied in common MCP clients, such as Cherry Studio.
httpmlgitgithub - VMware Fusion - Manage VMware Fusion virtual machines via the Fusion REST API.
apiresthttpgitgithub - Voice Status Report - An MCP server that provides voice status updates using OpenAI's text-to-speech API, to be used with Cursor or Claude Code.
apihttpaiopenaigit - VoiceMode - Enable voice conversations with Claude using any OpenAI-compatible STT/TTS service getvoicemode.com
httpaiopenaigitgithub - VPS-MCP-SERVER 🐚 🏠 - Servidor VPS MCP para gerenciamento de projetos
httpgitgithubshellmcpgit clone https://github.com/LuizBranco-ClickHype/VPS-MCP-SERVER - VpunaAiSearch 🏠 ☁️ - Connect to Vpuna AI Search Service, a developer first platform for semantic search, summarization, and contextual chat. Each project dynamically exposes its own Remote HTTP MCP server, enabling real-time context injection from structured and unstructured data.
remotehttpaigitgithub - vscode-ai-model-detector - Real-time AI model detection for VS Code Copilot with 100% accuracy. Enables proper git attribution by identifying active models (Claude, GPT, Gemini) via Chat Participant API.
apihttpaigitgithub - Vulert - Vulert secures software by detecting vulnerabilities in open-source dependencies—without accessing your code. It supports Js, PHP, Java, Python, and more.
http - vulnicheck - Real-time Python package vulnerability scanner that checks dependencies against OSV and NVD databases, providing comprehensive security analysis with CVE details, lock file support, and actionable upgrade recommendations.
databasefilehttpaigit - Wanaku MCP Router - The Wanaku MCP Router is a SSE-based MCP server that provides an extensible routing engine that allows integrating your enterprise systems with AI agents.
httpaigitgithub - wanaku-ai/wanaku 🏠 - ☁️ 🏠 The Wanaku MCP Router is a SSE-based MCP server that provides an extensible routing engine that allows integrating your enterprise systems with AI agents.
httpaigitgithub - WayStation - A universal remote MCP server that connects to popular productivity tools such as Notion, Monday, AirTable, and many more.
remotehttpai - weather-forecast-mcp-server 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install 93minki/weather-forecast-mcp-server - weather-mcp-server - Get real-time weather data for any location using weatherapi.
apihttpgitgithubai - Web Search MCP - A server that provides full web search, summaries and page extration for use with Local LLMs.
weblocalhttpllmgit - WebDataSource - Web Crawler for AI Agents. Supercharge your AI agents with an MCP-ready web crawler that delivers real-time insights from the web and your private knowledge bases.
webhttpaiml - Webex - A Model Context Protocol (MCP) server that provides AI assistants with comprehensive access to Cisco Webex messaging capabilities.
webhttpaimlgit - Webvizio/mcp 🎖️ 📇 🏠 - Automatically converts feedback and bug reports from websites and web apps into actionable, context-enriched developer tasks. Delivered straight to your AI coding tools, the Webvizio MCP Server ensures your AI agent has all the data it needs to solve tasks with speed and accuracy.
webhttpaigitgithub - weibaohui/kom 🏎️ ☁️/🏠 🏠 - Provides MCP multi-cluster Kubernetes management and operations. It can be integrated as an SDK into your own project and includes nearly 50 built-in tools covering common DevOps and development scenarios. Supports both standard and CRD resources.
httpkubernetesgitgithub - welcome-mcp-server 🏠 - A server repository created using MCP
mcpservergit clone https://github.com/readerszone/welcome-mcp-server - wewei/skill-set 📘 🏠 - A Model Context Protocol server built with mcp-framework, enabling the creation and integration of custom tools for enhanced functionality.
httpgitgithub - Whaleylaw/pydanticaimcpneo4j 🏠 - Integrate AI agents with MCP servers using Pydantic AI for seamless tool access and dynamic discovery.
httpaimlgitgithub - wheather-mcp-server 📘 🏠 - A custom weather mcp server , which can be connected through claude desktop , to extract wheather alerts or information just by prompting with name of location .
httpgitgithubtypescriptmcpnpm install sneharao/wheather-mcp-server - Wikidata MCP - Wikidata MCP server that interact with Wikidata, by searching identifiers, extracting metadata, and executing sparql query.
httpgitgithub - Wikidata SPARQL - Unofficial REMOTE MCP server for Wikidata's SPARQL endpoint, providing access to structured knowledge data, entity relationships, and semantic queries for research and data analysis.
remotehttpgitgithub - Wikifunctions - Allowing AI models to discover and execute functions from the WikiFunctions library.
httpaigitgithub - Willi MaKo Knowledge Service - A knowledge service for Germany's complex Energy Market Communications (MaKo) regulations.
http - willvelida/mcp-afl-server ☁️ 🏠 📇 - MCP server that integrates with the Squiggle API to provide information on Australian Football League teams, ladder standings, results, tips, and power rankings.
apihttpgitgithub - win4r_Awesome-Claude-MCP-Servers 🏠 - Mirror of https://github.com/win4r/Awesome-Claude-MCP-Servers
mcpserverhttpgit clone https://github.com/MCP-Mirror/win4r_Awesome-Claude-MCP-Servers - Windsor - Windsor MCP (Model Context Protocol) enables your LLM to query, explore, and analyze your full-stack business data integrated into Windsor.ai with zero SQL writing or custom scripting.
httpaillmgitgithub - Wooonster/hocrmcpserver 🐍 🏠 🏠 📇 - A fastAPI-based FastMCP server with a Vue frontend that sends uploaded images to VLM via the MCP to quickly extract handwritten mathematical formulas as clean LaTeX code.
apihttpgitgithub - Wordle MCP - MCP Server that gets the Wordle Solution for a particular date.
httpgitgithub - WordPress MCP - Make your WordPress site into a simple MCP server, exposing functionality to LLMs and AI agents.
httpaillmgitgithub - WordPress MCP Adapter - An MCP adapter that bridges the Abilities API to the Model Context Protocol, enabling MCP clients to discover and invoke WordPress plugin, theme, and core abilities programmatically.
apihttpgitgithub - Workflowy - A server that interacts with workflowy.
httpgitgithub - wowinter13/solscan-mcp 🦀 🏠 🏠 📇 - An MCP tool for querying Solana transactions using natural language with Solscan API.
apihttpgitgithub - Wren Engine - The Semantic Engine for Model Context Protocol(MCP) Clients and AI Agents
httpaigitgithub - writers-muse-mcp 🏠 - An MCP server that analyses a writer’s style and generates a blog post.
mcpservergit clone https://github.com/bmmunga/writers-muse-mcp - wyattjoh/jsr-mcp 📇 ☁️ 🏠 - Model Context Protocol server for the JSR (JavaScript Registry)
httpgitgithub - X (Twitter) 🏠 📇 - Enhanced MCP server for Twitter/X with OAuth 2.0 support, v2 API media uploads, smart v1.1 fallbacks, and comprehensive rate limiting. Post tweets with text/media, search, and delete tweets programmatically.
apiauthoauthhttpgit - Xcode-mcp-server (by drewster99) - Best Xcode integration - ClaudeCode and Cursor can build your project with Xcode and see the same errors you do. Fast easy setup.
httpgitgithub - xcodebuild - 🍎 Build iOS Xcode workspace/project and feed back errors to llm.
httpaillmgitgithub - xcsimctl 🏠 - 🍎 Manage Xcode simulators.
httpgitgithub - xctools 🏠 - 🍎 MCP server for Xcode's xctrace, xcrun, xcodebuild.
httpgitgithub - Xinruims/myexperiment 🏠 - Enhance Roo Code with MCP server implementations for AI-driven coding tools, offering seamless integration and configuration across platforms.
httpaimlgitgithub - XRAY 🏠 - Progressive code-intelligence server: lets AI assistants map structure, fuzzy-find symbols, and assess change-impact across Python, JS/TS, and Go codebases (powered by ast-grep)
httpaigitgithub - xspadex/bilibili-mcp 📇 🏠 🏠 - A FastMCP-based tool that fetches Bilibili's trending videos and exposes them via a standard MCP interface.
httpgitgithub - Yahoo Finance - 📈 Lets your AI interact with Yahoo Finance to get comprehensive stock market data, news, financials, and more. Proxy supported.
httpaigitgithub - yamanoku/baseline-mcp-server 📇 🏠 🏠 📇 - MCP server that searches Baseline status using Web Platform API
apiwebhttpgitgithub - yamcp 🏠 - A Model Context Workspace Manager. Oraganize your MCP servers in local workspaces (coding, design, research, ...), scan, monitor, and integrate each workspace with AI apps via a unified CLI.
localhttpaigitgithub - YangLiangwei/PersonalizationMCP 🐍 ☁️ 🏠 🍎 🪟 🐧 🏠 - Comprehensive personal data aggregation MCP server with Steam, YouTube, Bilibili, Spotify, Reddit and other platforms integrations. Features OAuth2 authentication, automatic token management, and 90+ tools for gaming, music, video, and social platform data access.
authoauthhttpgitgithub - YetiBrowser MCP - A fully open-source implementation of the Browser MCP workflow with standout features such as optimized screenshots, dom diffs, console access, multi-websocket support + more.
webwebsockethttpgitgithub - yfinance -💹The MCP YFinance Stock Server provides real-time and historical stock data in a standard format, powering dashboards, AI agents,and research tools with seamless financial insights.
httpaimlgitgithub - ygocdb-mcp 📜 🏠 📇 - 用于与游戏王中文卡查百鸽(ygocdb.com)API交互的MCP服务端
apidatabasehttpgitgithubnpm install lieyanqzu/ygocdb-mcp - yiwenlu66/PiloTY 🐍 🏠 🏠 - AI pilot for PTY operations enabling agents to control interactive terminals with stateful sessions, SSH connections, and background process management
httpaigitgithub - YNAB - A Model Context Protocol (MCP) server for integrating with YNAB (You Need A Budget), allowing AI assistants to securely access and analyze your financial data.
httpaigitgithub - ynab_mcp 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install ivorpad/ynab_mcp - YO-mcp 📘 🏠 - TypeScript-based
httpgitgithubtypescriptnpm install CristianCiubancan/YO-mcp - yodablocks/mcp-installer.0 📜 🏠 - Facilitates the installation of MCP servers from npm or PyPi using Claude, streamlining server setup processes.
httpmlgitgithub - YouTube - Extract Youtube video information (with proxies support).
httpaigitgithub - YouTube DLP - Retrieve video information, subtitles, and top comments with proxies.
httpaigitgithub - YouTube MCP - Create playlists from song lists with OAuth2. Search videos, manage playlists, let AI curate your YouTube collections.
authoauthhttpaigit - YouTube Video Summarizer - Summarize lengthy youtube videos.
httpgitgithub - youtube-mcp-server 📘 🏠 - A FastMCP server for YouTube: unified video/channel/playlist info, download, and management tools for memo agents and automation.
httpgitgithubtypescriptmcpnpm install stephen9412/youtube-mcp-server - youtube-mp3-mcp 📘 🏠 - TypeScript-based
httpmlgitgithubtypescriptnpm install bads1de/youtube-mp3-mcp - Yuga Planner 🏠 - AI Task schedule planning with LLamaIndex and Timefold: breaks down a task description and schedules it around an existing calendar
httpaigitgithub - Yutarop/ros-mcp 🐍 🏠 🐧 🏠 - MCP server that supports ROS2 topics, services, and actions communication, and controls robots using natural language.
httpgitgithub - yutu - A fully functional MCP server and CLI for YouTube to automate YouTube operation.
httpaigitgithub - ZapCap - MCP server for ZapCap API providing video caption and B-roll generation via natural language
apihttpgitgithub - Zapier - Connect your AI Agents to 8,000 apps instantly.
apihttpai - zcaceres/markdownify-mcp 📇 🏠 🏠 - An MCP server to convert almost any file or web content into Markdown
webfilehttpgitgithub - Zed multiplayer code editor from the creators of atom 🏠
httpgitgithub - Zenable - Clean up sloppy AI code and prevent vulnerabilities
httpai - Zettelkasten- Comprehensive AI-powered knowledge management system implementing the Zettelkasten method. Features atomic note creation, full-text search, AI-powered CEQRC workflows (Capture→Explain→Question→Refine→Connect), intelligent link discovery, and multi-interface access (CLI, API, Web UI, MCP). Perfect for researchers, students, and knowledge workers.
apiwebhttpaigit - zhipu-web-search-mcp 🐍 🏠 - 基于智普AI的web网络搜索MCP工具 (Python-based)
webhttpaigitgithubpip install git+https://github.com/qianlima365/zhipu-web-search-mcp - zhsama/duckduckgo-mcp-server 📇 🏠 ☁️ 🏠 - This is a TypeScript-based MCP server that provides DuckDuckGo search functionality.
httpgitgithub - zillow/auto-mobile 📇 🏠 🐧 🏠 - Tool suite built around an MCP server for Android automation for developer workflow and testing
httpgitgithub - ZincBind - Unofficial MCP server for ZincBind, providing access to a comprehensive database of zinc binding sites in proteins, structural coordination data, and metalloproteomics research information.
databasehttpgitgithub - zinja-coder/jadx-ai-mcp ☕ 🏠 🏠 - JADX-AI-MCP is a plugin and MCP Server for the JADX decompiler that integrates directly with Model Context Protocol (MCP) to provide live reverse engineering support with LLMs like Claude.
httpaillmgitgithub - zolo-ryan/MarketAuxMcpServer 📇 ☁️ 🏠 - MCP server for comprehensive market and financial news search with advanced filtering by symbols, industries, countries, and date ranges.
httpgitgithub - Zoom - Create, update, read and delete your zoom meetings.
httpaigitgithub - zoomeye-mcp-server 📘 🏠 📇 - ZoomEye MCP Server - 网络资产搜索与用户信息查询
apiwebhttpaigitnpm install help116114/zoomeye-mcp-server
ℹ️ About
This awesome list is automatically generated and regularly updated to ensure you have access to the latest and most comprehensive collection of MCP servers available.
🤝 Contributing
This list is automatically generated and updated. To add your MCP server:
📝 Submit via JSON (Recommended)
- Fork this repository
- Copy
contributions/template.jsontocontributions/your-server-name.json - Fill in your MCP server details
- Submit a Pull Request
📋 Submit via Issue
Create an issue with your MCP server information using our template.
Requirements: Must be a legitimate MCP server with public source code and documentation.
📄 License
This project is licensed under the MIT License - see the LICENSE file for details.
This awesome list was automatically generated and last updated on 2025-10-28T21:54:39.281Z.